Citrus Sinensis ID: 042283
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| 225434396 | 478 | PREDICTED: alanine--glyoxylate aminotran | 0.987 | 0.169 | 0.726 | 3e-28 | |
| 297745799 | 436 | unnamed protein product [Vitis vinifera] | 0.987 | 0.185 | 0.726 | 3e-28 | |
| 255580991 | 480 | alanine-glyoxylate aminotransferase, put | 0.987 | 0.168 | 0.690 | 1e-27 | |
| 224140569 | 479 | predicted protein [Populus trichocarpa] | 0.987 | 0.169 | 0.714 | 1e-27 | |
| 224091092 | 477 | predicted protein [Populus trichocarpa] | 0.987 | 0.169 | 0.714 | 1e-27 | |
| 449464422 | 477 | PREDICTED: alanine--glyoxylate aminotran | 0.987 | 0.169 | 0.690 | 3e-27 | |
| 15231974 | 481 | PYRIMIDINE 4 [Arabidopsis thaliana] gi|7 | 0.987 | 0.168 | 0.690 | 5e-27 | |
| 356506738 | 475 | PREDICTED: alanine--glyoxylate aminotran | 0.987 | 0.170 | 0.654 | 1e-26 | |
| 356496283 | 475 | PREDICTED: alanine--glyoxylate aminotran | 0.987 | 0.170 | 0.654 | 2e-26 | |
| 356568186 | 482 | PREDICTED: alanine--glyoxylate aminotran | 0.987 | 0.168 | 0.654 | 2e-26 |
| >gi|225434396|ref|XP_002270785.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 129 bits (323), Expect = 3e-28, Method: Composition-based stats.
Identities = 61/84 (72%), Positives = 70/84 (83%), Gaps = 3/84 (3%)
Query: 1 DKYGTIGDARGWGFMLGVEFVTDSQLR---KAETLDVMDKMKQMGVLIGKGGFYGNVFRI 57
+K+ IGD RG G MLGVE VTD QL+ K ETL VMDKMK+MGVLIGKGGFYGNVFRI
Sbjct: 394 EKHEIIGDVRGRGLMLGVELVTDRQLKTPAKVETLHVMDKMKEMGVLIGKGGFYGNVFRI 453
Query: 58 APPLCFTKEDANYLVDVMDCSMTK 81
PPLCFTKEDA++LVDVMD +M++
Sbjct: 454 TPPLCFTKEDADFLVDVMDYTMSR 477
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297745799|emb|CBI15855.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255580991|ref|XP_002531313.1| alanine-glyoxylate aminotransferase, putative [Ricinus communis] gi|223529081|gb|EEF31063.1| alanine-glyoxylate aminotransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224140569|ref|XP_002323655.1| predicted protein [Populus trichocarpa] gi|222868285|gb|EEF05416.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224091092|ref|XP_002309175.1| predicted protein [Populus trichocarpa] gi|222855151|gb|EEE92698.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449464422|ref|XP_004149928.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15231974|ref|NP_187498.1| PYRIMIDINE 4 [Arabidopsis thaliana] gi|75313797|sp|Q9SR86.1|AGT23_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial; AltName: Full=Beta-alanine-pyruvate aminotransferase 3; Flags: Precursor gi|6403506|gb|AAF07846.1|AC010871_22 putative aminotransferase [Arabidopsis thaliana] gi|20466700|gb|AAM20667.1| putative aminotransferase [Arabidopsis thaliana] gi|110740902|dbj|BAE98547.1| aminotransferase like protein [Arabidopsis thaliana] gi|332641167|gb|AEE74688.1| PYRIMIDINE 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356506738|ref|XP_003522133.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356496283|ref|XP_003516998.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356568186|ref|XP_003552294.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| TAIR|locus:2097623 | 481 | PYD4 "PYRIMIDINE 4" [Arabidops | 0.987 | 0.168 | 0.690 | 9.8e-26 | |
| TAIR|locus:2135237 | 476 | AGT2 "alanine:glyoxylate amino | 0.975 | 0.168 | 0.481 | 1.5e-18 | |
| UNIPROTKB|F1NQJ1 | 479 | AGXT2 "Uncharacterized protein | 0.987 | 0.169 | 0.423 | 1.7e-14 | |
| ZFIN|ZDB-GENE-050913-100 | 517 | agxt2 "alanine-glyoxylate amin | 0.926 | 0.147 | 0.487 | 2e-14 | |
| WB|WBGene00020382 | 444 | T09B4.8 [Caenorhabditis elegan | 0.865 | 0.159 | 0.479 | 3.9e-14 | |
| UNIPROTKB|E2QZD7 | 514 | AGXT2 "Uncharacterized protein | 0.902 | 0.143 | 0.435 | 5e-13 | |
| UNIPROTKB|Q5E9S4 | 497 | AGXT2L1 "Ethanolamine-phosphat | 0.963 | 0.158 | 0.414 | 2e-11 | |
| UNIPROTKB|F6XN94 | 397 | AGXT2L1 "Uncharacterized prote | 0.963 | 0.198 | 0.426 | 2.1e-11 | |
| FB|FBgn0037186 | 518 | CG11241 [Drosophila melanogast | 0.914 | 0.144 | 0.392 | 2.1e-11 | |
| UNIPROTKB|H9KZQ5 | 415 | H9KZQ5 "Uncharacterized protei | 0.963 | 0.190 | 0.390 | 2.3e-11 |
| TAIR|locus:2097623 PYD4 "PYRIMIDINE 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 295 (108.9 bits), Expect = 9.8e-26, P = 9.8e-26
Identities = 58/84 (69%), Positives = 68/84 (80%)
Query: 1 DKYGTIGDARGWGFMLGVEFVTDSQLR---KAETLDVMDKMKQMGVLIGKGGFYGNVFRI 57
+KY IGD RG G MLGVEFV D L+ KAETL +MD+MK+MGVL+GKGGFYGNVFRI
Sbjct: 397 NKYELIGDVRGRGLMLGVEFVKDRDLKTPAKAETLHLMDQMKEMGVLVGKGGFYGNVFRI 456
Query: 58 APPLCFTKEDANYLVDVMDCSMTK 81
PPLCFT DA++LVDVMD +M+K
Sbjct: 457 TPPLCFTLSDADFLVDVMDHAMSK 480
|
|
| TAIR|locus:2135237 AGT2 "alanine:glyoxylate aminotransferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQJ1 AGXT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050913-100 agxt2 "alanine-glyoxylate aminotransferase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00020382 T09B4.8 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZD7 AGXT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E9S4 AGXT2L1 "Ethanolamine-phosphate phospho-lyase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XN94 AGXT2L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037186 CG11241 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9KZQ5 H9KZQ5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| COG0160 | 447 | COG0160, GabT, 4-aminobutyrate aminotransferase an | 5e-22 | |
| cd00610 | 413 | cd00610, OAT_like, Acetyl ornithine aminotransfera | 1e-18 | |
| PRK06148 | 1013 | PRK06148, PRK06148, hypothetical protein; Provisio | 4e-17 | |
| PRK06149 | 972 | PRK06149, PRK06149, hypothetical protein; Provisio | 5e-16 | |
| PRK07678 | 451 | PRK07678, PRK07678, aminotransferase; Validated | 1e-13 | |
| COG4992 | 404 | COG4992, ArgD, Ornithine/acetylornithine aminotran | 8e-13 | |
| PRK08117 | 433 | PRK08117, PRK08117, 4-aminobutyrate aminotransfera | 1e-11 | |
| PRK02627 | 396 | PRK02627, PRK02627, acetylornithine aminotransfera | 2e-11 | |
| PRK07481 | 449 | PRK07481, PRK07481, hypothetical protein; Provisio | 5e-11 | |
| PRK05639 | 457 | PRK05639, PRK05639, 4-aminobutyrate aminotransfera | 3e-10 | |
| PRK08360 | 443 | PRK08360, PRK08360, 4-aminobutyrate aminotransfera | 5e-10 | |
| COG0161 | 449 | COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon | 7e-10 | |
| PRK08593 | 445 | PRK08593, PRK08593, 4-aminobutyrate aminotransfera | 9e-10 | |
| PRK05769 | 441 | PRK05769, PRK05769, 4-aminobutyrate aminotransfera | 2e-09 | |
| PRK06058 | 443 | PRK06058, PRK06058, 4-aminobutyrate aminotransfera | 4e-09 | |
| PRK06917 | 447 | PRK06917, PRK06917, hypothetical protein; Provisio | 7e-09 | |
| PRK06918 | 451 | PRK06918, PRK06918, 4-aminobutyrate aminotransfera | 2e-08 | |
| TIGR00707 | 379 | TIGR00707, argD, transaminase, acetylornithine/suc | 1e-06 | |
| TIGR00700 | 420 | TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf | 1e-06 | |
| PRK07036 | 466 | PRK07036, PRK07036, hypothetical protein; Provisio | 1e-06 | |
| PRK08088 | 425 | PRK08088, PRK08088, 4-aminobutyrate aminotransfera | 2e-06 | |
| PRK07495 | 425 | PRK07495, PRK07495, 4-aminobutyrate aminotransfera | 3e-06 | |
| PRK06938 | 464 | PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat | 3e-06 | |
| PRK06931 | 459 | PRK06931, PRK06931, diaminobutyrate--2-oxoglutarat | 5e-06 | |
| PRK06082 | 459 | PRK06082, PRK06082, 4-aminobutyrate aminotransfera | 6e-06 | |
| TIGR01885 | 401 | TIGR01885, Orn_aminotrans, ornithine aminotransfer | 6e-06 | |
| PRK01278 | 389 | PRK01278, argD, acetylornithine transaminase prote | 6e-06 | |
| PRK07482 | 461 | PRK07482, PRK07482, hypothetical protein; Provisio | 2e-05 | |
| PRK00854 | 401 | PRK00854, rocD, ornithine--oxo-acid transaminase; | 5e-05 | |
| PLN00144 | 382 | PLN00144, PLN00144, acetylornithine transaminase | 6e-05 | |
| PRK06062 | 451 | PRK06062, PRK06062, hypothetical protein; Provisio | 6e-05 | |
| TIGR00709 | 442 | TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase | 8e-05 | |
| PRK04260 | 375 | PRK04260, PRK04260, acetylornithine aminotransfera | 1e-04 | |
| PRK06777 | 421 | PRK06777, PRK06777, 4-aminobutyrate aminotransfera | 2e-04 | |
| PRK05965 | 459 | PRK05965, PRK05965, hypothetical protein; Provisio | 5e-04 | |
| PRK06916 | 460 | PRK06916, PRK06916, adenosylmethionine--8-amino-7- | 5e-04 | |
| PTZ00125 | 400 | PTZ00125, PTZ00125, ornithine aminotransferase-lik | 7e-04 | |
| PRK04073 | 396 | PRK04073, rocD, ornithine--oxo-acid transaminase; | 0.001 | |
| PRK02936 | 377 | PRK02936, argD, acetylornithine aminotransferase; | 0.002 |
| >gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Score = 87.3 bits (217), Expect = 5e-22
Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
Query: 1 DKYGTIGDARGWGFMLGVEFVTDSQLRK---AETLDVMDKMKQMGVLIGKGGFYGNVFRI 57
+K+ IGD RG G M+GVE V D ++ ++ + + G+L+ G +GNV RI
Sbjct: 362 EKHPLIGDVRGLGLMIGVELVKDRDTKEPDAELAAKIVARAFERGLLLLTCGPHGNVLRI 421
Query: 58 APPLCFTKEDANYLVDVMD 76
PPL + E+ + +D+++
Sbjct: 422 LPPLTISDEELDEGLDILE 440
|
Length = 447 |
| >gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235716 PRK06149, PRK06149, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235884 PRK06917, PRK06917, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family | Back alignment and domain information |
|---|
| >gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >gnl|CDD|235913 PRK07036, PRK07036, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235889 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236026 PRK07482, PRK07482, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases | Back alignment and domain information |
|---|
| >gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| COG0160 | 447 | GabT 4-aminobutyrate aminotransferase and related | 99.91 | |
| KOG1404 | 442 | consensus Alanine-glyoxylate aminotransferase AGT2 | 99.82 | |
| COG0161 | 449 | BioA Adenosylmethionine-8-amino-7-oxononanoate ami | 99.81 | |
| COG4992 | 404 | ArgD Ornithine/acetylornithine aminotransferase [A | 99.81 | |
| PRK08742 | 472 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.78 | |
| PRK06938 | 464 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.77 | |
| PRK07483 | 443 | hypothetical protein; Provisional | 99.77 | |
| TIGR00709 | 442 | dat 2,4-diaminobutyrate 4-transaminases. This fami | 99.76 | |
| PRK07495 | 425 | 4-aminobutyrate aminotransferase; Provisional | 99.75 | |
| PRK04013 | 364 | argD acetylornithine/acetyl-lysine aminotransferas | 99.75 | |
| PRK06931 | 459 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.75 | |
| PRK05630 | 422 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.75 | |
| PRK06082 | 459 | 4-aminobutyrate aminotransferase; Provisional | 99.74 | |
| PRK05965 | 459 | hypothetical protein; Provisional | 99.74 | |
| PRK05639 | 457 | 4-aminobutyrate aminotransferase; Provisional | 99.74 | |
| PRK06943 | 453 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.73 | |
| PRK06149 | 972 | hypothetical protein; Provisional | 99.73 | |
| PRK06105 | 460 | aminotransferase; Provisional | 99.73 | |
