Citrus Sinensis ID: 044708
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| 225437340 | 324 | PREDICTED: E3 ubiquitin-protein ligase B | 0.961 | 0.929 | 0.571 | 1e-101 | |
| 224128498 | 320 | predicted protein [Populus trichocarpa] | 0.948 | 0.928 | 0.580 | 2e-97 | |
| 255564140 | 330 | ubiquitin-protein ligase, putative [Rici | 0.971 | 0.921 | 0.566 | 2e-96 | |
| 356505572 | 324 | PREDICTED: E3 ubiquitin-protein ligase B | 0.961 | 0.929 | 0.571 | 3e-96 | |
| 356572738 | 324 | PREDICTED: E3 ubiquitin-protein ligase B | 0.961 | 0.929 | 0.571 | 5e-95 | |
| 356505574 | 322 | PREDICTED: E3 ubiquitin-protein ligase B | 0.955 | 0.928 | 0.571 | 1e-94 | |
| 224068330 | 320 | predicted protein [Populus trichocarpa] | 0.948 | 0.928 | 0.559 | 1e-94 | |
| 356535248 | 315 | PREDICTED: E3 ubiquitin-protein ligase B | 0.929 | 0.923 | 0.534 | 2e-92 | |
| 449436501 | 330 | PREDICTED: E3 ubiquitin-protein ligase B | 0.971 | 0.921 | 0.525 | 6e-91 | |
| 357442533 | 316 | E3 ubiquitin-protein ligase BAH1 [Medica | 0.932 | 0.924 | 0.545 | 2e-87 |
| >gi|225437340|ref|XP_002265436.1| PREDICTED: E3 ubiquitin-protein ligase BAH1 [Vitis vinifera] gi|297743873|emb|CBI36843.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 375 bits (963), Expect = e-101, Method: Compositional matrix adjust.
Identities = 192/336 (57%), Positives = 242/336 (72%), Gaps = 35/336 (10%)
Query: 1 MKFCKKYEEYMQQKQQKLPKVACKKLKKILKKCRLACQSQKDPESNSNADGVAQIKITSC 60
MKFCKKY+EYMQ +++KLP V KKLKKILK+CR Q QK E GV + I +C
Sbjct: 1 MKFCKKYQEYMQAQEKKLPGVGFKKLKKILKRCRRDLQIQKGLE------GV--VDIPTC 52
Query: 61 HNRCPVCDGAFFPTLVNDMSAVVRYFNKRAKKLINLHQAAGLKKYFLWIKGKMQGQGTHV 120
+ C VCDG FFP+L+ +MS +V FN+RA+KL++LH A+G++KY++W KGK+QG HV
Sbjct: 53 PHHCQVCDGTFFPSLLKEMSEIVGCFNERAQKLLDLHLASGVRKYYIWFKGKLQG--NHV 110
Query: 121 SSLIEQGKELVVYALINAIMIRKILKKYDK-----------------------SPWLREL 157
+ LI++GK+LV YA+INA IRKILKKYDK SPWL EL
Sbjct: 111 A-LIQEGKDLVTYAMINATAIRKILKKYDKVHYSKQGQAFKSQAQSMHMEILQSPWLCEL 169
Query: 158 MALHINLGETNVSSSTMAAMSSEGYRLTFNDDKLSLSCELFDSIRLDIELTCPVCLETVF 217
MA HINL E+ S A+ +G LTFND K SLSCELFDS++LDI+LTC +CL+TVF
Sbjct: 170 MAFHINLRESKAKSRKAPALF-DGCSLTFNDGKPSLSCELFDSVKLDIDLTCSICLDTVF 228
Query: 218 DPVSLTCGHILCKMCACSAASVSIVDGLKLADPREKCPLCRQASVFMLFLQIYLINGCYI 277
DPVSLTCGHI C MCACSAASV+IVDGLK+A+P+EKCPLCR+A V+ + + +N
Sbjct: 229 DPVSLTCGHIFCYMCACSAASVTIVDGLKIAEPKEKCPLCREAGVYEGAVHLEELNILLS 288
Query: 278 NSCREYWEKRLQIERVERVKQAKEYWENQCRAFMGI 313
SC EYWE+RLQ ER ER++QAKE+WE+QCRAFMG+
Sbjct: 289 RSCHEYWEQRLQTERTERIRQAKEHWESQCRAFMGV 324
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224128498|ref|XP_002320347.1| predicted protein [Populus trichocarpa] gi|222861120|gb|EEE98662.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255564140|ref|XP_002523067.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223537629|gb|EEF39252.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356505572|ref|XP_003521564.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356572738|ref|XP_003554523.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505574|ref|XP_003521565.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224068330|ref|XP_002302708.1| predicted protein [Populus trichocarpa] gi|222844434|gb|EEE81981.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356535248|ref|XP_003536160.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449436501|ref|XP_004136031.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357442533|ref|XP_003591544.1| E3 ubiquitin-protein ligase BAH1 [Medicago truncatula] gi|355480592|gb|AES61795.1| E3 ubiquitin-protein ligase BAH1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| TAIR|locus:2024675 | 335 | NLA "nitrogen limitation adapt | 0.552 | 0.516 | 0.533 | 2e-73 | |
| TAIR|locus:2064935 | 335 | AT2G38920 [Arabidopsis thalian | 0.504 | 0.471 | 0.414 | 9.8e-48 | |
| UNIPROTKB|A2AE50 | 122 | TRIM26 "Tripartite motif-conta | 0.156 | 0.401 | 0.350 | 2.5e-08 | |
| UNIPROTKB|Q5SPU2 | 157 | TRIM26 "Tripartite motif-conta | 0.156 | 0.312 | 0.350 | 2.1e-07 | |
| UNIPROTKB|C9JWN8 | 72 | TRIM5 "Tripartite motif-contai | 0.153 | 0.666 | 0.396 | 1.4e-06 | |
| UNIPROTKB|C9J060 | 203 | TRIM22 "E3 ubiquitin-protein l | 0.175 | 0.270 | 0.360 | 2.6e-06 | |
| UNIPROTKB|D6RAS2 | 90 | TRIM60 "Tripartite motif-conta | 0.159 | 0.555 | 0.413 | 4e-06 | |
| UNIPROTKB|C9JIU5 | 227 | TRIM22 "E3 ubiquitin-protein l | 0.175 | 0.242 | 0.360 | 4.7e-06 | |
