Psyllid ID: psy10044

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MVTHPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLSLIG
cccccccccccccccEEEEccccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccHHHHHcccHHHHHHHcccccccccEEEEEEccccc
ccccccEEEEEcccHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHccccccccEccHHHHHHHHHHHHcHHEEEEcccccccEEEEEEEccccccc
mvthpdtnhaqgpefdevlvGQGARRVRDLFKAakdrtpcvvFIDEIdsvgakrtnsvlhpyaNQTINQLLAEMDGFHQNEGVVVLgatnrrddldkallrpgrfdievnvpppdytgrrEILDLYLGKivsknidvdtlargttgftgadLENMVNQAALRAAIDGVPHVTMKYLEYARDkvlmgperksrlpdeetNMITAYHEGGHAVVAFFTkdsenhlthpiTLNLSLIG
mvthpdtnhaqgpefdevlvgQGARRVRDLFkaakdrtpcvvFIDEIDSVgakrtnsvlhPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKallrpgrfdievnvpppdytgrREILDLYLGKIvsknidvdtlarGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYardkvlmgperksrlpdEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLSLIG
MVTHPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLSLIG
*****************VLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLM**************MITAYHEGGHAVVAFFTKDSENHLTHPITLNL****
****P*TNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNS**HPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPERKSR**DEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLSLIG
*********AQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLSLIG
***HPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGA*******HPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTHPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLSLIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
P54813 723 ATP-dependent zinc metall no N/A 0.897 0.291 0.676 3e-81
O88967 715 ATP-dependent zinc metall yes N/A 0.897 0.295 0.613 3e-75
Q96TA2 773 ATP-dependent zinc metall no N/A 0.897 0.272 0.608 1e-74
Q925S8 715 ATP-dependent zinc metall yes N/A 0.897 0.295 0.603 2e-73
P46508 662 ATP-dependent zinc metall N/A N/A 0.893 0.317 0.589 1e-69
Q8LQJ8 715 ATP-dependent zinc metall yes N/A 0.923 0.303 0.542 3e-65
Q8LQJ9 709 ATP-dependent zinc metall no N/A 0.880 0.291 0.559 3e-64
Q9FGM0 806 ATP-dependent zinc metall yes N/A 0.889 0.259 0.539 5e-63
O80983 717 ATP-dependent zinc metall no N/A 0.880 0.288 0.540 8e-63
A2ZVG7 784 ATP-dependent zinc metall no N/A 0.889 0.266 0.504 2e-58
>sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 Back     alignment and function desciption
 Score =  301 bits (770), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 144/213 (67%), Positives = 169/213 (79%), Gaps = 2/213 (0%)

Query: 9   HAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTIN 68
           H  G EFDEVLVGQGARRVRDLF  AK R PC++FIDEIDSVG+KR ++ +HPYANQTIN
Sbjct: 311 HTAGSEFDEVLVGQGARRVRDLFDKAKARAPCIIFIDEIDSVGSKRVSNSIHPYANQTIN 370

Query: 69  QLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLG 128
           QLL+EMDGF +NEG++V+ ATNR DDLDKALLRPGRFD+ V VP PD  GR +I + YL 
Sbjct: 371 QLLSEMDGFTRNEGIIVIAATNRVDDLDKALLRPGRFDVRVTVPKPDLAGRVDIFNFYLS 430

Query: 129 KIV-SKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGP 187
           KIV S  ID   LA+G+TGFTGAD+ENMVNQAAL+AA D    VTM YL+ ARD+VLMGP
Sbjct: 431 KIVHSGGIDPKVLAKGSTGFTGADIENMVNQAALKAATDNAVEVTMAYLDEARDRVLMGP 490

Query: 188 ERK-SRLPDEETNMITAYHEGGHAVVAFFTKDS 219
            R   R+PDEE N  TAYHE GH +V+ +TKD+
Sbjct: 491 ARTGGRIPDEEANRNTAYHEAGHTLVSLYTKDA 523
Putative ATP-dependent protease.
Caenorhabditis elegans (taxid: 6239)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=2 SV=1 Back     alignment and function description
>sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 Back     alignment and function description
>sp|Q925S8|YMEL1_RAT ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 Back     alignment and function description
>sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 Back     alignment and function description
>sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 Back     alignment and function description
>sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 Back     alignment and function description
>sp|Q9FGM0|FTSHB_ARATH ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FTSH11 PE=1 SV=1 Back     alignment and function description
>sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 Back     alignment and function description
>sp|A2ZVG7|FTSH9_ORYSJ ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH9 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
91086165 716 PREDICTED: similar to GA17483-PA [Tribol 0.931 0.305 0.805 1e-105
312375083 790 hypothetical protein AND_15087 [Anophele 0.931 0.277 0.819 1e-103
158298980 570 AGAP009973-PA [Anopheles gambiae str. PE 0.931 0.384 0.814 1e-103
157167438 598 metalloprotease m41 ftsh [Aedes aegypti] 0.931 0.366 0.819 1e-103
332375729 721 unknown [Dendroctonus ponderosae] 0.931 0.303 0.796 1e-102
170033703 757 cell division protease ftsH [Culex quinq 0.931 0.289 0.809 1e-102
195426391 753 GK20855 [Drosophila willistoni] gi|19415 0.931 0.290 0.805 1e-102
386768486 740 CG3499, isoform C [Drosophila melanogast 0.931 0.295 0.805 1e-102
24658770 736 CG3499, isoform B [Drosophila melanogast 0.931 0.297 0.805 1e-102
442624487 739 CG3499, isoform D [Drosophila melanogast 0.931 0.296 0.805 1e-102
>gi|91086165|ref|XP_970259.1| PREDICTED: similar to GA17483-PA [Tribolium castaneum] gi|270009883|gb|EFA06331.1| hypothetical protein TcasGA2_TC009202 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/221 (80%), Positives = 205/221 (92%), Gaps = 2/221 (0%)