| PRK06058 | 443 | 4-aminobutyrate aminotransferase; Provisional | 99.72 | |
| PRK06917 | 447 | hypothetical protein; Provisional | 99.72 | |
| PRK07030 | 466 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.71 | |
| PRK06148 | 1013 | hypothetical protein; Provisional | 99.7 | |
| PRK07480 | 456 | putative aminotransferase; Validated | 99.7 | |
| PRK07986 | 428 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.7 | |
| PRK07481 | 449 | hypothetical protein; Provisional | 99.7 | |
| PRK12403 | 460 | putative aminotransferase; Provisional | 99.7 | |
| PRK07036 | 466 | hypothetical protein; Provisional | 99.7 | |
| PRK07482 | 461 | hypothetical protein; Provisional | 99.69 | |
| PRK06916 | 460 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.69 | |
| TIGR03372 | 442 | putres_am_tran putrescine aminotransferase. Member | 99.68 | |
| PRK06173 | 429 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.68 | |
| PLN02760 | 504 | 4-aminobutyrate:pyruvate transaminase | 99.68 | |
| PRK07678 | 451 | aminotransferase; Validated | 99.68 | |
| PRK09221 | 445 | beta alanine--pyruvate transaminase; Provisional | 99.67 | |
| KOG1403 | 452 | consensus Predicted alanine-glyoxylate aminotransf | 99.66 | |
| PRK11522 | 459 | putrescine--2-oxoglutarate aminotransferase; Provi | 99.66 | |
| PRK08593 | 445 | 4-aminobutyrate aminotransferase; Provisional | 99.66 | |
| PRK09792 | 421 | 4-aminobutyrate transaminase; Provisional | 99.65 | |
| PRK06062 | 451 | hypothetical protein; Provisional | 99.65 | |
| PRK13360 | 442 | omega amino acid--pyruvate transaminase; Provision | 99.65 | |
| PRK06777 | 421 | 4-aminobutyrate aminotransferase; Provisional | 99.65 | |
| PRK04612 | 408 | argD acetylornithine transaminase protein; Provisi | 99.64 | |
| PRK08360 | 443 | 4-aminobutyrate aminotransferase; Provisional | 99.64 | |
| KOG1402 | 427 | consensus Ornithine aminotransferase [Amino acid t | 99.64 | |
| PRK05769 | 441 | 4-aminobutyrate aminotransferase; Provisional | 99.63 | |
| PRK06541 | 460 | hypothetical protein; Provisional | 99.63 | |
| TIGR00699 | 464 | GABAtrns_euk 4-aminobutyrate aminotransferase, euk | 99.61 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 99.61 | |
| TIGR02407 | 412 | ectoine_ectB diaminobutyrate--2-oxoglutarate amino | 99.59 | |
| PRK08117 | 433 | 4-aminobutyrate aminotransferase; Provisional | 99.56 | |
| PRK08297 | 443 | L-lysine aminotransferase; Provisional | 99.55 | |
| TIGR00700 | 420 | GABAtrnsam 4-aminobutyrate aminotransferase, proka | 99.54 | |
| PRK06918 | 451 | 4-aminobutyrate aminotransferase; Reviewed | 99.54 | |
| TIGR00508 | 427 | bioA adenosylmethionine-8-amino-7-oxononanoate tra | 99.52 | |
| PRK05964 | 423 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.51 | |
| PRK03715 | 395 | argD acetylornithine transaminase protein; Provisi | 99.5 | |
| TIGR03251 | 431 | LAT_fam L-lysine 6-transaminase. Characterized mem | 99.48 | |
| PRK09264 | 425 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.47 | |
| PLN00144 | 382 | acetylornithine transaminase | 99.47 | |
| PRK08088 | 425 | 4-aminobutyrate aminotransferase; Validated | 99.42 | |
| TIGR03246 | 397 | arg_catab_astC succinylornithine transaminase fami | 99.41 | |
| PRK12381 | 406 | bifunctional succinylornithine transaminase/acetyl | 99.41 | |
| PLN02624 | 474 | ornithine-delta-aminotransferase | 99.36 | |
| PRK03244 | 398 | argD acetylornithine aminotransferase; Provisional | 99.34 | |
| PRK04073 | 396 | rocD ornithine--oxo-acid transaminase; Provisional | 99.31 | |
| TIGR01885 | 401 | Orn_aminotrans ornithine aminotransferase. This mo | 99.29 | |
| PRK01278 | 389 | argD acetylornithine transaminase protein; Provisi | 99.28 | |
| PTZ00125 | 400 | ornithine aminotransferase-like protein; Provision | 99.18 | |
| PRK04260 | 375 | acetylornithine aminotransferase; Provisional | 99.13 | |
| PRK12389 | 428 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.12 | |
| PRK02936 | 377 | argD acetylornithine aminotransferase; Provisional | 99.12 | |
| PRK00854 | 401 | rocD ornithine--oxo-acid transaminase; Reviewed | 99.11 | |
| PRK00062 | 426 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.1 | |
| PRK02627 | 396 | acetylornithine aminotransferase; Provisional | 99.07 | |
| PRK05093 | 403 | argD bifunctional N-succinyldiaminopimelate-aminot | 99.04 | |
| TIGR00713 | 423 | hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi | 99.02 | |
| PRK07046 | 453 | aminotransferase; Validated | 98.96 | |
| PLN03227 | 392 | serine palmitoyltransferase-like protein; Provisio | 98.94 | |
| KOG1405 | 484 | consensus 4-aminobutyrate aminotransferase [Amino | 98.92 | |
| cd00610 | 413 | OAT_like Acetyl ornithine aminotransferase family. | 98.87 | |
| PRK07505 | 402 | hypothetical protein; Provisional | 98.65 | |
| PLN02482 | 474 | glutamate-1-semialdehyde 2,1-aminomutase | 98.55 | |
| PRK06209 | 431 | glutamate-1-semialdehyde 2,1-aminomutase; Provisio | 98.53 | |
| PRK00615 | 433 | glutamate-1-semialdehyde aminotransferase; Provisi | 98.51 | |
| TIGR00707 | 379 | argD acetylornithine and succinylornithine aminotr | 98.46 | |
| PRK13393 | 406 | 5-aminolevulinate synthase; Provisional | 98.34 | |
| PRK07179 | 407 | hypothetical protein; Provisional | 98.04 | |
| PRK05958 | 385 | 8-amino-7-oxononanoate synthase; Reviewed | 97.99 | |
| TIGR01821 | 402 | 5aminolev_synth 5-aminolevulinic acid synthase. Th | 97.95 | |
| TIGR01825 | 385 | gly_Cac_T_rel pyridoxal phosphate-dependent acyltr | 97.8 | |
| PRK09064 | 407 | 5-aminolevulinate synthase; Validated | 97.76 | |
| KOG1401 | 433 | consensus Acetylornithine aminotransferase [Amino | 97.62 | |
| TIGR01814 | 406 | kynureninase kynureninase. This model describes ky | 97.5 | |
| PLN02721 | 353 | threonine aldolase | 97.41 | |
| TIGR03301 | 355 | PhnW-AepZ 2-aminoethylphosphonate aminotransferase | 97.39 | |
| PRK13520 | 371 | L-tyrosine decarboxylase; Provisional | 97.33 | |
| PRK06939 | 397 | 2-amino-3-ketobutyrate coenzyme A ligase; Provisio | 97.29 | |
| PRK13392 | 410 | 5-aminolevulinate synthase; Provisional | 97.28 | |
| cd00613 | 398 | GDC-P Glycine cleavage system P-protein, alpha- an | 97.21 | |
| cd06451 | 356 | AGAT_like Alanine-glyoxylate aminotransferase (AGA | 97.18 | |
| cd06502 | 338 | TA_like Low-specificity threonine aldolase (TA). T | 97.1 | |
| TIGR00858 | 360 | bioF 8-amino-7-oxononanoate synthase. This model r | 97.02 | |
| PRK05937 | 370 | 8-amino-7-oxononanoate synthase; Provisional | 96.96 | |
| cd06454 | 349 | KBL_like KBL_like; this family belongs to the pyri | 96.93 | |
| TIGR03812 | 373 | tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe | 96.72 | |
| PLN02483 | 489 | serine palmitoyltransferase | 96.67 | |
| TIGR01822 | 393 | 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig | 96.66 | |
| TIGR03402 | 379 | FeS_nifS cysteine desulfurase NifS. Members of thi | 96.62 | |
| PRK02731 | 367 | histidinol-phosphate aminotransferase; Validated | 96.54 | |
| TIGR03392 | 398 | FeS_syn_CsdA cysteine desulfurase, catalytic subun | 96.47 | |
| TIGR01979 | 403 | sufS cysteine desulfurases, SufS subfamily. This m | 96.46 | |
| cd00609 | 350 | AAT_like Aspartate aminotransferase family. This f | 96.32 | |
| PF12897 | 425 | Aminotran_MocR: Alanine-glyoxylate amino-transfera | 96.3 | |
| PRK06225 | 380 | aspartate aminotransferase; Provisional | 96.29 | |
| PRK10874 | 401 | cysteine sulfinate desulfinase; Provisional | 96.24 | |
| PRK03080 | 378 | phosphoserine aminotransferase; Provisional | 96.19 | |
| COG3844 | 407 | Kynureninase [Amino acid transport and metabolism] | 96.17 | |
| TIGR02326 | 363 | transamin_PhnW 2-aminoethylphosphonate--pyruvate t | 95.96 | |
| cd06453 | 373 | SufS_like Cysteine desulfurase (SufS)-like. This f | 95.92 | |
| TIGR01141 | 346 | hisC histidinol-phosphate aminotransferase. Histid | 95.85 | |
| PRK02948 | 381 | cysteine desulfurase; Provisional | 95.76 | |
| TIGR02539 | 370 | SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation | 95.73 | |
| PRK00950 | 361 | histidinol-phosphate aminotransferase; Validated | 95.67 | |
| TIGR03403 | 382 | nifS_epsilon cysteine desulfurase, NifS family, ep | 95.57 | |
| PLN02822 | 481 | serine palmitoyltransferase | 95.46 | |
| PRK05355 | 360 | 3-phosphoserine/phosphohydroxythreonine aminotrans | 95.39 | |
| TIGR01976 | 397 | am_tr_V_VC1184 cysteine desulfurase family protein | 95.37 | |
| PLN02855 | 424 | Bifunctional selenocysteine lyase/cysteine desulfu | 95.34 | |
| PRK06108 | 382 | aspartate aminotransferase; Provisional | 95.33 | |
| KOG3846 | 465 | consensus L-kynurenine hydrolase [Amino acid trans | 95.32 | |
| PRK13479 | 368 | 2-aminoethylphosphonate--pyruvate transaminase; Pr | 95.26 | |
| TIGR01364 | 349 | serC_1 phosphoserine aminotransferase. This model | 95.25 | |
| PRK03317 | 368 | histidinol-phosphate aminotransferase; Provisional | 95.23 | |
| PRK14809 | 357 | histidinol-phosphate aminotransferase; Provisional | 94.99 | |
| PRK10534 | 333 | L-threonine aldolase; Provisional | 94.93 | |
| PRK04366 | 481 | glycine dehydrogenase subunit 2; Validated | 94.74 | |
| PRK08153 | 369 | histidinol-phosphate aminotransferase; Provisional | 94.64 | |
| COG0001 | 432 | HemL Glutamate-1-semialdehyde aminotransferase [Co | 94.61 | |
| PRK05764 | 393 | aspartate aminotransferase; Provisional | 94.51 | |
| PRK13034 | 416 | serine hydroxymethyltransferase; Reviewed | 94.44 | |
| PRK03158 | 359 | histidinol-phosphate aminotransferase; Provisional | 94.41 | |
| TIGR01437 | 363 | selA_rel uncharacterized pyridoxal phosphate-depen | 94.38 | |
| PTZ00094 | 452 | serine hydroxymethyltransferase; Provisional | 94.37 | |
| TIGR01366 | 361 | serC_3 phosphoserine aminotransferase, putative. T | 94.33 | |
| PRK09295 | 406 | bifunctional cysteine desulfurase/selenocysteine l | 94.33 | |
| PRK06959 | 339 | putative threonine-phosphate decarboxylase; Provis | 94.28 | |
| PRK02610 | 374 | histidinol-phosphate aminotransferase; Provisional | 94.09 | |
| PRK05387 | 353 | histidinol-phosphate aminotransferase; Provisional | 94.08 | |
| PRK03321 | 352 | putative aminotransferase; Provisional | 93.89 | |
| PLN02955 | 476 | 8-amino-7-oxononanoate synthase | 93.88 | |
| TIGR01977 | 376 | am_tr_V_EF2568 cysteine desulfurase family protein | 93.78 | |
| COG0520 | 405 | csdA Selenocysteine lyase/Cysteine desulfurase [Po | 93.77 | |
| cd06450 | 345 | DOPA_deC_like DOPA decarboxylase family. This fami | 93.69 | |
| cd00378 | 402 | SHMT Serine-glycine hydroxymethyltransferase (SHMT | 93.69 | |
| COG0156 | 388 | BioF 7-keto-8-aminopelargonate synthetase and rela | 93.49 | |
| PRK00451 | 447 | glycine dehydrogenase subunit 1; Validated | 93.49 | |
| PRK07682 | 378 | hypothetical protein; Validated | 93.47 | |
| TIGR03537 | 350 | DapC succinyldiaminopimelate transaminase. Note: t | 93.27 | |
| PF00266 | 371 | Aminotran_5: Aminotransferase class-V; InterPro: I | 93.19 | |
| cd00611 | 355 | PSAT_like Phosphoserine aminotransferase (PSAT) fa | 92.9 | |
| PRK06836 | 394 | aspartate aminotransferase; Provisional | 92.89 | |