| UNIPROTKB|G3N137 | 160 | G3N137 "Uncharacterized protei | 0.210 | 0.412 | 0.410 | 7.4e-06 | |
| UNIPROTKB|E1BM69 | 497 | LOC516599 "Uncharacterized pro | 0.172 | 0.108 | 0.413 | 9.9e-06 |
| TAIR|locus:2024675 NLA "nitrogen limitation adaptation" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 497 (180.0 bits), Expect = 2.0e-73, Sum P(2) = 2.0e-73
Identities = 96/180 (53%), Positives = 129/180 (71%)
Query: 141 IRKILKKYDKSPWLRELMALHINLGETNVSS-STMAAMSS------EGYRLTFNDDKLSL 193
++K+ + +SPWL ELMA HINL E+ S +T+ + +G LTF+D K L
Sbjct: 156 VQKMRIEILQSPWLCELMAFHINLKESKKESGATITSPPPPVHALFDGCALTFDDGKPLL 215
Query: 194 SCELFDSIRLDIELTCPVCLETVFDPVSLTCGHILCKMCACSAASVSIVDGLKLADPREK 253
SCEL DS+++DI+LTC +CL+TVFDP+SLTCGHI C MCACSAASV++VDGLK A+ EK
Sbjct: 216 SCELSDSVKVDIDLTCSICLDTVFDPISLTCGHIYCYMCACSAASVNVVDGLKTAEATEK 275
Query: 254 CPLCRQASVFMLFLQIYLINGCYINSCREYWEKRLQIERVERVKQAKEYWENQCRAFMGI 313
CPLCR+ V+ + + +N SCR+YWE+R + ER ER++QAKEYW+ QCR+F GI
Sbjct: 276 CPLCREDGVYKGAVHLDELNILLKRSCRDYWEERRKTERAERLQQAKEYWDYQCRSFTGI 335
|
|
| TAIR|locus:2064935 AT2G38920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2AE50 TRIM26 "Tripartite motif-containing protein 26" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5SPU2 TRIM26 "Tripartite motif-containing protein 26" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JWN8 TRIM5 "Tripartite motif-containing protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J060 TRIM22 "E3 ubiquitin-protein ligase TRIM22" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RAS2 TRIM60 "Tripartite motif-containing protein 60" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JIU5 TRIM22 "E3 ubiquitin-protein ligase TRIM22" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N137 G3N137 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BM69 LOC516599 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027985001 | SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (324 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| pfam03105 | 176 | pfam03105, SPX, SPX domain | 9e-13 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-05 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 1e-04 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-04 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 0.002 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 0.003 | |
| PRK11009 | 237 | PRK11009, aphA, acid phosphatase/phosphotransferas | 0.003 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 0.004 |
| >gnl|CDD|217372 pfam03105, SPX, SPX domain | Back alignment and domain information |
|---|
Score = 65.1 bits (159), Expect = 9e-13
Identities = 32/167 (19%), Positives = 58/167 (34%), Gaps = 23/167 (13%)
Query: 1 MKFCKKYEEYMQQKQQKLPKVACKKLKKILKKCRLACQSQKDPESNSNADGVAQIKITSC 60
MKF K E + + + + K LKK++K+ + +N DG +
Sbjct: 1 MKFGKSLERNLVPEWRDK-YIDYKALKKLIKELT-----RAKLSLTTNEDGEDESSNLLN 54
Query: 61 HNRCPVCDGAFFPTLVNDMSAVVRYFNKRAKKLINLHQAAGLKKYFLWIKGKMQGQGT-- 118
+ FF L ++ V ++ ++ +L+ + + L +
Sbjct: 55 EEELEEDESEFFEALDKELEKVNSFYKEKEAELLERLEELEKQLEELEERRDETSSAKSS 114
Query: 119 ---------------HVSSLIEQGKELVVYALINAIMIRKILKKYDK 150
+ L + + L Y +N RKILKKYDK
Sbjct: 115 PSDKNLLKAFEELKKALLELYRELQLLKSYIELNRTGFRKILKKYDK 161
|
We have named this region the SPX domain after (SYG1, Pho81 and XPR1). This 180 residue length domain is found at the amino terminus of a variety of proteins. In the yeast protein SYG1, the N-terminus directly binds to the G- protein beta subunit and inhibits transduction of the mating pheromone signal. This finding suggests that all the members of this family are involved in G-protein associated signal transduction. The N-termini of several proteins involved in the regulation of phosphate transport, including the putative phosphate level sensors PHO81 from Saccharomyces cerevisiae and NUC-2 from Neurospora crassa, are also members of this family. The SPX domain of S. cerevisiae low-affinity phosphate transporters Pho87 and Pho90 auto-regulates uptake and prevents efflux. This SPX dependent inhibition is mediated by the physical interaction with Spl2 NUC-2 contains several ankyrin repeats pfam00023. Several members of this family are annotated as XPR1 proteins: the xenotropic and polytropic retrovirus receptor confers susceptibility to infection with murine leukaemia viruses (MLV). The similarity between SYG1, phosphate regulators and XPR1 