Query: 9   HAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTIN 68
           HA GPEFDE+LVGQGARRVRDLFK+AK++ PCV+FIDEIDSVGAKRTNSVLHPYANQTIN
Sbjct: 338 HAAGPEFDEILVGQGARRVRDLFKSAKEKAPCVIFIDEIDSVGAKRTNSVLHPYANQTIN 397

Query: 69  QLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLG 128
           QLL+EMDGFHQNEGV+VLGATNRRDDLD+ALLRPGRFD+EV VP PD+TGR+EIL LYLG
Sbjct: 398 QLLSEMDGFHQNEGVIVLGATNRRDDLDQALLRPGRFDVEVTVPTPDFTGRKEILGLYLG 457

Query: 129 KIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPE 188
           K+++K++D++ LARGTTGFTGADLENMVNQAAL+AAIDG   V+MKYLE ARDKVLMGPE
Sbjct: 458 KVLAKDVDLELLARGTTGFTGADLENMVNQAALKAAIDGADCVSMKYLESARDKVLMGPE 517

Query: 189 RKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITL 229
           RKSR+PDEE N+ITAYHEGGHA+VAF+T+DS  H  H +T+
Sbjct: 518 RKSRIPDEEANLITAYHEGGHAIVAFYTRDS--HPLHKVTI 556

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312375083|gb|EFR22519.1| hypothetical protein AND_15087 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158298980|ref|XP_319111.4| AGAP009973-PA [Anopheles gambiae str. PEST] gi|157014148|gb|EAA13918.4| AGAP009973-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157167438|ref|XP_001660693.1| metalloprotease m41 ftsh [Aedes aegypti] gi|108873589|gb|EAT37814.1| AAEL010241-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332375729|gb|AEE63005.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|170033703|ref|XP_001844716.1| cell division protease ftsH [Culex quinquefasciatus] gi|167874684|gb|EDS38067.1| cell division protease ftsH [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195426391|ref|XP_002061318.1| GK20855 [Drosophila willistoni] gi|194157403|gb|EDW72304.1| GK20855 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|386768486|ref|NP_001246473.1| CG3499, isoform C [Drosophila melanogaster] gi|328751836|gb|AEB39673.1| MIP17311p [Drosophila melanogaster] gi|383302656|gb|AFH08226.1| CG3499, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24658770|ref|NP_726263.1| CG3499, isoform B [Drosophila melanogaster] gi|15291271|gb|AAK92904.1| GH14313p [Drosophila melanogaster] gi|23240115|gb|AAM71132.2| CG3499, isoform B [Drosophila melanogaster] gi|220945266|gb|ACL85176.1| CG3499-PB [synthetic construct] gi|220954998|gb|ACL90042.1| CG3499-PB [synthetic construct] Back     alignment and taxonomy information
>gi|442624487|ref|NP_001261142.1| CG3499, isoform D [Drosophila melanogaster] gi|440214588|gb|AGB93673.1| CG3499, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
FB|FBgn0034792 736 CG3499 [Drosophila melanogaste 0.931 0.297 0.805 5.5e-93
WB|WBGene00010842 723 ymel-1 [Caenorhabditis elegans 0.931 0.302 0.654 2.5e-74
UNIPROTKB|F1NTK8 712 YME1L1 "Uncharacterized protei 0.897 0.296 0.617 1e-68
UNIPROTKB|F1P519 717 YME1L1 "Uncharacterized protei 0.897 0.294 0.617 1e-68
MGI|MGI:1351651 715 Yme1l1 "YME1-like 1 (S. cerevi 0.897 0.295 0.613 1.7e-68
UNIPROTKB|G3V886 715 Yme1l1 "YME1-like 1 (S. cerevi 0.897 0.295 0.613 1.7e-68
ZFIN|ZDB-GENE-070410-25 722 yme1l1b "YME1-like 1b" [Danio 0.897 0.292 0.613 2.1e-68
ZFIN|ZDB-GENE-091113-41 729 yme1l1a "YME1-like 1a" [Danio 0.897 0.289 0.632 2.7e-68
UNIPROTKB|A6QR12 717 YME1L1 "Uncharacterized protei 0.897 0.294 0.608 4.4e-68
UNIPROTKB|F1PRV6 748 YME1L1 "Uncharacterized protei 0.897 0.282 0.608 4.4e-68
FB|FBgn0034792 CG3499 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 926 (331.0 bits), Expect = 5.5e-93, P = 5.5e-93
 Identities = 178/221 (80%), Positives = 197/221 (89%)

Query:     9 HAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTIN 68
             HA GPEFDEVLVGQGARRVRDLFKAAK R PCV+FIDEIDSVGAKRTNSVLHPYANQTIN
Sbjct:   363 HAAGPEFDEVLVGQGARRVRDLFKAAKARAPCVIFIDEIDSVGAKRTNSVLHPYANQTIN 422

Query:    69 QLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLG 128
             QLL+EMDGFHQN GV+VLGATNRRDDLD+ALLRPGRFD+EV V  PD+TGR+EIL LYL 
Sbjct:   423 QLLSEMDGFHQNAGVIVLGATNRRDDLDQALLRPGRFDVEVMVSTPDFTGRKEILSLYLT 482