| PRK09331 | 387 | Sep-tRNA:Cys-tRNA synthetase; Provisional | 92.79 | |
| PRK15481 | 431 | transcriptional regulatory protein PtsJ; Provision | 92.76 | |
| PRK06425 | 332 | histidinol-phosphate aminotransferase; Validated | 92.76 | |
| PRK01533 | 366 | histidinol-phosphate aminotransferase; Validated | 92.75 | |
| PRK07324 | 373 | transaminase; Validated | 92.66 | |
| cd06452 | 361 | SepCysS Sep-tRNA:Cys-tRNA synthase. This family be | 92.59 | |
| COG1167 | 459 | ARO8 Transcriptional regulators containing a DNA-b | 92.45 | |
| PRK07908 | 349 | hypothetical protein; Provisional | 92.12 | |
| COG0079 | 356 | HisC Histidinol-phosphate/aromatic aminotransferas | 91.99 | |
| PRK09440 | 416 | avtA valine--pyruvate transaminase; Provisional | 91.99 | |
| PRK05367 | 954 | glycine dehydrogenase; Provisional | 91.9 | |
| PRK04635 | 354 | histidinol-phosphate aminotransferase; Provisional | 91.45 | |
| PRK13580 | 493 | serine hydroxymethyltransferase; Provisional | 91.44 | |
| PLN02414 | 993 | glycine dehydrogenase (decarboxylating) | 91.39 | |
| PRK04870 | 356 | histidinol-phosphate aminotransferase; Provisional | 91.19 | |
| PRK07568 | 397 | aspartate aminotransferase; Provisional | 90.9 | |
| PRK01688 | 351 | histidinol-phosphate aminotransferase; Provisional | 90.74 | |
| PRK07590 | 409 | L,L-diaminopimelate aminotransferase; Validated | 90.71 | |
| PRK09265 | 404 | aminotransferase AlaT; Validated | 90.69 | |
| PRK05664 | 330 | threonine-phosphate decarboxylase; Reviewed | 90.41 | |
| TIGR01264 | 401 | tyr_amTase_E tyrosine aminotransferase, eukaryotic | 90.24 | |
| PRK06358 | 354 | threonine-phosphate decarboxylase; Provisional | 89.93 | |
| PRK07683 | 387 | aminotransferase A; Validated | 89.66 | |
| PRK06207 | 405 | aspartate aminotransferase; Provisional | 89.28 | |
| PRK00011 | 416 | glyA serine hydroxymethyltransferase; Reviewed | 89.25 | |
| KOG1359 | 417 | consensus Glycine C-acetyltransferase/2-amino-3-ke | 88.95 | |
| TIGR03542 | 402 | DAPAT_plant LL-diaminopimelate aminotransferase. T | 88.8 | |
| PRK04781 | 364 | histidinol-phosphate aminotransferase; Provisional | 88.47 | |
| PRK08056 | 356 | threonine-phosphate decarboxylase; Provisional | 88.22 | |
| PRK08361 | 391 | aspartate aminotransferase; Provisional | 87.97 | |
| PRK09105 | 370 | putative aminotransferase; Provisional | 87.96 | |
| PRK08912 | 387 | hypothetical protein; Provisional | 87.91 | |
| PLN02409 | 401 | serine--glyoxylate aminotransaminase | 87.86 | |
| PRK13355 | 517 | bifunctional HTH-domain containing protein/aminotr | 87.83 | |
| PRK14012 | 404 | cysteine desulfurase; Provisional | 87.75 | |
| PLN00175 | 413 | aminotransferase family protein; Provisional | 87.55 | |
| PLN00143 | 409 | tyrosine/nicotianamine aminotransferase; Provision | 87.53 | |
| PRK08363 | 398 | alanine aminotransferase; Validated | 87.49 | |
| PHA02771 | 90 | hypothetical protein; Provisional | 87.22 | |
| PLN03026 | 380 | histidinol-phosphate aminotransferase; Provisional | 87.1 | |
| PRK05957 | 389 | aspartate aminotransferase; Provisional | 86.73 | |
| TIGR02006 | 402 | IscS cysteine desulfurase IscS. This model represe | 86.7 | |
| PTZ00433 | 412 | tyrosine aminotransferase; Provisional | 86.49 | |
| PRK07681 | 399 | aspartate aminotransferase; Provisional | 86.46 | |
| PRK05367 | 954 | glycine dehydrogenase; Provisional | 86.36 | |
| PRK12566 | 954 | glycine dehydrogenase; Provisional | 86.33 | |
| cd00616 | 352 | AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa | 85.96 | |
| PF00155 | 363 | Aminotran_1_2: Aminotransferase class I and II 1-a | 85.74 | |
| TIGR03576 | 346 | pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 | 85.51 | |
| PRK05839 | 374 | hypothetical protein; Provisional | 85.42 | |
| KOG1368 | 384 | consensus Threonine aldolase [Amino acid transport | 84.86 | |
| COG2008 | 342 | GLY1 Threonine aldolase [Amino acid transport and | 84.79 | |
| PRK14808 | 335 | histidinol-phosphate aminotransferase; Provisional | 84.56 | |
| PTZ00377 | 481 | alanine aminotransferase; Provisional | 84.42 | |
| PLN02187 | 462 | rooty/superroot1 | 84.3 | |
| PRK09147 | 396 | succinyldiaminopimelate transaminase; Provisional | 84.23 | |
| PLN02414 | 993 | glycine dehydrogenase (decarboxylating) | 84.16 | |
| PRK08175 | 395 | aminotransferase; Validated | 83.84 | |
| PRK06107 | 402 | aspartate aminotransferase; Provisional | 83.55 | |
| PRK14807 | 351 | histidinol-phosphate aminotransferase; Provisional | 83.55 | |
| PRK07865 | 364 | N-succinyldiaminopimelate aminotransferase; Review | 83.43 | |
| PRK05166 | 371 | histidinol-phosphate aminotransferase; Provisional | 83.39 | |
| TIGR01265 | 403 | tyr_nico_aTase tyrosine/nicotianamine aminotransfe | 83.24 | |
| PRK06348 | 384 | aspartate aminotransferase; Provisional | 83.08 | |
| TIGR00461 | 939 | gcvP glycine dehydrogenase (decarboxylating). This | 82.55 | |
| TIGR01140 | 330 | L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy | 82.46 | |
| PRK12414 | 384 | putative aminotransferase; Provisional | 81.33 | |
| PRK07366 | 388 | succinyldiaminopimelate transaminase; Validated | 81.3 | |
| PLN02607 | 447 | 1-aminocyclopropane-1-carboxylate synthase | 81.28 | |
| PRK09276 | 385 | LL-diaminopimelate aminotransferase; Provisional | 81.23 | |
| PHA02772 | 95 | hypothetical protein; Provisional | 81.18 | |
| PRK08354 | 311 | putative aminotransferase; Provisional | 81.17 | |
| PLN02656 | 409 | tyrosine transaminase | 81.12 | |
| PRK07550 | 386 | hypothetical protein; Provisional | 80.48 | |
| PRK08637 | 388 | hypothetical protein; Provisional | 80.26 | |
| PLN00145 | 430 | tyrosine/nicotianamine aminotransferase; Provision | 80.11 | |
| PRK15399 | 713 | lysine decarboxylase LdcC; Provisional | 80.08 | |
| PRK13578 | 720 | ornithine decarboxylase; Provisional | 80.05 | |
| PRK08960 | 387 | hypothetical protein; Provisional | 80.02 |
| >COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.91 E-value=3.1e-24 Score=151.17 Aligned_cols=81 Identities=32% Similarity=0.578 Sum_probs=74.7
Q ss_pred CCCCceeeecccceEEEEEeeeCCCCc---hHHHHHHHHHHHHcCceeeecCCCCCEEEEecCcccCHHHHHHHHHHHHH
Q 042283 1 DKYGTIGDARGWGFMLGVEFVTDSQLR---KAETLDVMDKMKQMGVLIGKGGFYGNVFRIAPPLCFTKEDANYLVDVMDC 77 (82)
Q Consensus 1 ~~~~~v~~vRg~Glm~gie~~~~~~~~---~~~~~~v~~~~~~~Gll~~~~g~~~~~i~~~PPL~i~~~eid~~~~~l~~ 77 (82)
++||.|+||||+|||+||||+++..++ .+.+.+++..|+++||++..||.++|+|||.|||+||++|+|+++++|++
T Consensus 362 ~~~~~IgdVRG~Glm~giE~v~d~~t~~p~~~~~~~i~~~~~~~Glil~~~G~~~nviRi~PPL~is~e~~d~~l~il~~ 441 (447)
T COG0160 362 EKHPLIGDVRGLGLMIGVELVKDRDTKEPDAELAAKIVARAFERGLLLLTCGPHGNVLRILPPLTISDEELDEGLDILEE 441 (447)
T ss_pred hhcCceecccccceEEEEEEecCCCCCCCCHHHHHHHHHHHHHcCCEEeccCCCCcEEEEeCCcccCHHHHHHHHHHHHH
Confidence 468999999999999999999876543 57889999999999999999999999999999999999999999999999
Q ss_pred hHhc
Q 042283 78 SMTK 81 (82)
Q Consensus 78 ~l~~ 81 (82)
+|.+
T Consensus 442 al~~ 445 (447)
T COG0160 442 ALKE 445 (447)
T ss_pred HHHh
Confidence 9874
|
|
| >KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07483 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00709 dat 2,4-diaminobutyrate 4-transaminases | Back alignment and domain information |
|---|
| >PRK07495 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06082 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05965 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05639 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06149 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06105 aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06058 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06917 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07480 putative aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated | Back alignment and domain information |
|---|
| >PRK07481 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12403 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07036 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07482 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR03372 putres_am_tran putrescine aminotransferase | Back alignment and domain information |
|---|
| >PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02760 4-aminobutyrate:pyruvate transaminase | Back alignment and domain information |
|---|
| >PRK07678 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK09221 beta alanine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08593 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09792 4-aminobutyrate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06062 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13360 omega amino acid--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06777 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04612 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK08360 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05769 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06541 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase | Back alignment and domain information |
|---|
| >PRK08117 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08297 L-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >PRK06918 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK03715 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03251 LAT_fam L-lysine 6-transaminase | Back alignment and domain information |
|---|
| >PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN00144 acetylornithine transaminase | Back alignment and domain information |
|---|
| >PRK08088 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03246 arg_catab_astC succinylornithine transaminase family | Back alignment and domain information |
|---|
| >PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02624 ornithine-delta-aminotransferase | Back alignment and domain information |
|---|
| >PRK03244 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04073 rocD ornithine--oxo-acid transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR01885 Orn_aminotrans ornithine aminotransferase | Back alignment and domain information |
|---|
| >PRK01278 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00125 ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK04260 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02936 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed | Back alignment and domain information |
|---|
| >PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02627 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase | Back alignment and domain information |
|---|
| >PRK07046 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN03227 serine palmitoyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00610 OAT_like Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >PRK07505 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02482 glutamate-1-semialdehyde 2,1-aminomutase | Back alignment and domain information |
|---|
| >PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional | Back alignment and domain information |
|---|