sequences has been previously noted, as has the additional similarity to several predicted proteins, of unknown function, from Drosophila melanogaster, Arabidopsis thaliana, Caenorhabditis elegans, Schizosaccharomyces pombe, and Saccharomyces cerevisiae. In addition, given the similarities between XPR1 and SYG1 and phosphate regulatory proteins, it has been proposed that XPR1 might be involved in G-protein associated signal transduction and may itself function as a phosphate sensor. Length = 176 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236818 PRK11009, aphA, acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| KOG1161 | 310 | consensus Protein involved in vacuolar polyphospha | 99.89 | |
| PF03105 | 275 | SPX: SPX domain; InterPro: IPR004331 The SPX domai | 99.87 | |
| KOG1162 | 617 | consensus Predicted small molecule transporter [In | 99.82 | |
| COG5036 | 509 | SPX domain-containing protein involved in vacuolar | 99.48 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.44 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.42 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.29 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 99.26 | |
| COG5408 | 296 | SPX domain-containing protein [Signal transduction | 99.22 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.22 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.22 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.08 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.06 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 99.05 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 99.04 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.01 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.0 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.96 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.93 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.88 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.88 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.87 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.77 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.76 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.74 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.71 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.7 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.59 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.59 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.59 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.58 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.51 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.46 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.19 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.13 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.03 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.96 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 97.92 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.89 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.88 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.88 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.83 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.78 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.7 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.68 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.61 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.61 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.51 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.46 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.35 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 97.32 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.27 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.23 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.19 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.99 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.64 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 96.57 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.54 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 96.46 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.36 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.34 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.2 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.01 