Query:   129 KIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPE 188
             KI+   ID+D LARGT+GFTGADLENM+NQAALRAAIDG   V+MK+LE ARDKVLMGPE
Sbjct:   483 KILHDEIDLDMLARGTSGFTGADLENMINQAALRAAIDGAETVSMKHLETARDKVLMGPE 542

Query:   189 RKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITL 229
             RK+RLPDEE N ITAYHEGGHA+VAF+TK+S  H  H +T+
Sbjct:   543 RKARLPDEEANTITAYHEGGHAIVAFYTKES--HPLHKVTI 581
GO:0004176 "ATP-dependent peptidase activity" evidence=ISS
GO:0005743 "mitochondrial inner membrane" evidence=ISS
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0030163 "protein catabolic process" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
WB|WBGene00010842 ymel-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTK8 YME1L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P519 YME1L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1351651 Yme1l1 "YME1-like 1 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V886 Yme1l1 "YME1-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-25 yme1l1b "YME1-like 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-41 yme1l1a "YME1-like 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A6QR12 YME1L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRV6 YME1L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A1URA3FTSH_BARBK3, ., 4, ., 2, 4, ., -0.51940.86380.2657yesN/A
B3DY14FTSH2_METI43, ., 4, ., 2, 4, ., -0.51130.91910.3369yesN/A
Q6MLS7FTSH1_BDEBA3, ., 4, ., 2, 4, ., -0.51210.85950.3131yesN/A
Q1RGP0FTSH_RICBR3, ., 4, ., 2, 4, ., -0.50230.89360.3291yesN/A
Q9FGM0FTSHB_ARATH3, ., 4, ., 2, 4, ., -0.53910.88930.2593yesN/A
C6V4R9FTSH_NEORI3, ., 4, ., 2, 4, ., -0.53360.85530.3160yesN/A
C1F8X6FTSH_ACIC53, ., 4, ., 2, 4, ., -0.52030.91910.3380yesN/A
A8F7F7FTSH_THELT3, ., 4, ., 2, 4, ., -0.52400.87230.3274yesN/A
C8WEG0FTSH_ZYMMN3, ., 4, ., 2, 4, ., -0.53880.86380.3066yesN/A
Q8LQJ8FTSH5_ORYSJ3, ., 4, ., 2, 4, ., -0.54290.92340.3034yesN/A
Q4UN68FTSH_RICFE3, ., 4, ., 2, 4, ., -0.50710.87650.3244yesN/A
P32795YME1_YEAST3, ., 4, ., 2, 4, ., -0.50720.87230.2744yesN/A
A9EXK6FTSH4_SORC53, ., 4, ., 2, 4, ., -0.52680.85950.3117yesN/A
A0PXM8FTSH_CLONN3, ., 4, ., 2, 4, ., -0.51410.88930.3091yesN/A
Q04Q03FTSH_LEPBJ3, ., 4, ., 2, 4, ., -0.52910.86380.3113yesN/A
B0K5A3FTSH1_THEPX3, ., 4, ., 2, 4, ., -0.53650.85950.3306yesN/A
C5CES8FTSH_KOSOT3, ., 4, ., 2, 4, ., -0.52150.87650.3193yesN/A
Q925S8YMEL1_RAT3, ., 4, ., 2, 4, ., -0.60370.89780.2951yesN/A
B8H444FTSH_CAUCN3, ., 4, ., 2, 4, ., -0.53620.86800.3258yesN/A
B2A3Q4FTSH_NATTJ3, ., 4, ., 2, 4, ., -0.52650.86800.2943yesN/A
D1C1U7FTSH1_SPHTD3, ., 4, ., 2, 4, ., -0.52680.85950.3093yesN/A
Q68XR9FTSH_RICTY3, ., 4, ., 2, 4, ., -0.50710.87650.3233yesN/A
Q9WZ49FTSH_THEMA3, ., 4, ., 2, 4, ., -0.51160.90210.3475yesN/A
Q92JJ9FTSH_RICCN3, ., 4, ., 2, 4, ., -0.50710.87650.3233yesN/A
A0L4S0FTSH_MAGSM3, ., 4, ., 2, 4, ., -0.51940.86380.3016yesN/A
Q6LUJ8FTSH_PHOPR3, ., 4, ., 2, 4, ., -0.50950.88080.2974yesN/A
Q1LLA9FTSH_RALME3, ., 4, ., 2, 4, ., -0.54140.85950.3112yesN/A
A6TWP7FTSH2_ALKMQ3, ., 4, ., 2, 4, ., -0.51700.85950.2931yesN/A
O88967YMEL1_MOUSE3, ., 4, ., 2, 4, ., -0.61320.89780.2951yesN/A
Q9ZEA2FTSH_RICPR3, ., 4, ., 2, 4, ., -0.50710.87650.3233yesN/A
Q2JNP0FTSH_SYNJB3, ., 4, ., 2, 4, ., -0.52940.85530.3150yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-89
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-78
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 1e-65
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-62
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-55
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 4e-55
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-45
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 9e-42
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-41
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-33
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 2e-33
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-32
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-29
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 4e-29
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 8e-25
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-23
pfam01434 212 pfam01434, Peptidase_M41, Peptidase family M41 1e-18
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 7e-13
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 1e-09
smart00382148 smart00382, AAA, ATPases associated with a variety 5e-09
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information 
 Score =  272 bits (697), Expect = 1e-89
 Identities = 107/212 (50%), Positives = 142/212 (66%), Gaps = 3/212 (1%)