| >PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00707 argD acetylornithine and succinylornithine aminotransferases | Back alignment and domain information |
|---|
| >PRK13393 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07179 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05958 8-amino-7-oxononanoate synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase | Back alignment and domain information |
|---|
| >TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative | Back alignment and domain information |
|---|
| >PRK09064 5-aminolevulinate synthase; Validated | Back alignment and domain information |
|---|
| >KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01814 kynureninase kynureninase | Back alignment and domain information |
|---|
| >PLN02721 threonine aldolase | Back alignment and domain information |
|---|
| >TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase | Back alignment and domain information |
|---|
| >PRK13520 L-tyrosine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13392 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits | Back alignment and domain information |
|---|
| >cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family | Back alignment and domain information |
|---|
| >cd06502 TA_like Low-specificity threonine aldolase (TA) | Back alignment and domain information |
|---|
| >TIGR00858 bioF 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >PRK05937 8-amino-7-oxononanoate synthase; Provisional | Back alignment and domain information |
|---|
| >cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) | Back alignment and domain information |
|---|
| >TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA | Back alignment and domain information |
|---|
| >PLN02483 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase | Back alignment and domain information |
|---|
| >TIGR03402 FeS_nifS cysteine desulfurase NifS | Back alignment and domain information |
|---|
| >PRK02731 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA | Back alignment and domain information |
|---|
| >TIGR01979 sufS cysteine desulfurases, SufS subfamily | Back alignment and domain information |
|---|
| >cd00609 AAT_like Aspartate aminotransferase family | Back alignment and domain information |
|---|
| >PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases | Back alignment and domain information |
|---|
| >PRK06225 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10874 cysteine sulfinate desulfinase; Provisional | Back alignment and domain information |
|---|
| >PRK03080 phosphoserine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG3844 Kynureninase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase | Back alignment and domain information |
|---|
| >cd06453 SufS_like Cysteine desulfurase (SufS)-like | Back alignment and domain information |
|---|
| >TIGR01141 hisC histidinol-phosphate aminotransferase | Back alignment and domain information |
|---|
| >PRK02948 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >PRK00950 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type | Back alignment and domain information |
|---|
| >PLN02822 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily | Back alignment and domain information |
|---|
| >PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase | Back alignment and domain information |
|---|
| >PRK06108 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR01364 serC_1 phosphoserine aminotransferase | Back alignment and domain information |
|---|
| >PRK03317 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14809 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10534 L-threonine aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK04366 glycine dehydrogenase subunit 2; Validated | Back alignment and domain information |
|---|
| >PRK08153 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05764 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13034 serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK03158 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme | Back alignment and domain information |
|---|
| >PTZ00094 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01366 serC_3 phosphoserine aminotransferase, putative | Back alignment and domain information |
|---|
| >PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated | Back alignment and domain information |
|---|
| >PRK06959 putative threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK02610 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05387 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03321 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02955 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein | Back alignment and domain information |
|---|
| >COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06450 DOPA_deC_like DOPA decarboxylase family | Back alignment and domain information |
|---|
| >cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) | Back alignment and domain information |
|---|
| >COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00451 glycine dehydrogenase subunit 1; Validated | Back alignment and domain information |
|---|
| >PRK07682 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03537 DapC succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family | Back alignment and domain information |
|---|
| >PRK06836 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK15481 transcriptional regulatory protein PtsJ; Provisional | Back alignment and domain information |
|---|
| >PRK06425 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK01533 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07324 transaminase; Validated | Back alignment and domain information |
|---|
| >cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07908 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09440 avtA valine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK05367 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04635 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13580 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02414 glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK04870 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07568 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01688 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07590 L,L-diaminopimelate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK09265 aminotransferase AlaT; Validated | Back alignment and domain information |
|---|
| >PRK05664 threonine-phosphate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic | Back alignment and domain information |
|---|
| >PRK06358 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07683 aminotransferase A; Validated | Back alignment and domain information |
|---|
| >PRK06207 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00011 glyA serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase | Back alignment and domain information |
|---|
| >PRK04781 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08056 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08361 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09105 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08912 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02409 serine--glyoxylate aminotransaminase | Back alignment and domain information |
|---|
| >PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14012 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >PLN00175 aminotransferase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN00143 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08363 alanine aminotransferase; Validated | Back alignment and domain information |
|---|
| >PHA02771 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03026 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05957 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02006 IscS cysteine desulfurase IscS | Back alignment and domain information |
|---|
| >PTZ00433 tyrosine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07681 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05367 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12566 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) | Back alignment and domain information |
|---|
| >PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family | Back alignment and domain information |
|---|
| >PRK05839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14808 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00377 alanine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02187 rooty/superroot1 | Back alignment and domain information |
|---|
| >PRK09147 succinyldiaminopimelate transaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02414 glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08175 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06107 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14807 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05166 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases | Back alignment and domain information |
|---|
| >PRK06348 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00461 gcvP glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase | Back alignment and domain information |
|---|
| >PRK12414 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07366 succinyldiaminopimelate transaminase; Validated | Back alignment and domain information |
|---|
| >PLN02607 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK09276 LL-diaminopimelate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PHA02772 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08354 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02656 tyrosine transaminase | Back alignment and domain information |
|---|
| >PRK07550 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08637 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00145 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15399 lysine decarboxylase LdcC; Provisional | Back alignment and domain information |
|---|
| >PRK13578 ornithine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08960 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 82 | ||||
| 2zuk_A | 439 | The Crystal Structure Of Alpha-Amino-Epsilon-Caprol | 1e-08 | ||
| 3dxw_A | 452 | The Crystal Structure Of Alpha-Amino-Epsilon-Caprol | 1e-08 | ||
| 3n5m_A | 452 | Crystals Structure Of A Bacillus Anthracis Aminotra | 6e-07 | ||
| 3fcr_A | 459 | Crystal Structure Of Putative Aminotransferase (Yp_ | 3e-05 | ||
| 1z3z_A | 431 | The Crystal Structure Of A Dgd Mutant: Q52a Length | 6e-05 | ||
| 1m0n_A | 433 | Structure Of Dialkylglycine Decarboxylase Complexed | 6e-05 | ||
| 1dgd_A | 432 | An Alkali Metal Ion Size-Dependent Switch In The Ac | 6e-05 | ||
| 1d7r_A | 433 | Crystal Structure Of The Complex Of 2,2-Dialkylglyc | 7e-05 | ||
| 4atp_A | 456 | Structure Of Gaba-Transaminase A1r958 From Arthroba | 1e-04 | ||