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 96.0 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.95 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.93 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.87 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 95.85 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 95.72 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.52 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 95.38 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.32 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.28 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.68 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.61 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 94.53 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.47 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.38 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 94.33 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 94.32 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 94.3 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.26 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.24 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 94.1 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 93.29 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 93.22 | |
| PHA03096 | 284 | p28-like protein; Provisional | 93.07 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 92.76 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 91.63 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 90.57 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.11 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.0 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 89.44 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 89.19 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 89.05 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 88.76 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.7 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 87.06 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 84.07 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 83.95 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 83.87 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.98 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 82.78 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 82.6 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.57 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 80.51 |
| >KOG1161 consensus Protein involved in vacuolar polyphosphate accumulation, contains SPX domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.89 E-value=6e-23 Score=185.67 Aligned_cols=123 Identities=23% Similarity=0.211 Sum_probs=89.1
Q ss_pred CCCccccHHHHhccccCCCccchHHHHHHHHhchhhccCCCCCCCCCCCCCchhhhhhhccCCCCcchhchhHHHHHHHH
Q 044708 1 MKFCKKYEEYMQQKQQKLPKVACKKLKKILKKCRLACQSQKDPESNSNADGVAQIKITSCHNRCPVCDGAFFPTLVNDMS 80 (313)
Q Consensus 1 MKFgk~~~~~~~~~~~~~~yi~Yk~LKk~ik~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ff~~l~~El~ 80 (313)
|||||.|++.+.| +|+++||+||.|||+||+.......... ++ ..+.+|+..|++||+
T Consensus 1 MkFGk~L~~~~l~-ew~~~yinYk~LKK~lK~~~~~~~~~~~-~~--------------------~~e~dFv~~Ld~ELE 58 (310)
T KOG1161|consen 1 MKFGKYLKEELLP-EWKDKYINYKELKKLLKQYSIQTADSSP-DS--------------------RDESDFVRLLDAELE 58 (310)
T ss_pred CchhHHHHHhhhh-hHhhhhcCHHHHHHHHHHhccccccCCc-cc--------------------chHHHHHHHHHHHHH
Confidence 9999999988888 6899999999999999997543221100 00 037789999999999
Q ss_pred HHHHHHHHHHHHHHHHHhhh------h-----hHHHHHHHHccccCCCccHHHHHHHhHHHHHHHHhhHHHHHHHHhhcC
Q 044708 81 AVVRYFNKRAKKLINLHQAA------G-----LKKYFLWIKGKMQGQGTHVSSLIEQGKELVVYALINAIMIRKILKKYD 149 (313)
Q Consensus 81 ki~~ff~~r~~~l~~~~~~~------~-----~~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~y~~lN~tg~rKilkk~~ 149 (313)
||++||.++.++++.+.... + ...-+..++.. .. ++.++...|.+|++||+|||+|||||||
T Consensus 59 Kv~~F~lek~~el~~Rl~~L~e~~~~~~~~~~~~~~~~~lr~~------l~-~~~~em~~L~~fs~LN~tGf~KILKK~D 131 (310)
T KOG1161|consen 59 KVNGFQLEKESELIIRLKELEEKIDALSLEPPSAEEMKELREE------LV-DFHGEMVLLENFSRLNYTGFAKILKKHD 131 (310)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhccccCCcchhHHHHHHHH------HH-HHHHHHHHHHHHHHHhHHHHHHHHHHHh
Confidence 99999999888875443210 0 00011112221 12 5566778999999999999999999999
Q ss_pred Chh
Q 044708 150 KSP 152 (313)
Q Consensus 150 k~~ 152 (313)
|+.