Query: 12  GPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPY--ANQTINQ 69
           G +F E+ VG GA RVRDLF+ AK   PC++FIDEID+VG +R   +        QT+NQ
Sbjct: 121 GSDFVEMFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQ 180

Query: 70  LLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYL-G 128
           LL EMDGF  N GV+V+ ATNR D LD ALLRPGRFD +V V  PD  GR EIL ++   
Sbjct: 181 LLVEMDGFGTNTGVIVIAATNRPDVLDPALLRPGRFDRQVVVDLPDIKGREEILKVHAKN 240

Query: 129 KIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPE 188
           K ++ ++D+  +AR T GF+GADL N++N+AAL AA      +TM  +E A D+V+ GPE
Sbjct: 241 KKLAPDVDLKAVARRTPGFSGADLANLLNEAALLAARKNKTEITMNDIEEAIDRVIAGPE 300

Query: 189 RKSRLPDEETNMITAYHEGGHAVVAFFTKDSE 220
           +KSR+  E+   + AYHE GHA+V    KD++
Sbjct: 301 KKSRVISEKEKKLVAYHEAGHALVGLLLKDAD 332

HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 495
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|216502 pfam01434, Peptidase_M41, Peptidase family M41 Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
KOG0734|consensus 752 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
KOG0731|consensus 774 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730|consensus693 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
KOG0733|consensus802 100.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
CHL00176 638 ftsH cell division protein; Validated 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
KOG0733|consensus 802 100.0
KOG0738|consensus491 100.0
KOG0736|consensus953 100.0
KOG0728|consensus404 100.0
KOG0727|consensus408 100.0
KOG0739|consensus439 100.0
KOG0726|consensus440 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0735|consensus952 100.0
KOG0652|consensus424 100.0
KOG0729|consensus435 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0737|consensus386 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
KOG0730|consensus 693 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.97
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.97
KOG0741|consensus 744 99.97
KOG0651|consensus388 99.97
KOG0740|consensus428 99.97
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.96
KOG0732|consensus 1080 99.95
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.95
KOG0735|consensus 952 99.86
KOG0736|consensus 953 99.84
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.78
KOG0742|consensus630 99.75
PF00004132 AAA: ATPase family associated with various cellula 99.74
KOG0744|consensus423 99.61
CHL00181287 cbbX CbbX; Provisional 99.51
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.49
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.48
KOG0743|consensus457 99.45
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.39
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.33
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.26
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.24
PRK10865 857 protein disaggregation chaperone; Provisional 99.11
CHL00095 821 clpC Clp protease ATP binding subunit 99.09
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.07
PRK00149450 dnaA chromosomal replication initiation protein; R 98.95
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.93
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.89
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.88
PF01434 213 Peptidase_M41: Peptidase family M41 This is family 98.88
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.86
PRK14088440 dnaA chromosomal replication initiation protein; P 98.84
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 98.78
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.77
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 98.75
PRK14086617 dnaA chromosomal replication initiation protein; P 98.67
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.66
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.61
KOG2004|consensus 906 98.56
PRK13342 413 recombination factor protein RarA; Reviewed 98.55
PRK14087450 dnaA chromosomal replication initiation protein; P 98.54
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.54
PRK12422445 chromosomal replication initiation protein; Provis 98.51
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.5
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.46
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.42
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.41
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.38
PRK06893229 DNA replication initiation factor; Validated 98.35
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.32
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.3
PRK07940394 DNA polymerase III subunit delta'; Validated 98.29
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.28
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.27
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 98.25
PRK04195 482 replication factor C large subunit; Provisional 98.23
PRK12402337 replication factor C small subunit 2; Reviewed 98.23
COG0593408 DnaA ATPase involved in DNA replication initiation 98.22
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.21
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.2
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.19
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.17
PRK13341 725 recombination factor protein RarA/unknown domain f 98.16
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.14
PRK04132846 replication factor C small subunit; Provisional 98.14
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 98.13
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.12
KOG2028|consensus 554 98.11
PRK08727233 hypothetical protein; Validated 98.11
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.09
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.08
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.07
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.06
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.06
PHA02544316 44 clamp loader, small subunit; Provisional 98.05
PRK05642234 DNA replication initiation factor; Validated 98.04
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.01
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 97.99
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.99
PRK13407334 bchI magnesium chelatase subunit I; Provisional 97.98
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.98
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.96
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.95
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.95
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.95
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.94
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.94
PRK08084235 DNA replication initiation factor; Provisional 97.94
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.92
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.92
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.9
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.87
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 97.86
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.86
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.86
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.85
PRK09087226 hypothetical protein; Validated 97.84
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.81
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.81
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 97.8
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.79
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.78
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.76
PRK06620214 hypothetical protein; Validated 97.76
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 97.75
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.75
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.71