| 1szk_A | 426 | The Structure Of Gamma-Aminobutyrate Aminotransfera | 1e-04 | ||
| 1szs_A | 426 | The Structure Of Gamma-aminobutyrate Aminotransfera | 1e-04 | ||
| 1szu_A | 426 | The Structure Of Gamma-Aminobutyrate Aminotransfera | 1e-04 | ||
| 1sf2_A | 426 | Structure Of E. Coli Gamma-Aminobutyrate Aminotrans | 1e-04 | ||
| 4ffc_A | 453 | Crystal Structure Of A 4-Aminobutyrate Aminotransfe | 2e-04 | ||
| 3gju_A | 459 | Crystal Structure Of A Putative Aminotransferase (M | 2e-04 | ||
| 3oks_A | 451 | Crystal Structure Of 4-Aminobutyrate Transaminase F | 5e-04 | ||
| 3r4t_A | 467 | Crystal Structure Of 4-Aminobutyrate Aminotransfera | 6e-04 |
| >pdb|2ZUK|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam (Different Binding Mode) Length = 439 | Back alignment and structure |
|
| >pdb|3DXW|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam Length = 452 | Back alignment and structure |
| >pdb|3N5M|A Chain A, Crystals Structure Of A Bacillus Anthracis Aminotransferase Length = 452 | Back alignment and structure |
| >pdb|1Z3Z|A Chain A, The Crystal Structure Of A Dgd Mutant: Q52a Length = 431 | Back alignment and structure |
| >pdb|1M0N|A Chain A, Structure Of Dialkylglycine Decarboxylase Complexed With 1- Aminocyclopentanephosphonate Length = 433 | Back alignment and structure |
| >pdb|1DGD|A Chain A, An Alkali Metal Ion Size-Dependent Switch In The Active Site Structure Of Dialkylglycine Decarboxylase Length = 432 | Back alignment and structure |
| >pdb|1D7R|A Chain A, Crystal Structure Of The Complex Of 2,2-Dialkylglycine Decarboxylase With 5pa Length = 433 | Back alignment and structure |
| >pdb|4ATP|A Chain A, Structure Of Gaba-Transaminase A1r958 From Arthrobacter Aurescens In Complex With Plp Length = 456 | Back alignment and structure |
| >pdb|1SZK|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: E211s Length = 426 | Back alignment and structure |
| >pdb|1SZS|A Chain A, The Structure Of Gamma-aminobutyrate Aminotransferase Mutant: I50q Length = 426 | Back alignment and structure |
| >pdb|1SZU|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: V241a Length = 426 | Back alignment and structure |
| >pdb|1SF2|A Chain A, Structure Of E. Coli Gamma-Aminobutyrate Aminotransferase Length = 426 | Back alignment and structure |
| >pdb|4FFC|A Chain A, Crystal Structure Of A 4-Aminobutyrate Aminotransferase (Gabt) From Mycobacterium Abscessus Length = 453 | Back alignment and structure |
| >pdb|3OKS|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 451 | Back alignment and structure |
| >pdb|3R4T|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase Gabt From Mycobacterium Marinum Covalently Bound To Pyridoxal Phosphate Length = 467 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 1e-25 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 8e-25 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 1e-19 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 1e-19 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 6e-19 | |
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 5e-15 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 1e-14 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 6e-14 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 3e-13 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 2e-12 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 3e-12 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 8e-12 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 1e-11 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 2e-11 | |
| 3nui_A | 478 | Pyruvate transaminase; amino transferase, transfer | 4e-11 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 9e-11 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 9e-11 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 3e-10 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 3e-10 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 7e-10 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 1e-09 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 2e-09 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 6e-09 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 8e-09 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 4e-06 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 2e-04 |
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 | Back alignment and structure |
|---|
Score = 96.5 bits (241), Expect = 1e-25
Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 3/84 (3%)
Query: 1 DKYGTIGDARGWGFMLGVEFVTDSQLRK---AETLDVMDKMKQMGVLIGKGGFYGNVFRI 57
++ IGD RG G G+E V D Q R+ AET ++ + Q+G+++ G GNV
Sbjct: 341 KRHPLIGDIRGRGLACGMELVCDRQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEF 400
Query: 58 APPLCFTKEDANYLVDVMDCSMTK 81
PPL T+ D + +D++D + ++
Sbjct: 401 TPPLTITETDIHKALDLLDRAFSE 424
|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 | Back alignment and structure |
|---|
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 | Back alignment and structure |
|---|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 | Back alignment and structure |
|---|
| >3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans} Length = 430 | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| 4atq_A | 456 | 4-aminobutyrate transaminase; transferase; HET: PL | 99.85 | |
| 4e3q_A | 473 | Pyruvate transaminase; aminotransferase, transfera | 99.79 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.52 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 99.45 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 99.44 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 99.38 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 99.38 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 99.37 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 99.36 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.33 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.33 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.22 | |
| 4ao9_A | 454 | Beta-phenylalanine aminotransferase; HET: PLP; 1.5 | 99.22 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 99.17 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 99.15 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 99.14 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 99.12 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 99.11 | |
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 99.11 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 99.1 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 99.08 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 99.03 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 98.98 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 98.83 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 98.81 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 98.79 | |
| 4adb_A | 406 | Succinylornithine transaminase; transferase, PLP e | 98.77 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 98.73 | |
| 2yky_A | 465 | Beta-transaminase; transferase; HET: PLP SFE; 1.69 | 98.12 | |
| 3k28_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn | 98.66 | |
| 3l44_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha | 98.63 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 98.62 | |
| 3fq8_A | 427 | Glutamate-1-semialdehyde 2,1-aminomutase; drug res | 98.58 | |
| 4e77_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase; structur | 98.56 | |
| 2epj_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 98.5 | |
| 2e7u_A | 424 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 98.43 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 98.33 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 98.21 | |
| 3kki_A | 409 | CAI-1 autoinducer synthase; quorum sensing, CQSA, | 98.18 | |
| 2cy8_A | 453 | D-phgat, D-phenylglycine aminotransferase; structu | 98.17 | |
| 3e9k_A | 465 | Kynureninase; kynurenine-L-hydrolase, kynurenine h | 98.14 | |
| 3tqx_A | 399 | 2-amino-3-ketobutyrate coenzyme A ligase; energy m | 97.98 | |
| 3l8a_A | 421 | METC, putative aminotransferase, probable beta-cys | 97.94 | |
| 3kgw_A | 393 | Alanine-glyoxylate aminotransferase; AAH25799.1, p | 97.86 | |
| 1m32_A | 366 | 2-aminoethylphosphonate-pyruvate aminotransferase; | 97.85 | |
| 2w8t_A | 427 | SPT, serine palmitoyltransferase; HET: LLP; 1.25A | 97.84 | |
| 3a2b_A | 398 | Serine palmitoyltransferase; vitamin B6-dependent | 97.84 | |
| 3f0h_A | 376 | Aminotransferase; RER070207000802, structural geno | 97.81 | |
| 3piu_A | 435 | 1-aminocyclopropane-1-carboxylate synthase; fruit | 97.8 | |
| 1elu_A | 390 | L-cysteine/L-cystine C-S lyase; FES cluster biosyn | 97.77 | |
| 1fc4_A | 401 | 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino | 97.76 | |
| 3f9t_A | 397 | TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L | 97.75 | |
| 2zyj_A | 397 | Alpha-aminodipate aminotransferase; alpha-aminoadi | 97.73 | |
| 3zrp_A | 384 | Serine-pyruvate aminotransferase (AGXT); HET: PLP; | 97.72 | |
| 1iay_A | 428 | ACC synthase 2, 1-aminocyclopropane-1-carboxylate | 97.71 | |
| 1v72_A | 356 | Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 | 97.71 | |
| 4dq6_A | 391 | Putative pyridoxal phosphate-dependent transferas; | 97.66 | |
| 3ez1_A | 423 | Aminotransferase MOCR family; YP_604413.1, struct | 97.63 | |
| 1kmj_A | 406 | Selenocysteine lyase; persulfide perselenide NIFS | 97.61 | |
| 3nnk_A | 411 | Ureidoglycine-glyoxylate aminotransferase; PLP-dep | 97.61 | |
| 2dr1_A | 386 | PH1308 protein, 386AA long hypothetical serine ami | 97.6 | |
| 3ffh_A | 363 | Histidinol-phosphate aminotransferase; APC88260, l | 97.59 | |
| 1qz9_A | 416 | Kynureninase; kynurenine, tryptophan, PLP, vitamin | 97.55 | |
| 1jg8_A | 347 | L-ALLO-threonine aldolase; glycine biosynthesis, p | 97.53 | |
| 3g7q_A | 417 | Valine-pyruvate aminotransferase; NP_462565.1, str | 97.53 | |
| 2oqx_A | 467 | Tryptophanase; lyase, pyridoxal phosphate, tryptop | 97.53 | |
| 2zc0_A | 407 | Alanine glyoxylate transaminase; alanine:glyoxylat | 97.5 | |
| 3aow_A | 448 | Putative uncharacterized protein PH0207; protein-P | 97.48 | |
| 1iug_A | 352 | Putative aspartate aminotransferase; wild type, py | 97.47 | |
| 1yiz_A | 429 | Kynurenine aminotransferase; glutamine transaminas | 97.45 | |
| 1ax4_A | 467 | Tryptophanase; tryptophan biosynthesis, tryptophan | 97.45 | |
| 1vp4_A | 425 | Aminotransferase, putative; structural genomics, j | 97.45 | |
| 3euc_A | 367 | Histidinol-phosphate aminotransferase 2; YP_297314 | 97.43 | |
| 3if2_A | 444 | Aminotransferase; YP_265399.1, structura genomics, | 97.43 | |
| 2vi8_A | 405 | Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, | 97.42 | |
| 3cq5_A | 369 | Histidinol-phosphate aminotransferase; PLP, PMP, a | 97.41 | |
| 1t3i_A | 420 | Probable cysteine desulfurase; PLP-binding enzyme, | 97.4 | |
| 2dkj_A | 407 | Serine hydroxymethyltransferase; PLP dependent enz | 97.38 | |
| 1w23_A | 360 | Phosphoserine aminotransferase; pyridoxal-5'-phosp | 97.38 | |