T Consensus 132 Krt 134 (310)
T KOG1161|consen 132 KRT 134 (310)
T ss_pred ccc
Confidence 943
|
|
| >PF03105 SPX: SPX domain; InterPro: IPR004331 The SPX domain is named after SYG1/Pho81/XPR1 proteins | Back alignment and domain information |
|---|
| >KOG1162 consensus Predicted small molecule transporter [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5036 SPX domain-containing protein involved in vacuolar polyphosphate accumulation [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5408 SPX domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 313 | ||||
| 2egp_A | 79 | Solution Structure Of The Ring-Finger Domain From H | 2e-05 | ||
| 2ecv_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 1e-04 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 3e-04 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 5e-04 |
| >pdb|2EGP|A Chain A, Solution Structure Of The Ring-Finger Domain From Human Tripartite Motif Protein 34 Length = 79 | Back alignment and structure |
|
| >pdb|2ECV|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Tripartite Motif-Containing Protein 5 Length = 85 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 3e-10 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 6e-10 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 8e-10 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 8e-10 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 2e-09 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 3e-09 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 1e-08 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 2e-08 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 5e-08 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-08 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 5e-08 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 8e-08 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 9e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 1e-07 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-07 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-07 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 2e-07 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 2e-07 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 4e-07 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 6e-07 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 1e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 1e-06 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 2e-06 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 2e-06 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 2e-06 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 3e-06 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 3e-06 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 3e-06 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 7e-05 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-04 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 7e-04 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 8e-04 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 8e-04 |
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
Score = 54.7 bits (132), Expect = 3e-10
Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%)
Query: 206 ELTCPVCLETVFDPVSLTCGHILCKMCACSAASVSIVDGLKLADPREKCPLCRQAS 261
E+ CP+CL+ + PV++ CGH C C I + + KCPLC+ +
Sbjct: 20 EVICPICLDILQKPVTIDCGHNFCLKC--------ITQIGETSCGFFKCPLCKTSV 67
|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.58 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.58 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.56 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.56 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.56 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.55 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.52 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.5 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.48 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.47 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.46 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.46 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.43 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.42 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.42 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.41 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.41 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.4 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.4 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.39 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.39 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.39 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.36 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.35 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.34 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.34 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.34 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.33 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.3 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.28 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.27 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.27 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.26 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.26 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.26 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.25 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.25 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.23 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.22 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.18 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.18 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.18 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.17 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.17 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.16 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.14 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.12 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.11 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.1 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.09 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.05 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.01 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.01 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.95 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.93 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.93 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.89 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.89 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.84 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.83 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.8 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.77 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.76 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.72 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.61 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.4 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.16 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.67 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.35 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.2 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 97.15 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.09 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.81 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 92.25 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 91.69 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 89.53 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 88.24 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 82.42 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 80.75 |
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=99.58 E-value=1.2e-15 Score=114.53 Aligned_cols=71 Identities=14% Similarity=0.109 Sum_probs=61.2
Q ss_pred cCCccCccccccccccCceEcccCCcchHHHHHHhhhhhhhccccCCCCCCCCCCCcCCccchhhhhhhhhhHHHHHHHH
Q 044708 202 RLDIELTCPVCLETVFDPVSLTCGHILCKMCACSAASVSIVDGLKLADPREKCPLCRQASVFMLFLQIYLINGCYINSCR 281 (313)
Q Consensus 202 ~~~~~l~C~IC~~~~~~Pv~l~CgH~FC~~Cl~~~~~~~~~~~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~n~~l~~l~~ 281 (313)
.+.+++.||||++++.+||+++|||+||+.||..|+. ....||.|+.++....+. .|..++++++
T Consensus 10 ~~p~~~~CpI~~~~m~dPV~~~cGhtf~r~~I~~~l~-----------~~~~cP~~~~~l~~~~l~----pn~~L~~~i~ 74 (85)
T 2kr4_A 10 DAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLL-----------NSPTDPFNRQMLTESMLE----PVPELKEQIQ 74 (85)
T ss_dssp TCCTTTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHH-----------HCSBCTTTCCBCCGGGCE----ECHHHHHHHH
T ss_pred cCchheECcccCchhcCCeECCCCCEECHHHHHHHHh-----------cCCCCCCCcCCCChHhcc----hHHHHHHHHH
Confidence 3567999999999999999999999999999999982 246899999999877655 8888999999
Q ss_pred HHHHHH
Q 044708 282 EYWEKR 287 (313)
Q Consensus 282 ~~~~~~ 287 (313)
.|....
T Consensus 75 ~~~~~~ 80 (85)
T 2kr4_A 75 AWMREK 80 (85)
T ss_dssp HHHHHH
T ss_pred HHHHHh
Confidence 886544
|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 313 | ||||
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-07 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 2e-07 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-06 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-06 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-04 |
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: brca1 RING domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 47.0 bits (111), Expect = 1e-07
Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 8/58 (13%)
Query: 202 RLDIELTCPVCLETVFDPVSLTCGHILCKMCACSAASVSIVDGLKLADPREKCPLCRQ 259
+ L CP+CLE + +PVS C HI CK C ++ L +CPLC+
Sbjct: 17 AMQKILECPICLELIKEPVSTKCDHIFCKFC--------MLKLLNQKKGPSQCPLCKN 66
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.6 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.59 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.54 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.51 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.48 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.45 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.34 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.29 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.2 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.17 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.11 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.07 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.81 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.66 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.54 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.28 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 93.43 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.60 E-value=1.3e-16 Score=116.51 Aligned_cols=70 Identities=10% Similarity=0.015 Sum_probs=59.7
Q ss_pred cCCccCccccccccccCceEcccCCcchHHHHHHhhhhhhhccccCCCCCCCCCCCcCCccchhhhhhhhhhHHHHHHHH
Q 044708 202 RLDIELTCPVCLETVFDPVSLTCGHILCKMCACSAASVSIVDGLKLADPREKCPLCRQASVFMLFLQIYLINGCYINSCR 281 (313)
Q Consensus 202 ~~~~~l~C~IC~~~~~~Pv~l~CgH~FC~~Cl~~~~~~~~~~~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~n~~l~~l~~ 281 (313)
++.+++.||||+++|.+||+++|||+||+.||.+|+. .....||.||.++...+.. .|..|+++++
T Consensus 3 eiP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~----------~~~~~cP~c~~~l~~~~l~----pN~~L~~~I~ 68 (80)
T d2c2la2 3 DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQ----------RVGHFNPVTRSPLTQEQLI----PNLAMKEVID 68 (80)
T ss_dssp CCCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHH----------HTCSSCTTTCCCCCGGGCE----ECHHHHHHHH
T ss_pred CCCccccCcCcCchhhhhcccCCcCeecHHHHHHHHh----------cCCccCCCccccccccccc----cHHHHHHHHH
Confidence 3458999999999999999999999999999999972 3456799999998876654 7888999998
Q ss_pred HHHH
Q 044708 282 EYWE 285 (313)
Q Consensus 282 ~~~~ 285 (313)
.|.+
T Consensus 69 ~~l~ 72 (80)
T d2c2la2 69 AFIS 72 (80)
T ss_dssp HHHT
T ss_pred HHHH
Confidence 8754
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|