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.7
smart00350509 MCM minichromosome maintenance proteins. 97.69
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.65
PRK05707328 DNA polymerase III subunit delta'; Validated 97.61
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 97.61
PRK00440319 rfc replication factor C small subunit; Reviewed 97.59
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.59
CHL00195 489 ycf46 Ycf46; Provisional 97.53
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.53
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.49
PLN03025319 replication factor C subunit; Provisional 97.47
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.44
PRK09112351 DNA polymerase III subunit delta'; Validated 97.42
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.39
KOG1514|consensus767 97.38
PRK06964342 DNA polymerase III subunit delta'; Validated 97.33
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.33
PRK07471365 DNA polymerase III subunit delta'; Validated 97.31
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.29
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 97.26
PRK06871325 DNA polymerase III subunit delta'; Validated 97.22
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 97.21
PRK07993334 DNA polymerase III subunit delta'; Validated 97.2
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.14
KOG0741|consensus744 97.07
CHL00095821 clpC Clp protease ATP binding subunit 97.05
PRK06090319 DNA polymerase III subunit delta'; Validated 97.04
PRK09862506 putative ATP-dependent protease; Provisional 97.04
COG0714329 MoxR-like ATPases [General function prediction onl 97.02
PRK08769319 DNA polymerase III subunit delta'; Validated 96.98
KOG1942|consensus456 96.98
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.96
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 96.95
smart00382148 AAA ATPases associated with a variety of cellular 96.84
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.82
KOG2680|consensus454 96.8
PRK05564313 DNA polymerase III subunit delta'; Validated 96.66
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 96.59
KOG2227|consensus529 96.58
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.56
PRK07276290 DNA polymerase III subunit delta'; Validated 96.55
PRK10865857 protein disaggregation chaperone; Provisional 96.52
PRK07399314 DNA polymerase III subunit delta'; Validated 96.47
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.46
PRK13765 637 ATP-dependent protease Lon; Provisional 96.45
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 96.44
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 96.4
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.37
PRK08058329 DNA polymerase III subunit delta'; Validated 96.28
PRK14700 300 recombination factor protein RarA; Provisional 96.19
PRK13531 498 regulatory ATPase RavA; Provisional 96.16
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.04
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.99
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.91
KOG0745|consensus564 95.85
PHA02244383 ATPase-like protein 95.76
PRK06581263 DNA polymerase III subunit delta'; Validated 95.58
PRK08699325 DNA polymerase III subunit delta'; Validated 95.56
PRK10365441 transcriptional regulatory protein ZraR; Provision 95.38
KOG0989|consensus346 95.37
PRK05917290 DNA polymerase III subunit delta'; Validated 95.31
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 95.22
COG1221403 PspF Transcriptional regulators containing an AAA- 94.87
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 94.79
PF05729166 NACHT: NACHT domain 94.77
TIGR02974329 phageshock_pspF psp operon transcriptional activat 94.73
PTZ00111915 DNA replication licensing factor MCM4; Provisional 94.58
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 94.57
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 94.42
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 94.28
TIGR01817534 nifA Nif-specific regulatory protein. This model r 94.27
PRK05818261 DNA polymerase III subunit delta'; Validated 94.26
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 94.21
KOG1051|consensus 898 94.16
PRK15115444 response regulator GlrR; Provisional 94.08
PRK07132299 DNA polymerase III subunit delta'; Validated 93.93
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 93.92
PRK05022509 anaerobic nitric oxide reductase transcription reg 93.88
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 93.86
PRK08485206 DNA polymerase III subunit delta'; Validated 93.68
KOG2228|consensus408 93.64
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 93.56
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 93.54
PRK11608326 pspF phage shock protein operon transcriptional ac 93.52
PF12846304 AAA_10: AAA-like domain 93.43
TIGR02329526 propionate_PrpR propionate catabolism operon regul 93.4
PRK15429686 formate hydrogenlyase transcriptional activator Fh 93.17
KOG2035|consensus351 93.13
PRK07452326 DNA polymerase III subunit delta; Validated 93.09
COG1241682 MCM2 Predicted ATPase involved in replication cont 93.05
PRK15424538 propionate catabolism operon regulatory protein Pr 92.58
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 92.56
COG2204464 AtoC Response regulator containing CheY-like recei 92.52
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 92.22
PRK05574340 holA DNA polymerase III subunit delta; Reviewed 91.71
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 91.46
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 91.29
TIGR01128302 holA DNA polymerase III, delta subunit. subunit ar 91.16
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 91.08
PRK08116268 hypothetical protein; Validated 90.95
PF13173128 AAA_14: AAA domain 90.58
KOG1969|consensus 877 90.56
PF14516331 AAA_35: AAA-like domain 90.09
KOG0482|consensus721 89.09
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 89.05
KOG0478|consensus804 87.36
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 87.19
KOG0480|consensus764 86.89
PF07726131 AAA_3: ATPase family associated with various cellu 86.82
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 86.07
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 85.7
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 85.16
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 84.78
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 84.57
PF05872502 DUF853: Bacterial protein of unknown function (DUF 84.44
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 83.77
COG0606490 Predicted ATPase with chaperone activity [Posttran 83.03
KOG1051|consensus898 82.42
COG3829560 RocR Transcriptional regulator containing PAS, AAA 82.11
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 80.96
PRK13898800 type IV secretion system ATPase VirB4; Provisional 80.45
>KOG0734|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-56  Score=398.38  Aligned_cols=227  Identities=62%  Similarity=0.952  Sum_probs=219.8

Q ss_pred             CCCeeEEeccchhhhhhccHHHHHHHHHHHHHhhCCCeEEEEccccccccccCCCCCCccHHHHHHHHHHHhcCCCCCCC
Q psy10044          3 THPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEG   82 (235)
Q Consensus         3 s~~~~~~v~~s~l~~~~~g~~~~~i~~~F~~A~~~~P~Il~iDeiD~l~~~r~~~~~~~~~~~~~~~ll~~ld~~~~~~~   82 (235)
                      +|+|||+.+||+|-++|+|.+.+++|++|..|++++||||||||||+++++|.....+ +.++.+|+||.+|||+..+.+
T Consensus       361 A~VPFF~~sGSEFdEm~VGvGArRVRdLF~aAk~~APcIIFIDEiDavG~kR~~~~~~-y~kqTlNQLLvEmDGF~qNeG  439 (752)
T KOG0734|consen  361 AGVPFFYASGSEFDEMFVGVGARRVRDLFAAAKARAPCIIFIDEIDAVGGKRNPSDQH-YAKQTLNQLLVEMDGFKQNEG  439 (752)
T ss_pred             cCCCeEeccccchhhhhhcccHHHHHHHHHHHHhcCCeEEEEechhhhcccCCccHHH-HHHHHHHHHHHHhcCcCcCCc
Confidence            5899999999999999999999999999999999999999999999999999766544 899999999999999999999