| 3ppl_A | 427 | Aspartate aminotransferase; dimer, PLP-dependent t | 97.38 | |
| 3ftb_A | 361 | Histidinol-phosphate aminotransferase; structural | 97.37 | |
| 1bs0_A | 384 | Protein (8-amino-7-oxonanoate synthase); PLP-depen | 97.37 | |
| 2dou_A | 376 | Probable N-succinyldiaminopimelate aminotransfera; | 97.35 | |
| 3kax_A | 383 | Aminotransferase, classes I and II; PLP, C-S lyase | 97.34 | |
| 3ezs_A | 376 | Aminotransferase ASPB; NP_207418.1, structural gen | 97.32 | |
| 2x5f_A | 430 | Aspartate_tyrosine_phenylalanine pyridoxal-5' phos | 97.32 | |
| 2ch1_A | 396 | 3-hydroxykynurenine transaminase; PLP-enzyme, kynu | 97.31 | |
| 2huf_A | 393 | Alanine glyoxylate aminotransferase; alpha and bet | 97.28 | |
| 3d6k_A | 422 | Putative aminotransferase; APC82464, corynebacteri | 97.28 | |
| 3nra_A | 407 | Aspartate aminotransferase; structural genomics, j | 97.26 | |
| 1cs1_A | 386 | CGS, protein (cystathionine gamma-synthase); lyase | 97.25 | |
| 2yrr_A | 353 | Aminotransferase, class V; structural genomics, NP | 97.25 | |
| 3get_A | 365 | Histidinol-phosphate aminotransferase; NP_281508.1 | 97.25 | |
| 2fyf_A | 398 | PSAT, phosphoserine aminotransferase; PLP-dependen | 97.23 | |
| 1pff_A | 331 | Methionine gamma-lyase; homocysteine; 2.50A {Trich | 97.2 | |
| 2z9v_A | 392 | Aspartate aminotransferase; pyridoxamine, pyruvate | 97.2 | |
| 1svv_A | 359 | Threonine aldolase; structural genomics, structura | 97.18 | |
| 3gbx_A | 420 | Serine hydroxymethyltransferase; structural genomi | 97.15 | |
| 2ez2_A | 456 | Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend | 97.14 | |
| 3ke3_A | 379 | Putative serine-pyruvate aminotransferase; structu | 97.14 | |
| 3dzz_A | 391 | Putative pyridoxal 5'-phosphate-dependent C-S LYA; | 97.12 | |
| 2oga_A | 399 | Transaminase; PLP-dependent enzyme, desosamine, de | 97.11 | |
| 1xi9_A | 406 | Putative transaminase; alanine aminotransferase, s | 97.11 | |
| 2gb3_A | 409 | Aspartate aminotransferase; TM1698, structural gen | 97.1 | |
| 1d2f_A | 390 | MALY protein; aminotransferase fold, large PLP-bin | 97.1 | |
| 3g0t_A | 437 | Putative aminotransferase; NP_905498.1, putative a | 97.09 | |
| 3isl_A | 416 | Purine catabolism protein PUCG; pyridoxalphosphate | 97.09 | |
| 1mdo_A | 393 | ARNB aminotransferase; type 1 aminotransferase fol | 97.09 | |
| 3ele_A | 398 | Amino transferase; RER070207001803, structural gen | 97.09 | |
| 1lc5_A | 364 | COBD, L-threonine-O-3-phosphate decarboxylase; PLP | 97.08 | |
| 3h14_A | 391 | Aminotransferase, classes I and II; YP_167802.1, S | 97.07 | |
| 2bwn_A | 401 | 5-aminolevulinate synthase; tetrapyrrole biosynthe | 97.01 | |
| 3ly1_A | 354 | Putative histidinol-phosphate aminotransferase; st | 97.01 | |
| 3ecd_A | 425 | Serine hydroxymethyltransferase 2; ssgcid, decode, | 97.0 | |
| 1c7n_A | 399 | Cystalysin; transferase, aminotransferase, pyridox | 97.0 | |
| 3h7f_A | 447 | Serine hydroxymethyltransferase 1; cytoplasm, one- | 96.99 | |
| 3fkd_A | 350 | L-threonine-O-3-phosphate decarboxylase; structura | 96.95 | |
| 1bw0_A | 416 | TAT, protein (tyrosine aminotransferase); tyrosine | 96.95 | |
| 4hvk_A | 382 | Probable cysteine desulfurase 2; transferase and I | 96.95 | |
| 1eg5_A | 384 | Aminotransferase; PLP-dependent enzymes, iron-sulf | 96.95 | |
| 2o1b_A | 404 | Aminotransferase, class I; aminotrasferase; HET: P | 96.94 | |
| 2r2n_A | 425 | Kynurenine/alpha-aminoadipate aminotransferase mit | 96.94 | |
| 3fdb_A | 377 | Beta C-S lyase, putative PLP-dependent beta-cystat | 96.92 | |
| 1vjo_A | 393 | Alanine--glyoxylate aminotransferase; 17130350, AL | 96.9 | |
| 3uwc_A | 374 | Nucleotide-sugar aminotransferase; lipopolysacchar | 96.9 | |
| 2x5d_A | 412 | Probable aminotransferase; HET: LLP PLP; 2.25A {Ps | 96.9 | |
| 4eb5_A | 382 | Probable cysteine desulfurase 2; scaffold, transfe | 96.83 | |
| 2z61_A | 370 | Probable aspartate aminotransferase 2; amino acid | 96.79 | |
| 3cai_A | 406 | Possible aminotransferase; RV3778C; 1.80A {Mycobac | 96.74 | |
| 1wyu_B | 474 | Glycine dehydrogenase subunit 2 (P-protein); alpha | 96.72 | |
| 3qgu_A | 449 | LL-diaminopimelate aminotransferase; L-lysine, pyr | 96.71 | |
| 3hdo_A | 360 | Histidinol-phosphate aminotransferase; PSI-II, his | 96.69 | |
| 1gd9_A | 389 | Aspartate aminotransferase; pyridoxal enzyme, temp | 96.6 | |
| 1fg7_A | 356 | Histidinol phosphate aminotransferase; HISC, histi | 96.59 | |
| 1o4s_A | 389 | Aspartate aminotransferase; TM1255, structural gen | 96.57 | |
| 3jtx_A | 396 | Aminotransferase; NP_283882.1, structural genomics | 96.57 | |
| 1v2d_A | 381 | Glutamine aminotransferase; PLP, riken structural | 96.53 | |
| 3dyd_A | 427 | Tyrosine aminotransferase; PLP, SGC, structural ge | 96.51 | |
| 3ffr_A | 362 | Phosphoserine aminotransferase SERC; structural ge | 96.5 | |
| 3mad_A | 514 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 96.48 | |
| 3rq1_A | 418 | Aminotransferase class I and II; structural genomi | 96.45 | |
| 1j32_A | 388 | Aspartate aminotransferase; HET: PLP; 2.10A {Phorm | 96.45 | |
| 3mc6_A | 497 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 96.4 | |
| 3b1d_A | 392 | Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ | 95.39 | |
| 2bkw_A | 385 | Alanine-glyoxylate aminotransferase 1; analine-gly | 96.27 | |
| 3dr4_A | 391 | Putative perosamine synthetase; deoxysugar, pyrido | 96.26 | |
| 2qma_A | 497 | Diaminobutyrate-pyruvate transaminase and L-2,4- d | 96.22 | |
| 1wyu_A | 438 | Glycine dehydrogenase (decarboxylating) subunit 1; | 96.21 | |
| 2o0r_A | 411 | RV0858C (N-succinyldiaminopimelate aminotransfera; | 96.05 | |
| 3asa_A | 400 | LL-diaminopimelate aminotransferase; PLP dependent | 96.04 | |
| 1gc0_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate; HE | 96.03 | |
| 1u08_A | 386 | Hypothetical aminotransferase YBDL; alpha beta pro | 96.02 | |
| 3op7_A | 375 | Aminotransferase class I and II; PLP-dependent tra | 95.99 | |
| 2c0r_A | 362 | PSAT, phosphoserine aminotransferase; pyridoxal-5' | 95.94 | |
| 2rfv_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate, PL | 95.93 | |
| 3fvs_A | 422 | Kynurenine--oxoglutarate transaminase 1; alpha bet | 95.93 | |
| 2fnu_A | 375 | Aminotransferase; protein-product complex, structu | 95.88 | |
| 2x3l_A | 446 | ORN/Lys/Arg decarboxylase family protein; lyase; H | 95.81 | |
| 3qhx_A | 392 | Cystathionine gamma-synthase METB (CGS); structura | 95.78 | |
| 3n0l_A | 417 | Serine hydroxymethyltransferase; alpha beta class, | 95.7 | |
| 1ibj_A | 464 | CBL, cystathionine beta-lyase; PLP-dependent enzym | 95.67 | |
| 1uu1_A | 335 | Histidinol-phosphate aminotransferase; histidine b | 95.54 | |
| 1e5e_A | 404 | MGL, methionine gamma-lyase; methionine biosynthes | 95.54 | |
| 3b46_A | 447 | Aminotransferase BNA3; kynurenine aminotransferase | 95.54 | |
| 3lvm_A | 423 | Cysteine desulfurase; structural genomics, montrea | 95.5 | |
| 3vax_A | 400 | Putative uncharacterized protein DNDA; desulfurase | 95.49 | |
| 3e77_A | 377 | Phosphoserine aminotransferase; SERC, PLP, structu | 95.47 | |
| 2e7j_A | 371 | SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st | 95.35 | |
| 3qm2_A | 386 | Phosphoserine aminotransferase; structural genomic | 95.25 | |
| 1b5p_A | 385 | Protein (aspartate aminotransferase); pyridoxal en | 95.16 | |
| 3m5u_A | 361 | Phosphoserine aminotransferase; alpha-beta half sa | 94.94 | |
| 3t18_A | 413 | Aminotransferase class I and II; PSI-biology, MCSG | 94.93 | |
| 2jis_A | 515 | Cysteine sulfinic acid decarboxylase; pyridoxal ph | 94.85 | |
| 3ndn_A | 414 | O-succinylhomoserine sulfhydrylase; seattle struct | 94.73 | |
| 1c4k_A | 730 | Protein (ornithine decarboxylase); lyase; HET: PLP | 94.73 | |
| 3p1t_A | 337 | Putative histidinol-phosphate aminotransferase; PL | 94.72 | |
| 3bwn_A | 391 | AT1G70560, L-tryptophan aminotransferase; auxin sy | 94.7 | |
| 3ei9_A | 432 | LL-diaminopimelate aminotransferase; lysine biosyn | 94.67 | |
| 2c81_A | 418 | Glutamine-2-deoxy-scyllo-inosose aminotransferase; | 94.62 | |
| 2okj_A | 504 | Glutamate decarboxylase 1; PLP-dependent decarboxy | 94.61 | |
| 3e2y_A | 410 | Kynurenine-oxoglutarate transaminase 3; alpha beta | 94.43 | |
| 2ctz_A | 421 | O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac | 94.24 | |
| 2cb1_A | 412 | O-acetyl homoserine sulfhydrylase; PLP enzyme, lya | 94.23 | |
| 3pj0_A | 359 | LMO0305 protein; structural genomics, joint center | 94.23 | |
| 3a9z_A | 432 | Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph | 93.74 | |
| 3nmy_A | 400 | Xometc, cystathionine gamma-lyase-like protein; Cy | 93.63 | |
| 3hbx_A | 502 | GAD 1, glutamate decarboxylase 1; calmodulin-bindi | 93.6 | |
| 1rv3_A | 483 | Serine hydroxymethyltransferase, cytosolic; one-ca | 93.55 | |
| 2hox_A | 427 | ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA | 93.47 | |
| 2po3_A | 424 | 4-dehydrase; external aldimine, PLP, aminotransfer | 93.44 | |
| 2q7w_A | 396 | Aspartate aminotransferase; mechanism-based inhibi | 93.32 | |
| 3lws_A | 357 | Aromatic amino acid beta-eliminating lyase/threoni | 92.95 | |
| 3frk_A | 373 | QDTB; aminotransferase, sugar-modification, natura | 92.95 | |
| 1ajs_A | 412 | Aspartate aminotransferase; PIG, in the presence o | 92.93 | |
| 3cog_A | 403 | Cystathionine gamma-lyase; CTH, PLP, propargylglyc | 92.91 | |
| 2zy4_A | 546 | L-aspartate beta-decarboxylase; pyridoxal 5'-phosp | 92.87 | |
| 2dgk_A | 452 | GAD-beta, GADB, glutamate decarboxylase beta; gadb | 92.74 | |
| 2ay1_A | 394 | Aroat, aromatic amino acid aminotransferase; HET: | 92.71 | |
| 1b9h_A | 388 | AHBA synthase, protein (3-amino-5-hydroxybenzoic a | 92.23 | |
| 3fsl_A | 397 | Aromatic-amino-acid aminotransferase; tyrosine ami | 92.05 | |
| 3acz_A | 389 | Methionine gamma-lyase; L-methionine; HET: LLP; 1. | 91.36 | |
| 2z67_A | 456 | O-phosphoseryl-tRNA(SEC) selenium transferase; sel | 91.34 | |
| 4f4e_A | 420 | Aromatic-amino-acid aminotransferase; ssgcid, stru | 91.31 | |
| 3bb8_A | 437 | CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat | 91.3 | |
| 3tcm_A | 500 | Alanine aminotransferase 2; pyridoxal phosphate (P | 91.0 | |
| 1o69_A | 394 | Aminotransferase; structural genomics, unknown fun | 90.67 | |
| 2aeu_A | 374 | Hypothetical protein MJ0158; selenocysteine syntha | 90.12 | |
| 3f6t_A | 533 | Aspartate aminotransferase; YP_194538.1, STRU geno | 90.09 | |
| 2a7v_A | 490 | Serine hydroxymethyltransferase; structural genomi | 89.38 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 89.04 | |
| 1yaa_A | 412 | Aspartate aminotransferase; HET: PLP; 2.05A {Sacch | 88.96 | |
| 3ihj_A | 498 | Alanine aminotransferase 2; helix, structural geno | 88.8 | |
| 4e1o_A | 481 | HDC, histidine decarboxylase; lyase; HET: PLP PVH; | 86.36 | |
| 3k40_A | 475 | Aromatic-L-amino-acid decarboxylase; PLP dependent | 86.2 | |
| 1js3_A | 486 | DDC;, DOPA decarboxylase; carbidopa, parkinson'S d | 83.85 | |
| 3ri6_A | 430 | O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate | 83.59 | |
| 3vp6_A | 511 | Glutamate decarboxylase 1; catalytic loop SWAP, ly | 83.05 | |
| 1qgn_A | 445 | Protein (cystathionine gamma-synthase); methionine | 82.99 | |
| 2fqm_A | 75 | Phosphoprotein, P protein; negative strand RNA vir | 80.76 |
| >4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* | Back alignment and structure |
|---|
Probab=99.85 E-value=4e-21 Score=134.82 Aligned_cols=79 Identities=32% Similarity=0.453 Sum_probs=69.7
Q ss_pred CCceeeecccceEEEEEeeeCCCCc--hHHHHHHHHHHHHcCceeeecCCCCCEEEEecCcccCHHHHHHHHHHHHHhHh
Q 042283 3 YGTIGDARGWGFMLGVEFVTDSQLR--KAETLDVMDKMKQMGVLIGKGGFYGNVFRIAPPLCFTKEDANYLVDVMDCSMT 80 (82)
Q Consensus 3 ~~~v~~vRg~Glm~gie~~~~~~~~--~~~~~~v~~~~~~~Gll~~~~g~~~~~i~~~PPL~i~~~eid~~~~~l~~~l~ 80 (82)
||.|++|||+|||+||||+++.... .+.+.++.+.|+++|+++.++|..+|+|||+|||+||++|+|+++++|+++|+
T Consensus 374 ~~~v~~VRG~Gl~~giel~~~~~~~~~~~~~~~v~~~~~~~Gvl~~~~g~~~~~irl~PpL~it~~~id~~l~~l~~al~ 453 (456)
T 4atq_A 374 GSVVGDIRGRGAMLAIELVQPGSKEPNAELTKAVAAACLKEGVIILTCGTYGNVIRLLPPLVISDELLIDGLEVLAAAIK 453 (456)
T ss_dssp --CEEEEEEETTEEEEEEBCTTSCCBCHHHHHHHHHHHHHTTEECEEECTTSCEEEECCCTTCCHHHHHHHHHHHHHHHH
T ss_pred CCceEEeeecceEEEEEEecCCCCCcCHHHHHHHHHHHHHCCCEEEecCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Confidence 5789999999999999998754322 56788899999999999999988899999999999999999999999999997
Q ss_pred c
Q 042283 81 K 81 (82)
Q Consensus 81 ~ 81 (82)
+
T Consensus 454 a 454 (456)
T 4atq_A 454 A 454 (456)
T ss_dssp H
T ss_pred h
Confidence 4
|
| >4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* | Back alignment and structure |
|---|
| >4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* | Back alignment and structure |
|---|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* | Back alignment and structure |
|---|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* | Back alignment and structure |
|---|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* | Back alignment and structure |
|---|
| >4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* | Back alignment and structure |
|---|
| >2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* | Back alignment and structure |
|---|
| >3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* | Back alignment and structure |
|---|
| >3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* | Back alignment and structure |
|---|
| >4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} | Back alignment and structure |
|---|
| >2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* | Back alignment and structure |
|---|
| >2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A | Back alignment and structure |
|---|
| >2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} | Back alignment and structure |
|---|
| >3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* | Back alignment and structure |
|---|
| >3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* | Back alignment and structure |
|---|
| >1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* | Back alignment and structure |
|---|
| >3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} | Back alignment and structure |
|---|
| >3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* | Back alignment and structure |
|---|
| >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* | Back alignment and structure |
|---|
| >1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 | Back alignment and structure |
|---|
| >3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* | Back alignment and structure |
|---|
| >3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* | Back alignment and structure |
|---|
| >1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* | Back alignment and structure |
|---|
| >1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* | Back alignment and structure |
|---|
| >3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* | Back alignment and structure |
|---|
| >3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* | Back alignment and structure |
|---|
| >3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* | Back alignment and structure |
|---|
| >2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} | Back alignment and structure |
|---|
| >3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* | Back alignment and structure |
|---|
| >1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* | Back alignment and structure |
|---|
| >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 | Back alignment and structure |
|---|
| >1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... | Back alignment and structure |
|---|
| >3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A | Back alignment and structure |
|---|
| >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* | Back alignment and structure |
|---|
| >3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* | Back alignment and structure |
|---|
| >2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* | Back alignment and structure |
|---|
| >2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* | Back alignment and structure |
|---|
| >3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* | Back alignment and structure |
|---|
| >3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* | Back alignment and structure |
|---|
| >1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* | Back alignment and structure |
|---|
| >1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* | Back alignment and structure |
|---|
| >2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* | Back alignment and structure |
|---|
| >3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* | Back alignment and structure |
|---|
| >1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* | Back alignment and structure |
|---|
| >3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* | Back alignment and structure |
|---|
| >3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* | Back alignment and structure |
|---|
| >3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} | Back alignment and structure |
|---|
| >3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* | Back alignment and structure |
|---|
| >3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* | Back alignment and structure |
|---|
| >1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* | Back alignment and structure |
|---|
| >2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* | Back alignment and structure |
|---|
| >3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* | Back alignment and structure |
|---|
| >2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} | Back alignment and structure |
|---|
| >3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* | Back alignment and structure |
|---|
| >3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* | Back alignment and structure |
|---|
| >1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* | Back alignment and structure |
|---|
| >1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* | Back alignment and structure |
|---|
| >3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* | Back alignment and structure |
|---|
| >3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* | Back alignment and structure |
|---|
| >3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} | Back alignment and structure |
|---|
| >1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* | Back alignment and structure |
|---|
| >2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* | Back alignment and structure |
|---|
| >2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* | Back alignment and structure |
|---|
| >2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* | Back alignment and structure |
|---|
| >1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* | Back alignment and structure |
|---|
| >1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* | Back alignment and structure |
|---|
| >2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* | Back alignment and structure |
|---|
| >2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* | Back alignment and structure |
|---|
| >3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* | Back alignment and structure |
|---|
| >2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* | Back alignment and structure |
|---|
| >2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* | Back alignment and structure |
|---|
| >3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* | Back alignment and structure |
|---|
| >1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* | Back alignment and structure |
|---|
| >3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* | Back alignment and structure |
|---|
| >3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* | Back alignment and structure |
|---|
| >3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* | Back alignment and structure |
|---|
| >1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* | Back alignment and structure |
|---|
| >3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* | Back alignment and structure |
|---|
| >3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* | Back alignment and structure |
|---|
| >3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* | Back alignment and structure |
|---|
| >2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* | Back alignment and structure |
|---|
| >2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* | Back alignment and structure |
|---|
| >3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* | Back alignment and structure |
|---|
| >2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* | Back alignment and structure |
|---|
| >3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* | Back alignment and structure |
|---|
| >3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* | Back alignment and structure |
|---|
| >2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* | Back alignment and structure |
|---|
| >2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... | Back alignment and structure |
|---|
| >3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} | Back alignment and structure |
|---|
| >1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* | Back alignment and structure |
|---|
| >3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B | Back alignment and structure |
|---|
| >2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* | Back alignment and structure |
|---|
| >2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* | Back alignment and structure |
|---|
| >2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* | Back alignment and structure |
|---|
| >1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* | Back alignment and structure |
|---|
| >3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* | Back alignment and structure |
|---|
| >3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* | Back alignment and structure |
|---|
| >2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 | Back alignment and structure |