Q ss_pred             eEEEEecCCCCcccHHhhCCCcccEEEEcCCCCHHHHHHHHHHHhcCc-cCCCCCHHHHHhcCCCCCHHHHHHHHHHHHH
Q psy10044         83 VVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKI-VSKNIDVDTLARGTTGFTGADLENMVNQAAL  161 (235)
Q Consensus        83 v~vIatTn~~~~ld~al~rpgRf~~~i~i~~P~~~~R~~il~~~l~~~-~~~~~~l~~la~~t~G~s~~di~~l~~~A~~  161 (235)
                      |+|||+||+|+.||+||.||||||++|.+|.||...|.+||+.|+++. ...++|+.-+|+-|.||||+||+++||.|+.
T Consensus       440 iIvigATNfpe~LD~AL~RPGRFD~~v~Vp~PDv~GR~eIL~~yl~ki~~~~~VD~~iiARGT~GFsGAdLaNlVNqAAl  519 (752)
T KOG0734|consen  440 IIVIGATNFPEALDKALTRPGRFDRHVTVPLPDVRGRTEILKLYLSKIPLDEDVDPKIIARGTPGFSGADLANLVNQAAL  519 (752)
T ss_pred             eEEEeccCChhhhhHHhcCCCccceeEecCCCCcccHHHHHHHHHhcCCcccCCCHhHhccCCCCCchHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999998 5679999999999999999999999999999


Q ss_pred             HHHHcCCCCCcHHHHHHHHHHhhCCcccCCCCCchhhhHHHHHHHHHHHHHHhhhcCCCCCCccceEEEec
Q psy10044        162 RAAIDGVPHVTMKYLEYARDKVLMGPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSENHLTHPITLNLS  232 (235)
Q Consensus       162 ~a~~~~~~~i~~~~~~~al~~~~~~~~~~~~~~~~e~~~~~a~~e~gha~~~~~~~~~~~~~~~~~~~~~~  232 (235)
                      +|+.++...+++++++.|.+++.+|+++++..++++-+.++||||+|||+++.+.+.+-  |+||.+|.|-
T Consensus       520 kAa~dga~~VtM~~LE~akDrIlMG~ERks~~i~~eak~~TAyHE~GHAivA~yTk~A~--PlhKaTImPR  588 (752)
T KOG0734|consen  520 KAAVDGAEMVTMKHLEFAKDRILMGPERKSMVIDEEAKKITAYHEGGHAIVALYTKGAM--PLHKATIMPR  588 (752)
T ss_pred             HHHhcCcccccHHHHhhhhhheeecccccccccChhhhhhhhhhccCceEEEeecCCCc--cccceeeccC
Confidence            99999999999999999999999999999999999999999999999999999999998  9999999984

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF01434 Peptidase_M41: Peptidase family M41 This is family M41 in the peptidase classification Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK08485 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>PRK07452 DNA polymerase III subunit delta; Validated Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK05574 holA DNA polymerase III subunit delta; Reviewed Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR01128 holA DNA polymerase III, delta subunit Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2ce7_A 476 Edta Treated Length = 476 3e-54
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 3e-54
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-47
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-47
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 5e-45
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 1e-38
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 5e-37
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-37
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 9e-37
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 7e-33
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-27
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 3e-27
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-27
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 3e-27
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 4e-25
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 4e-25
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 3e-24
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 4e-24
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 4e-24
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 4e-24
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 5e-24
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 3e-22
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 3e-22
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 7e-22
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-15
1xwi_A322 Crystal Structure Of Vps4b Length = 322 3e-15
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 5e-14
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 1e-13
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-13
3b9p_A297 Spastin Length = 297 2e-13
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-13
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 2e-13
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 3e-13
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure 
Iteration: 1

 Score =  207 bits (528), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 144/215 (66%), Gaps = 3/215 (1%)
Query: 9   HAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVL--HPYANQT 66
           H  G +F E+ VG GA RVRDLF  AK   PC+VFIDEID+VG  R   +   H    QT
Sbjct: 79  HISGSDFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRHRGAGLGGGHDEREQT 138
Query: 67  INQLLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLY 126
           +NQLL EMDGF   EG++V+ ATNR D LD ALLRPGRFD ++ V PPD  GR++IL+++
Sbjct: 139 LNQLLVEMDGFDSKEGIIVMAATNRPDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIH 198
Query: 127 L-GKIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLM 185
              K ++++++++ +A+ T GF GADLEN+VN+AAL AA +G   +TMK  E A D+V+ 
Sbjct: 199 TRNKPLAEDVNLEIIAKRTPGFVGADLENLVNEAALLAAREGRDKITMKDFEEAIDRVIA 258
Query: 186 GPERKSRLPDEETNMITAYHEGGHAVVAFFTKDSE 220
           GP RKS L       I AYHE GHAVV+    + E
Sbjct: 259 GPARKSLLISPAEKRIIAYHEAGHAVVSTVVPNGE 293
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-92
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-91
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-80
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-79
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-76
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-68
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-68
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-61
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-56
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 4e-54
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-54
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-43
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 5e-50
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 3e-42
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-42
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 4e-42
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 3e-41
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 7e-41
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 9e-41
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 4e-40
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 7e-38
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-31
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 7e-27
2krk_A86 26S protease regulatory subunit 8; structural geno 3e-21
3kw6_A78 26S protease regulatory subunit 8; structural geno 7e-20
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 9e-15
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 2e-14
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-11
2di4_A 238 Zinc protease, cell division protein FTSH homolog; 9e-11
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 7e-08
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
 Score =  277 bits (712), Expect = 3e-92
 Identities = 109/212 (51%), Positives = 143/212 (67%), Gaps = 3/212 (1%)