|---|
| >4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* | Back alignment and structure |
|---|
| >3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* | Back alignment and structure |
|---|
| >2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* | Back alignment and structure |
|---|
| >3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 | Back alignment and structure |
|---|
| >1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* | Back alignment and structure |
|---|
| >3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* | Back alignment and structure |
|---|
| >1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* | Back alignment and structure |
|---|
| >2fqm_A Phosphoprotein, P protein; negative strand RNA virus, polymerase, replication, cofactor, viral protein; 2.30A {Vesicular stomatitis indiana virus} SCOP: d.378.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 82 | ||||
| d1sffa_ | 425 | c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA | 4e-17 | |
| d1z7da1 | 404 | c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla | 7e-16 | |
| d2byla1 | 404 | c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu | 9e-15 | |
| d1ohwa_ | 461 | c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA | 2e-14 | |
| d1zoda1 | 431 | c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {P | 5e-14 | |
| d1vefa1 | 387 | c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a | 2e-13 | |
| d1s0aa_ | 429 | c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona | 3e-12 | |
| d2gsaa_ | 427 | c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase | 3e-05 | |
| d1v72a1 | 345 | c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps | 2e-04 |
| >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: GABA-aminotransferase-like domain: 4-aminobutyrate aminotransferase, GABA-aminotransferase species: Escherichia coli [TaxId: 562]
Score = 71.8 bits (175), Expect = 4e-17
Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)
Query: 1 DKYGTIGDARGWGFMLGVEFVTDSQLRKAE---TLDVMDKMKQMGVLIGKGGFYGNVFRI 57
+K+ IGD RG G M+ +E D K + T +++ + + G+++ G Y NV RI
Sbjct: 339 EKHPEIGDVRGLGAMIAIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRI 398
Query: 58 APPLCFTKEDANYLVDVMD 76
PL ++++
Sbjct: 399 LVPLTIEDAQIRQGLEIIS 417
|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 | Back information, alignment and structure |
|---|
| >d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Length = 461 | Back information, alignment and structure |
|---|
| >d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Length = 431 | Back information, alignment and structure |
|---|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 | Back information, alignment and structure |
|---|
| >d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 | Back information, alignment and structure |
|---|
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 | Back information, alignment and structure |
|---|
| >d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| d1sffa_ | 425 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 99.77 | |
| d1ohwa_ | 461 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 99.77 | |
| d1s0aa_ | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.75 | |
| d1zoda1 | 431 | Dialkylglycine decarboxylase {Pseudomonas cepacia | 99.74 | |
| d1z7da1 | 404 | Ornithine aminotransferase {Plasmodium yoelii yoel | 99.73 | |
| d2byla1 | 404 | Ornithine aminotransferase {Human (Homo sapiens) [ | 99.72 | |
| d1vefa1 | 387 | Acetylornithine/acetyl-lysine aminotransferase Arg | 99.64 | |
| d2gsaa_ | 427 | Glutamate-1-semialdehyde aminomutase (aminotransfe | 98.9 | |
| d1m6sa_ | 343 | Low-specificity threonine aldolase {Thermotoga mar | 98.52 | |
| d1v72a1 | 345 | Phenylserine aldolase PSALD {Pseudomonas putida [T | 98.18 | |
| d1qz9a_ | 404 | Kynureninase {Pseudomonas fluorescens [TaxId: 294] | 97.87 | |
| d1fc4a_ | 401 | 2-amino-3-ketobutyrate CoA ligase {Escherichia col | 97.66 | |
| d1elua_ | 381 | Cystine C-S lyase C-des {Synechocystis sp. [TaxId: | 97.33 | |
| d1ax4a_ | 465 | Tryptophan indol-lyase (tryptophanase) {Proteus vu | 97.1 | |
| d1bs0a_ | 383 | PLP-dependent acyl-CoA synthase (8-amino-7-oxonano | 97.06 | |
| d1h0ca_ | 388 | Alanine-glyoxylate aminotransferase {Human (Homo s | 96.66 | |
| d1svva_ | 340 | Low-specificity threonine aldolase {Leishmania maj | 96.64 | |
| d1wsta1 | 403 | Multiple substrate aminotransferase, MSAT {Thermoc | 96.49 | |
| d1lc5a_ | 355 | L-threonine-O-3-phosphate decarboxylase CobD {Salm | 96.46 | |
| d1t3ia_ | 408 | Probable cysteine desulfurase SufS {Synechocystis | 96.42 | |
| d1jf9a_ | 405 | NifS-like protein/selenocysteine lyase {Escherichi | 96.22 | |
| d1vjoa_ | 377 | Alanine-glyoxylate aminotransferase {Cyanobacteria | 96.1 | |
| d1d2fa_ | 361 | Modulator in mal gene expression, MalY {Escherichi | 96.04 | |
| d2hoxa1 | 425 | Alliinase {Garlic (Allium sativum) [TaxId: 4682]} | 96.04 | |
| d1m32a_ | 361 | 2-aminoethylphosphonate transaminase {Salmonella t | 96.01 | |
| d1o4sa_ | 375 | Aspartate aminotransferase, AAT {Thermotoga mariti | 95.97 | |
| d2ch1a1 | 388 | 3-hydroxykynurenine transaminase {Malaria mosquito | 95.74 | |
| d1eg5a_ | 376 | NifS-like protein/selenocysteine lyase {Thermotoga | 95.71 | |
| d1c7na_ | 394 | Cystalysin {Treponema denticola [TaxId: 158]} | 95.37 | |
| d2v1pa1 | 467 | Tryptophan indol-lyase (tryptophanase) {Escherichi | 95.36 | |
| d2c0ra1 | 361 | Phosphoserine aminotransferase, PSAT {Bacillus cir | 95.27 | |
| d1gdea_ | 388 | Aromatic aminoacid aminotransferase, AroAT {Archae | 95.24 | |
| d1vp4a_ | 420 | Putative aminotransferase TM1131 {Thermotoga marit | 95.24 | |
| d1xi9a_ | 395 | Putative alanine aminotransferase {Pyrococcus furi | 95.2 | |
| d1b5pa_ | 382 | Aspartate aminotransferase, AAT {Thermus thermophi | 95.15 | |
| d2f8ja1 | 334 | Histidinol-phosphate aminotransferase HisC {Thermo | 95.06 | |
| d1bw0a_ | 412 | Tyrosine aminotransferase (TAT) {Trypanosoma cruzi | 94.68 | |
| d1fg7a_ | 354 | Histidinol-phosphate aminotransferase HisC {Escher | 94.68 | |
| d1c4ka2 | 462 | Ornithine decarboxylase major domain {Lactobacillu | 94.57 | |
| d1v2da_ | 368 | Glutamine aminotransferase {Thermus thermophilus [ | 94.14 | |
| d2bwna1 | 396 | 5-aminolevulinate synthase {Rhodobacter capsulatus | 93.98 | |
| d1bjna_ | 360 | Phosphoserine aminotransferase, PSAT {Escherichia | 93.92 | |
| d3bc8a1 | 445 | Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu | 93.72 | |
| d1iaya_ | 428 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 93.48 | |
| d1p3wa_ | 391 | Cysteine desulfurase IscS {Escherichia coli [TaxId | 93.14 | |
| d1m7ya_ | 431 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 92.76 | |
| d2gb3a1 | 389 | AAT homologue TM1698 {Thermotoga maritima [TaxId: | 92.32 | |
| d1j32a_ | 388 | Aspartate aminotransferase, AAT {Phormidium lapide | 91.98 | |
| d1wyua1 | 437 | Glycine dehydrogenase (decarboxylating) subunit 1 | 90.62 | |
| d1w23a_ | 360 | Phosphoserine aminotransferase, PSAT {Bacillus alc | 90.53 | |
| d1w7la_ | 418 | Kynurenine--oxoglutarate transaminase I {Human (Ho | 90.44 | |
| d1iuga_ | 348 | Subgroup IV putative aspartate aminotransferase {T | 89.82 | |
| d1wyub1 | 471 | Glycine dehydrogenase subunit 2 (P-protein) {Therm | 89.73 | |
| d2z67a1 | 434 | Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco | 89.52 | |
| d2r5ea1 | 418 | Kynurenine--oxoglutarate transaminase I {Yellowfev | 89.03 | |
| d1c7ga_ | 456 | Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 | 88.9 | |
| d1u08a_ | 382 | Putative methionine aminotransferase YdbL {Escheri | 88.89 | |
| d2fqma1 | 65 | Phosphoprotein P (M1) {Vesicular stomatitis indian | 85.77 | |
| d1c75a_ | 71 | Cytochrome c6 (synonym: cytochrome c553) {Bacillus | 84.19 | |
| d351ca_ | 82 | Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 28 | 82.59 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 82.47 | |
| d2e7ja1 | 364 | Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl | 80.6 |
| >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: GABA-aminotransferase-like domain: 4-aminobutyrate aminotransferase, GABA-aminotransferase species: Escherichia coli [TaxId: 562]
Probab=99.77 E-value=5.6e-19 Score=120.78 Aligned_cols=80 Identities=25% Similarity=0.444 Sum_probs=71.0
Q ss_pred CCCceeeecccceEEEEEeeeCCCCc---hHHHHHHHHHHHHcCceeeecCCCCCEEEEecCcccCHHHHHHHHHHHHHh
Q 042283 2 KYGTIGDARGWGFMLGVEFVTDSQLR---KAETLDVMDKMKQMGVLIGKGGFYGNVFRIAPPLCFTKEDANYLVDVMDCS 78 (82)
Q Consensus 2 ~~~~v~~vRg~Glm~gie~~~~~~~~---~~~~~~v~~~~~~~Gll~~~~g~~~~~i~~~PPL~i~~~eid~~~~~l~~~ 78 (82)
+||.+.+|||.|+|++++|..+.... ...+..+.+.|+++|+++.+++..+|+|+|+|||++|++|||+++++++++
T Consensus 340 ~~~~v~~vrg~Gl~~~i~f~~~~~~~~~~~~~~~~~~~~l~~~Gvl~~~~g~~~n~i~~~PpL~it~~eid~~l~~l~~a 419 (425)
T d1sffa_ 340 KHPEIGDVRGLGAMIAIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC 419 (425)
T ss_dssp TCTTEEEEEEETTEEEEEEBGGGCTTSBCHHHHHHHHHHHHHTTEECEEESTTSCEEEECCCTTCCHHHHHHHHHHHHHH
T ss_pred hCCceEEEEccccEEEEEEeccCccCCccHHHHHHHHHHHHHCCCEEeccCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Confidence 68899999999999999998654322 456788999999999999998888899999999999999999999999999
Q ss_pred Hhc
Q 042283 79 MTK 81 (82)
Q Consensus 79 l~~ 81 (82)
|++
T Consensus 420 l~e 422 (425)
T d1sffa_ 420 FDE 422 (425)
T ss_dssp HHH
T ss_pred HHH
Confidence 964
|
| >d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} | Back information, alignment and structure |
|---|
| >d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} | Back information, alignment and structure |
|---|
| >d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} | Back information, alignment and structure |
|---|
| >d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} | Back information, alignment and structure |
|---|
| >d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} | Back information, alignment and structure |
|---|
| >d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} | Back information, alignment and structure |
|---|
| >d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} | Back information, alignment and structure |
|---|
| >d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} | Back information, alignment and structure |
|---|
| >d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} | Back information, alignment and structure |
|---|
| >d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} | Back information, alignment and structure |
|---|
| >d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} | Back information, alignment and structure |
|---|
| >d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fqma1 d.378.1.1 (A:107-171) Phosphoprotein P (M1) {Vesicular stomatitis indiana virus [TaxId: 11277]} | Back information, alignment and structure |
|---|
| >d1c75a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]} | Back information, alignment and structure |
|---|
| >d351ca_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|