Query: 12  GPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVL--HPYANQTINQ 69
           G +F E+ VG GA RVRDLF  AK   PC+VFIDEID+VG  R   +   H    QT+NQ
Sbjct: 82  GSDFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRHRGAGLGGGHDEREQTLNQ 141

Query: 70  LLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYL-G 128
           LL EMDGF   EG++V+ ATNR D LD ALLRPGRFD ++ V PPD  GR++IL+++   
Sbjct: 142 LLVEMDGFDSKEGIIVMAATNRPDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRN 201

Query: 129 KIVSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMGPE 188
           K ++++++++ +A+ T GF GADLEN+VN+AAL AA +G   +TMK  E A D+V+ GP 
Sbjct: 202 KPLAEDVNLEIIAKRTPGFVGADLENLVNEAALLAAREGRDKITMKDFEEAIDRVIAGPA 261

Query: 189 RKSRLPDEETNMITAYHEGGHAVVAFFTKDSE 220
           RKS L       I AYHE GHAVV+    + E
Sbjct: 262 RKSLLISPAEKRIIAYHEAGHAVVSTVVPNGE 293
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Length = 238 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 100.0
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.98
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.97
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.97
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.96
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.96
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.96
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.96
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.95
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.95
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.95
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.94
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.93
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.93
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.93
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.92
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.92
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.92
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.86
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.7
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.65
2krk_A86 26S protease regulatory subunit 8; structural geno 99.65
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.61
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.55
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.52
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.48
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.46
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.44
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.43
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.38
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.35
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.32
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.28
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.28
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.28
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.19
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.14
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.12
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.1
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.08
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.07
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.06
3pvs_A 447 Replication-associated recombination protein A; ma 99.06
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.06
3bos_A242 Putative DNA replication factor; P-loop containing 99.05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.03
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.01
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.01
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.98
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.94
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.92
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 98.87
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.85
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 98.85
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.83
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.82
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.8
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.78
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.72
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.69
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.67
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.66
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.65
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.63
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.6
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.54
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.52
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.45
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.38
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.36
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.25
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.17
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.15
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.12
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.09
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.86
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.84
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.83
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.82
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.82
3f8t_A506 Predicted ATPase involved in replication control, 97.29
3co5_A143 Putative two-component system transcriptional RES 97.15
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.85
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.73
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 96.69
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.47
2fna_A357 Conserved hypothetical protein; structural genomic 95.97
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 95.66
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 95.19
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.03
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.84
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.24
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.94
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 92.84
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.76
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.37
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 91.71
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 86.44
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 85.88
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.8e-44  Score=320.51  Aligned_cols=184  Identities=35%  Similarity=0.587  Sum_probs=173.0

Q ss_pred             CCCeeEEeccchhhhhhccHHHHHHHHHHHHHhhCCCeEEEEccccccccccCCCC--CCccHHHHHHHHHHHhcCCCCC
Q psy10044          3 THPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSV--LHPYANQTINQLLAEMDGFHQN   80 (235)
Q Consensus         3 s~~~~~~v~~s~l~~~~~g~~~~~i~~~F~~A~~~~P~Il~iDeiD~l~~~r~~~~--~~~~~~~~~~~ll~~ld~~~~~   80 (235)
                      +|+||+.|+++++.++|+|+++++++.+|..|+..+||||||||+|+++++|....  .+....+++++||.+||++...
T Consensus       206 ~~~~f~~v~~s~l~sk~vGese~~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~~  285 (405)
T 4b4t_J          206 TDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETS  285 (405)
T ss_dssp             HTCEEEEEEGGGGSCSSTTHHHHHHHHHHHHHHHTCSEEEEEESSSCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTCC
T ss_pred             hCCCceEEEhHHhhccccchHHHHHHHHHHHHHHhCCceEeeecchhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCCC
Confidence            47899999999999999999999999999999999999999999999999886443  2345678999999999999999


Q ss_pred             CCeEEEEecCCCCcccHHhhCCCcccEEEEcCCCCHHHHHHHHHHHhcCc-cCCCCCHHHHHhcCCCCCHHHHHHHHHHH
Q psy10044         81 EGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKI-VSKNIDVDTLARGTTGFTGADLENMVNQA  159 (235)
Q Consensus        81 ~~v~vIatTn~~~~ld~al~rpgRf~~~i~i~~P~~~~R~~il~~~l~~~-~~~~~~l~~la~~t~G~s~~di~~l~~~A  159 (235)
                      .+|+||||||+|+.||||++||||||++|+|++|+.++|.+||+.++++. ...++|+..||+.|+||||+||+++|++|
T Consensus       286 ~~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~lA~~t~G~SGADi~~l~~eA  365 (405)
T 4b4t_J          286 KNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEA  365 (405)
T ss_dssp             CCEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHHHHHHCCSCCHHHHHHHHHHH
T ss_pred             CCeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHHHHHHCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999887 56789999999999999999999999999


Q ss_pred             HHHHHHcCCCCCcHHHHHHHHHHhhCC
Q psy10044        160 ALRAAIDGVPHVTMKYLEYARDKVLMG  186 (235)
Q Consensus       160 ~~~a~~~~~~~i~~~~~~~al~~~~~~  186 (235)
                      ++.|+++++..|+++||+.|++++.+.
T Consensus       366 ~~~Air~~~~~vt~~Df~~Al~~v~~~  392 (405)
T 4b4t_J          366 GMYALRERRIHVTQEDFELAVGKVMNK  392 (405)
T ss_dssp             HHHHHHTTCSBCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHcCCCCcCHHHHHHHHHHHhCc
Confidence            999999999999999999999998764
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-70
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-65
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 3e-46
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 8e-43
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-29
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 5e-27
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 5e-24
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 4e-15
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 5e-12
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-09
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 7e-07
d2di4a1 202 a.269.1.1 (A:406-607) Cell division protein FtsH, 3e-04
d2ce7a1 193 a.269.1.1 (A:411-603) Cell division protein FtsH, 5e-04
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  213 bits (545), Expect = 2e-70
 Identities = 92/178 (51%), Positives = 123/178 (69%), Gaps = 3/178 (1%)

Query: 12  GPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKR--TNSVLHPYANQTINQ 69
           G +F E+ VG GA RVRD+F+ AK   PC++FIDEID+VG +R       H    QT+NQ
Sbjct: 78  GSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQ 137

Query: 70  LLAEMDGFHQNEGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGK 129
           +L EMDGF  NEG++V+ ATNR D LD ALLRPGRFD +V V  PD  GR +IL +++ +
Sbjct: 138 MLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRR 197

Query: 130 I-VSKNIDVDTLARGTTGFTGADLENMVNQAALRAAIDGVPHVTMKYLEYARDKVLMG 186
           + ++ +ID   +ARGT GF+GADL N+VN+AAL AA      V+M   E A+DK++MG
Sbjct: 198 VPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG 255
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 202 Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 193 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.91
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.81
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.55
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.19
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.12
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.1
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.91
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.87
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.86
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.7
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.62
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.59
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.57
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.56
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.34
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.19
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.09
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.07
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.06
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.84
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.81
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.79
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.48
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.22
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.69
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 95.86
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.48
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 93.66
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.62
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.91
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 83.35
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 82.54
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 81.58
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 80.82
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.1e-41  Score=282.42  Aligned_cols=184  Identities=50%  Similarity=0.794  Sum_probs=172.3

Q ss_pred             CCCeeEEeccchhhhhhccHHHHHHHHHHHHHhhCCCeEEEEccccccccccCCCC--CCccHHHHHHHHHHHhcCCCCC
Q psy10044          3 THPDTNHAQGPEFDEVLVGQGARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSV--LHPYANQTINQLLAEMDGFHQN   80 (235)
Q Consensus         3 s~~~~~~v~~s~l~~~~~g~~~~~i~~~F~~A~~~~P~Il~iDeiD~l~~~r~~~~--~~~~~~~~~~~ll~~ld~~~~~   80 (235)
                      .|+|+++++++++.++|+|+++++++++|+.|++++||||||||+|+++.+|+...  .+....+++++|+..+|++..+
T Consensus        69 ~~~~~~~i~~~~l~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~  148 (256)
T d1lv7a_          69 AKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGN  148 (256)
T ss_dssp             HTCCEEEECSCSSTTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSS
T ss_pred             cCCCEEEEEhHHhhhcchhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCC
Confidence            37899999999999999999999999999999999999999999999999876443  3345678999999999999888


Q ss_pred             CCeEEEEecCCCCcccHHhhCCCcccEEEEcCCCCHHHHHHHHHHHhcCc-cCCCCCHHHHHhcCCCCCHHHHHHHHHHH
Q psy10044         81 EGVVVLGATNRRDDLDKALLRPGRFDIEVNVPPPDYTGRREILDLYLGKI-VSKNIDVDTLARGTTGFTGADLENMVNQA  159 (235)
Q Consensus        81 ~~v~vIatTn~~~~ld~al~rpgRf~~~i~i~~P~~~~R~~il~~~l~~~-~~~~~~l~~la~~t~G~s~~di~~l~~~A  159 (235)
                      .+|+||||||+|+.|||+++||||||+.|+|++|+.++|.+||+.++.+. ...++++..+++.|+|||++||.++|++|
T Consensus       149 ~~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A  228 (256)
T d1lv7a_         149 EGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEA  228 (256)
T ss_dssp             SCEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHH
T ss_pred             CCEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHHHHHhCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999887 45789999999999999999999999999


Q ss_pred             HHHHHHcCCCCCcHHHHHHHHHHhhCC
Q psy10044        160 ALRAAIDGVPHVTMKYLEYARDKVLMG  186 (235)
Q Consensus       160 ~~~a~~~~~~~i~~~~~~~al~~~~~~  186 (235)
                      +..|.++++..++.+||++|+++++.|
T Consensus       229 ~~~a~~~~~~~i~~~d~~~Al~rv~~g  255 (256)
T d1lv7a_         229 ALFAARGNKRVVSMVEFEKAKDKIMMG  255 (256)
T ss_dssp             HHHHHHTTCSSBCHHHHHHHHHHHTTC
T ss_pred             HHHHHHcCCCccCHHHHHHHHHHHhcC
Confidence            999999999999999999999999876
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure