Psyllid ID: psy10289

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
ccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccccccEEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEcccccccccccHHHccccccccEEEccccccccccHHHccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccHHcccccccccccccccccHHHHHccccccccccccccc
cccHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEcccccEEEEEccccccccccHHHHcccHcHcEEEEEccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHccccHHccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccHHHHHcccccccccccccc
MEFTLIFMSKLksldlsyndivEINPEIFKDIQDTTMLFQVTIFLYLLHSsasvmcpymcecalddrgrYEIVCrrgdmanpipigqmdlgtevlkivpseenpnhltigpifQQFQHLeelhitnsfipaigfhpfwgvpslrylnlthnNITSLLDYNFKGMMNLQELYLdfnkiesipssvfmhlsDLRVLSLAHNRISKLAPRLFLKLSklksldlsyndivEINPEIFKDIQELKtfkcrscgleninPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLldgnhfpvileksfssQFKLQVLCLKRNRLAKVTTTAFTNLTNlieldisynkldrlevasfdpienSLRDLkisgnniqlsdVKNVLDKLVKLKALSIadmnytdipkglfkmnphlqflnlsgnnlQDIHNLLYQsniklthldlsrnkfkgfdeksyimsepknIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTttaftnltnlieldisyNKLDRLEVASFDPIENSLRDLKIsgnniqlsdvknVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRlflklsklksldlsYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQlkylladeledlkkletllldGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQlsdvknvldklvklkalsIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
**FTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYI***********************NAEYAVFIASSSISYLLEA***
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFTLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAVFIASSSISYLLEALLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query497 2.2.26 [Sep-21-2011]
O02833605 Insulin-like growth facto N/A N/A 0.774 0.636 0.272 5e-26
P35858605 Insulin-like growth facto yes N/A 0.774 0.636 0.270 7e-26
P35859603 Insulin-like growth facto yes N/A 0.674 0.555 0.284 5e-25
A1A4H9 521 Leucine-rich repeat trans yes N/A 0.480 0.458 0.293 2e-24
Q5R6B1 522 Leucine-rich repeat trans yes N/A 0.480 0.457 0.289 7e-24
Q8K377 522 Leucine-rich repeat trans yes N/A 0.480 0.457 0.293 8e-24
Q86UE6 522 Leucine-rich repeat trans no N/A 0.480 0.457 0.289 8e-24
D4A6D8 523 Leucine-rich repeat trans no N/A 0.480 0.456 0.293 1e-23
P70389603 Insulin-like growth facto no N/A 0.665 0.548 0.282 1e-23
Q9DBB9547 Carboxypeptidase N subuni no N/A 0.746 0.678 0.281 1e-22
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 118/433 (27%), Positives = 188/433 (43%), Gaps = 48/433 (11%)

Query: 56  CPYMCECALDDR-GRYEIVCRRGDMA---NPIPIGQMDLGTEV--LKIVPSEE------- 102
           CP  C C+ DD      + C   ++    + IP G   L  +   L  +P          
Sbjct: 41  CPATCACSYDDEVNELSVFCSSRNLTRLPDGIPGGTQALWLDSNNLSSIPPAAFRNLSSL 100

Query: 103 ---NPNHLTIGPIFQQ----FQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITS 155
              N     +G +  Q     ++L  LH+  + + ++    F   P+L  L L++N ++ 
Sbjct: 101 AFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLAVGTFAYTPALALLGLSNNRLSR 160

Query: 156 LLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKL 215
           L D  F+G+ NL +L L +N +  +P + F  L  LR L LA NR++ L P LF  L++L
Sbjct: 161 LEDGLFEGLGNLWDLNLGWNSLAVLPDAAFRGLGGLRELVLAGNRLAYLQPALFSGLAEL 220

Query: 216 KSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKY 275
           + LDLS N +  I   +F  +  L+        +  + P  +  L  L +LDL +N++  
Sbjct: 221 RELDLSRNALRAIKANVFAQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAG 280

Query: 276 LLAD------------------------ELEDLKKLETLLLDGNHFPVILEKSFSSQFKL 311
           LL D                          EDL  LE L L  N    + E+SF    +L
Sbjct: 281 LLEDTFPGLLGLRVLRLSHNAIASLRPRTFEDLHFLEELQLGHNRIRQLAERSFEGLGQL 340

Query: 312 QVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQ 371
           +VL L  N+L +V   AF  LTN+  +++S N L  L    F  +   L  L + G+   
Sbjct: 341 EVLTLDHNQLQEVKVGAFLGLTNVAVMNLSGNCLRNLPEQVFRGL-GKLHSLHLEGSC-- 397

Query: 372 LSDVK-NVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSN 430
           L  ++ +    L  L+ L + D     I +        L  L+L+ N L  + + L+Q  
Sbjct: 398 LGRIRPHTFAGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHQLFQGL 457

Query: 431 IKLTHLDLSRNKF 443
            KL +L LS N+ 
Sbjct: 458 GKLEYLLLSHNRL 470
Involved in protein-protein interactions that result in protein complexes, receptor-ligand binding or cell adhesion.
Papio hamadryas (taxid: 9557)
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description
>sp|A1A4H9|LRRT1_BOVIN Leucine-rich repeat transmembrane neuronal protein 1 OS=Bos taurus GN=LRRTM1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6B1|LRRT1_PONAB Leucine-rich repeat transmembrane neuronal protein 1 OS=Pongo abelii GN=LRRTM1 PE=2 SV=1 Back     alignment and function description
>sp|Q8K377|LRRT1_MOUSE Leucine-rich repeat transmembrane neuronal protein 1 OS=Mus musculus GN=Lrrtm1 PE=2 SV=1 Back     alignment and function description
>sp|Q86UE6|LRRT1_HUMAN Leucine-rich repeat transmembrane neuronal protein 1 OS=Homo sapiens GN=LRRTM1 PE=2 SV=2 Back     alignment and function description
>sp|D4A6D8|LRRT1_RAT Leucine-rich repeat transmembrane neuronal protein 1 OS=Rattus norvegicus GN=Lrrtm1 PE=3 SV=1 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query497
270006814578 hypothetical protein TcasGA2_TC013196 [T 0.808 0.695 0.470 1e-104
91083685 682 PREDICTED: similar to Pray For Elves CG1 0.808 0.589 0.470 1e-104
157130348 670 leucine-rich transmembrane protein [Aede 0.780 0.579 0.448 1e-82
270007875 794 hypothetical protein TcasGA2_TC014616 [T 0.792 0.496 0.417 3e-81
189237716 893 PREDICTED: similar to leucine-rich trans 0.792 0.441 0.417 2e-80
312385235 627 hypothetical protein AND_01026 [Anophele 0.780 0.618 0.436 1e-79
158298684547 AGAP009775-PA [Anopheles gambiae str. PE 0.778 0.707 0.427 1e-77
195035621 762 GH11634 [Drosophila grimshawi] gi|193905 0.820 0.535 0.424 3e-74
194758860 753 GF14810 [Drosophila ananassae] gi|190615 0.824 0.544 0.422 3e-72
195388082 777 GJ17707 [Drosophila virilis] gi|19414917 0.824 0.527 0.424 3e-71
>gi|270006814|gb|EFA03262.1| hypothetical protein TcasGA2_TC013196 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/406 (47%), Positives = 268/406 (66%), Gaps = 4/406 (0%)

Query: 43  IFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEE 102
           + L L  +S   +CP MC+C +  +GR ++ C  G M   IP  +MD GTEVL+I     
Sbjct: 5   LLLGLCSTSGVALCPSMCQCGVTSKGRRKVQCVEGGMTEAIPTHEMDAGTEVLEISAPAG 64

Query: 103 NPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFK 162
           + N L+I P FQ+F+ LEE+HI  S +  +G HPFWGVPSL+ L+LT NNI+ + D+NF+
Sbjct: 65  DWNALSISPTFQRFKRLEEVHIRRSGLTQVGMHPFWGVPSLKLLDLTVNNISGVADHNFR 124

Query: 163 GMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSY 222
           G++NL EL LD N+I S+ S VF HL++LR+L+L  N + +L PRLFLKL KL  L LS 
Sbjct: 125 GLVNLVELNLDDNRITSLQSGVFKHLTELRILTLQRNLLDELVPRLFLKLGKLHMLKLSG 184

Query: 223 NDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELE 282
           N   E+NPE+FKDI EL+  +CR CGL  IN  +Y +L  L +LDLG NQ++++ +DE  
Sbjct: 185 NKFDELNPEVFKDIPELRVLECRECGLRRINTQIYHLLPYLSHLDLGDNQMQFIASDEFR 244

Query: 283 DLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISY 342
           DLK+L +L LDGN  PV+LE +F  Q +L+ LCL RNRLAK+T TAF NL++L +LDI Y
Sbjct: 245 DLKRLHSLKLDGNQLPVVLEHTFVRQQELKYLCLARNRLAKITNTAFVNLSSLADLDIGY 304

Query: 343 NKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGL 402
           NKLDRLE+ +  P+ ++L  L ISGN    + ++N+L+ +  ++ L +A MN   IPKG 
Sbjct: 305 NKLDRLEMQALQPVADTLERLVISGNAFGPNVIRNILNTVYNVRELGVAHMNLRHIPKGF 364

Query: 403 FKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDE 448
           F     ++ LN+S NNL ++ +       +L  LDLS N  +   E
Sbjct: 365 FP--ERVRKLNVSANNLTELESGSLPR--QLLELDLSHNDLQRLSE 406

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91083685|ref|XP_969045.1| PREDICTED: similar to Pray For Elves CG15151-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157130348|ref|XP_001661886.1| leucine-rich transmembrane protein [Aedes aegypti] gi|108871909|gb|EAT36134.1| AAEL011760-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270007875|gb|EFA04323.1| hypothetical protein TcasGA2_TC014616 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189237716|ref|XP_001810634.1| PREDICTED: similar to leucine-rich transmembrane protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312385235|gb|EFR29787.1| hypothetical protein AND_01026 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158298684|ref|XP_318863.4| AGAP009775-PA [Anopheles gambiae str. PEST] gi|157014003|gb|EAA14468.4| AGAP009775-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195035621|ref|XP_001989274.1| GH11634 [Drosophila grimshawi] gi|193905274|gb|EDW04141.1| GH11634 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194758860|ref|XP_001961676.1| GF14810 [Drosophila ananassae] gi|190615373|gb|EDV30897.1| GF14810 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195388082|ref|XP_002052719.1| GJ17707 [Drosophila virilis] gi|194149176|gb|EDW64874.1| GJ17707 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query497
FB|FBgn0243486 741 rdo "reduced ocelli" [Drosophi 0.867 0.581 0.359 5.4e-63
WB|WBGene00011345 603 dma-1 [Caenorhabditis elegans 0.790 0.651 0.258 3.3e-18
UNIPROTKB|F1NI07604 IGFALS "Uncharacterized protei 0.684 0.562 0.238 3.3e-18
FB|FBgn0036494 1514 Toll-6 "Toll-6" [Drosophila me 0.714 0.234 0.247 2e-16
UNIPROTKB|E1BX56 521 LRRTM1 "Uncharacterized protei 0.448 0.428 0.257 2.6e-16
UNIPROTKB|E2QW21 522 LRRTM1 "Uncharacterized protei 0.448 0.427 0.257 3.4e-16
RGD|70551578 Lrrc15 "leucine rich repeat co 0.698 0.600 0.249 5.5e-16
WB|WBGene00006366 680 sym-1 [Caenorhabditis elegans 0.672 0.491 0.229 1.3e-15
UNIPROTKB|A1A4H9 521 LRRTM1 "Leucine-rich repeat tr 0.448 0.428 0.248 1.6e-15
UNIPROTKB|I3L5J3 522 LRRTM1 "Uncharacterized protei 0.448 0.427 0.248 1.6e-15
FB|FBgn0243486 rdo "reduced ocelli" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 643 (231.4 bits), Expect = 5.4e-63, P = 5.4e-63
 Identities = 159/442 (35%), Positives = 229/442 (51%)

Query:    37 MLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLK 96
             +LF + I +  + S+    CP  C+C++DD  RY+ +C +G + + +   ++D+  +V+ 
Sbjct:     6 LLFSLCI-MPAMFSNTKRKCPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKVII 64

Query:    97 IVPSEENP-NHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITS 155
             I      P N +TIGP  +QF  LE L IT+S +PAIG   FWG+  LR L+L+ NNIT+
Sbjct:    65 I----RGPRNSITIGPALRQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNITN 120

Query:   156 LLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRXXXXXXXX 215
             + + NF+G  NL EL L  NK+  + SS F HL+DLR L+LA N I +L  R        
Sbjct:   121 ITENNFRGQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRL 180

Query:   216 XXXXXXYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQXXX 275
                    N + ++ P++F+D+ ELK  KCR+C L+ INP MY++L  L  LDLG N+   
Sbjct:   181 KYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKF 240

Query:   276 XXXXXXXXXXXXXXXXXXGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNL 335
                               GN   V++++ F  Q  L  L L  NRLAKV   +F  LTNL
Sbjct:   241 LDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNL 300

Query:   336 IELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQXXXXXXXXXXXX-XXXXXXIADMN 394
               LD+SYNKL RLE  S   + N L  L ISGN +                    IADM 
Sbjct:   301 TFLDLSYNKLVRLEPQSIRSLSNLLT-LNISGNVLMDLREMRETFELIPQLTHLAIADMG 359

Query:   395 YTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMS 454
                +P GL      L++LN+SGN+L +    +     +L  LDLSRN+  G  E + +  
Sbjct:   360 --TMPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLHGISEDTVLRI 417

Query:   455 EP-KNIHKAAKNSFALQSSMGK 475
             +  +N+          +  MGK
Sbjct:   418 QGIRNVRLDNNPLICDECHMGK 439
GO:0008056 "ocellus development" evidence=IMP
WB|WBGene00011345 dma-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI07 IGFALS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0036494 Toll-6 "Toll-6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BX56 LRRTM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QW21 LRRTM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|70551 Lrrc15 "leucine rich repeat containing 15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00006366 sym-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4H9 LRRTM1 "Leucine-rich repeat transmembrane neuronal protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L5J3 LRRTM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 7e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score = 76.4 bits (188), Expect = 1e-14
 Identities = 86/313 (27%), Positives = 130/313 (41%), Gaps = 15/313 (4%)

Query: 139 GVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIE-SIPSSVFMHLSDLRVLSLA 197
           G+ SL +L+L +NN+T  +  +   + NLQ L+L  NK+   IP S+F  L  L  L L+
Sbjct: 234 GLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLS 292

Query: 198 HNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMY 257
            N +S   P L ++L  L+ L L  N+     P     +  L+  +  S       P   
Sbjct: 293 DNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL 352

Query: 258 SILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLK 317
               +L  LDL  N L   + + L     L  L+L  N     + KS  +   L+ + L+
Sbjct: 353 GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQ 412

Query: 318 RNRLAKVTTTAFTNLTNLIELDISYNKLD-RLEVASFDPIENSLRDL---KISGNNIQLS 373
            N  +    + FT L  +  LDIS N L  R+    +D     +  L   K  G      
Sbjct: 413 DNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF 472

Query: 374 DVKNVLDKLVKLKALSIADMNYTD-IPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIK 432
             K        L+ L ++   ++  +P+ L  +   L  L LS N L         S  K
Sbjct: 473 GSKR-------LENLDLSRNQFSGAVPRKLGSL-SELMQLKLSENKLSGEIPDELSSCKK 524

Query: 433 LTHLDLSRNKFKG 445
           L  LDLS N+  G
Sbjct: 525 LVSLDLSHNQLSG 537

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 497
KOG4194|consensus 873 100.0
KOG4194|consensus 873 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4237|consensus498 99.97
KOG0472|consensus565 99.97
KOG0472|consensus565 99.97
KOG0444|consensus 1255 99.96
KOG0444|consensus 1255 99.96
KOG4237|consensus 498 99.92
KOG0618|consensus 1081 99.92
KOG0618|consensus 1081 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617|consensus264 99.61
KOG0617|consensus264 99.52
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
KOG1909|consensus382 99.26
KOG1259|consensus490 99.25
KOG3207|consensus 505 99.22
KOG1909|consensus382 99.2
KOG3207|consensus505 99.15
KOG1259|consensus490 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG0532|consensus 722 99.01
KOG0531|consensus414 99.0
KOG4658|consensus889 98.96
KOG0531|consensus414 98.96
KOG4658|consensus889 98.82
KOG0532|consensus 722 98.81
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.76
KOG2120|consensus419 98.73
PLN03150623 hypothetical protein; Provisional 98.64
PLN03150623 hypothetical protein; Provisional 98.61
KOG2982|consensus 418 98.54
KOG4579|consensus177 98.44
KOG1859|consensus 1096 98.43
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.25
KOG1644|consensus233 98.23
KOG2982|consensus418 98.19
KOG4579|consensus177 98.17
KOG1859|consensus 1096 98.14
KOG2120|consensus419 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.08
KOG1644|consensus233 98.06
PRK15386 426 type III secretion protein GogB; Provisional 97.88
KOG4341|consensus483 97.87
PRK15386 426 type III secretion protein GogB; Provisional 97.85
KOG4341|consensus483 97.76
KOG3665|consensus 699 97.41
KOG2739|consensus260 97.33
KOG3665|consensus 699 97.3
KOG2123|consensus388 96.99
KOG2739|consensus260 96.96
KOG2123|consensus 388 96.82
KOG1947|consensus482 96.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.59
KOG1947|consensus482 96.5
smart0037026 LRR Leucine-rich repeats, outliers. 95.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.91
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.41
smart0037026 LRR Leucine-rich repeats, outliers. 94.63
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.45
KOG3864|consensus221 94.06
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.9
KOG4308|consensus 478 93.08
KOG3864|consensus221 92.59
KOG4308|consensus478 91.97
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 91.95
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.59
KOG0473|consensus326 88.74
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.04
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 84.46
>KOG4194|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.3e-46  Score=349.30  Aligned_cols=418  Identities=24%  Similarity=0.323  Sum_probs=368.9

Q ss_pred             cCCCCCCCceeccCCCCcEEEEecCCCCCCCC--C-CCCCCCCCceEEeecCCCCCCccccCccccCCCCCcEEEccCCC
Q psy10289         52 ASVMCPYMCECALDDRGRYEIVCRRGDMANPI--P-IGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSF  128 (497)
Q Consensus        52 ~~~~~p~~~~c~~~~~~~~~~~c~~~~~~~~~--~-~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  128 (497)
                      ....||+.|.|...     .++|....+..+.  . ...+|.....|+++.+.   ..-.-...|.++++|+++++.+|.
T Consensus        42 ~~~~cpa~c~c~~~-----lldcs~~~lea~~~~~l~g~lp~~t~~LdlsnNk---l~~id~~~f~nl~nLq~v~l~~N~  113 (873)
T KOG4194|consen   42 DLSECPATCPCNTR-----LLDCSDRELEAIDKSRLKGFLPSQTQTLDLSNNK---LSHIDFEFFYNLPNLQEVNLNKNE  113 (873)
T ss_pred             ccccCCCcCCCCce-----eeecCccccccccccccCCcCccceeeeeccccc---cccCcHHHHhcCCcceeeeeccch
Confidence            34589999999865     6889988876642  1 13466677889998772   222223468999999999999999


Q ss_pred             CCccCCCCCCCCCCCCEEeccCCcCccCCccccCCCCCCcEEeccCCCCccCCcccccCCcCCcEEeccCCCCCCCChhh
Q psy10289        129 IPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRL  208 (497)
Q Consensus       129 i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~  208 (497)
                      ++.|+. .-....+|+.|+|.+|.|+++....++.++.|+.|||+.|.+..++...|..-.++++|+|++|+|+.+....
T Consensus       114 Lt~IP~-f~~~sghl~~L~L~~N~I~sv~se~L~~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~  192 (873)
T KOG4194|consen  114 LTRIPR-FGHESGHLEKLDLRHNLISSVTSEELSALPALRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGH  192 (873)
T ss_pred             hhhccc-ccccccceeEEeeeccccccccHHHHHhHhhhhhhhhhhchhhcccCCCCCCCCCceEEeecccccccccccc
Confidence            999973 2234457999999999999999999999999999999999999999888988899999999999999999999


Q ss_pred             hcCCCCCCEEeccCCCCCccChhhhcCCccccEEEcCCCCCcccCcccccCCCCccEEEccCCCCCccChhhhcCCccCc
Q psy10289        209 FLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLE  288 (497)
Q Consensus       209 ~~~l~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~  288 (497)
                      |.++.+|..|.++.|+++.++...|.++++|+.|++..|.|.-+...+|.++++|+.|.+..|.+.....++|..+.+++
T Consensus       193 F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~irive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme  272 (873)
T KOG4194|consen  193 FDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIRIVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKME  272 (873)
T ss_pred             ccccchheeeecccCcccccCHHHhhhcchhhhhhccccceeeehhhhhcCchhhhhhhhhhcCcccccCcceeeecccc
Confidence            99999999999999999999999999999999999999999988888999999999999999999998889999999999


Q ss_pred             eeeccCCcCCCcCccccCCCCCccEEEccCCcccccccccccCCCCCCEEECcCCCCCccCcccccccccCCCEEEcCCC
Q psy10289        289 TLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGN  368 (497)
Q Consensus       289 ~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~ls~n  368 (497)
                      +|++..|++..+....+-+++.|+.|++++|.|..+..+.|..+++|++|+++.|+++.++++.|..+.. |++|+|++|
T Consensus       273 ~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~~-Le~LnLs~N  351 (873)
T KOG4194|consen  273 HLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFRVLSQ-LEELNLSHN  351 (873)
T ss_pred             eeecccchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCChhHHHHHHH-hhhhccccc
Confidence            9999999999988888899999999999999999999999999999999999999999999999999987 999999999


Q ss_pred             cCCCcchhhHhhcCCCCCEEecCCCcCC---cCCcccccCCCcCcEEeCcCCCCcccchhhhccCCCCCEEECCCCcccc
Q psy10289        369 NIQLSDVKNVLDKLVKLKALSIADMNYT---DIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRNKFKG  445 (497)
Q Consensus       369 ~i~~~~~~~~~~~~~~L~~L~l~~n~i~---~l~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~  445 (497)
                      .++.. -...|..+++|+.||++.|.+.   +-....|.++++|+.|.+.+|++..++..+|.+++.|++|||.+|.|.+
T Consensus       352 si~~l-~e~af~~lssL~~LdLr~N~ls~~IEDaa~~f~gl~~LrkL~l~gNqlk~I~krAfsgl~~LE~LdL~~NaiaS  430 (873)
T KOG4194|consen  352 SIDHL-AEGAFVGLSSLHKLDLRSNELSWCIEDAAVAFNGLPSLRKLRLTGNQLKSIPKRAFSGLEALEHLDLGDNAIAS  430 (873)
T ss_pred             chHHH-HhhHHHHhhhhhhhcCcCCeEEEEEecchhhhccchhhhheeecCceeeecchhhhccCcccceecCCCCccee
Confidence            98732 2356788999999999999876   2245668999999999999999999999999999999999999999999


Q ss_pred             ccCCCcccCCchhHHHHhhhhhHhhhhccCCCceEE
Q psy10289        446 FDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEYAV  481 (497)
Q Consensus       446 ~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~  481 (497)
                      |-+..|....++++ -+.-..|-|+|.+.|.+.|.+
T Consensus       431 Iq~nAFe~m~Lk~L-v~nSssflCDCql~Wl~qWl~  465 (873)
T KOG4194|consen  431 IQPNAFEPMELKEL-VMNSSSFLCDCQLKWLAQWLY  465 (873)
T ss_pred             ecccccccchhhhh-hhcccceEEeccHHHHHHHHH
Confidence            99988887766665 344556779999999888854

>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 9e-13
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-12
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-11
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 5e-11
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-09
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-09
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-09
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 7e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-08
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 5e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-08
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 1e-07
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-07
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 5e-07
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-07
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 9e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 6e-05
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 1e-05
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 1e-05
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 1e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 1e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-05
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 3e-05
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 3e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-05
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 3e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 4e-05
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-05
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 4e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 6e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 6e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 6e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 7e-05
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 7e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 7e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 7e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 1e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 2e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 3e-04
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 4e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 5e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 5e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 9e-04
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 121/301 (40%), Gaps = 57/301 (18%)
Query: 56  CPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQ 115
           CP  C C+ +   R  ++C R ++A  +P   + + T  L +   +EN   +     F+ 
Sbjct: 6   CPAACSCS-NQASR--VICTRRELAE-VP-ASIPVNTRYLNL---QENSIQVIRTDTFKH 57
Query: 116 FQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFN 175
            +HLE L ++ + +  I    F G+PSL  L L  N +T++    F+ +  L+EL+L  N
Sbjct: 58  LRHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNN 117
Query: 176 KIESIPSSVFMHLSDLRVLSLAHNRISKLAPRXXXXXXXXXXXXXXYNDIVEINPEIFKD 235
            IESIPS  F  +  LR L                                        D
Sbjct: 118 PIESIPSYAFNRVPSLRRL----------------------------------------D 137
Query: 236 IQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQXXXXXXXXXXXXXXXXXXXXXGN 295
           + ELK        LE I+   +  L +L YL+LG                        GN
Sbjct: 138 LGELKR-------LEYISEAAFEGLVNLRYLNLG--MCNLKDIPNLTALVRLEELELSGN 188
Query: 296 HFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDP 355
              +I   SF     L+ L L   ++A +   AF +L +L EL++S+N L  L    F P
Sbjct: 189 RLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTP 248
Query: 356 I 356
           +
Sbjct: 249 L 249
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-64
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-61
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-38
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-61
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-52
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-40
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-58
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-48
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-38
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-49
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-48
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-53
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-52
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-51
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-34
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-52
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-50
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-49
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-46
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-32
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-49
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-46
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-45
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-31
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-49
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-31
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-36
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-48
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-48
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-47
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-42
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-34
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-42
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-47
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-41
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-40
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-45
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-44
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-43
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-42
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-41
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-39
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-36
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-42
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-41
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-39
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-39
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-39
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-31
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-34
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-29
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-27
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-33
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-32
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-32
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-29
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-22
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-20
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-15
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-26
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-30
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-29
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-28
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-28
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-22
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-18
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-14
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-15
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 4e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-05
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-05
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
 Score =  214 bits (546), Expect = 6e-64
 Identities = 84/390 (21%), Positives = 148/390 (37%), Gaps = 62/390 (15%)

Query: 56  CPYMCECALDDRGRYEIVCRRGDMANPIPIGQMDLGTEVLKIVPSEENPNHLT-IGP-IF 113
           CP  CEC+  DR    ++C R      +P G +   T +L +       N +  +    F
Sbjct: 3   CPPRCECSAQDR---AVLCHRKRFVA-VPEG-IPTETRLLDL-----GKNRIKTLNQDEF 52

Query: 114 QQFQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLD 173
             F HLEEL +  + + A+    F  + +LR L L  N +  +    F G+ NL +L + 
Sbjct: 53  ASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDIS 112

Query: 174 FNKIESIPSSVFMHLSDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIF 233
            NKI  +   +F  L +L+ L +  N +  ++ R F  L+ L+ L L   ++  I  E  
Sbjct: 113 ENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEAL 172

Query: 234 KDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLD 293
                                     L  LI L L +  +  +     + L +L+ L + 
Sbjct: 173 SH------------------------LHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEIS 208

Query: 294 GNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASF 353
              +   +  +      L  L +    L  V   A  +L  L  L++SYN +  +E +  
Sbjct: 209 HWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSML 268

Query: 354 DPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLN 413
             +   L+++++ G  +                           +    F+   +L+ LN
Sbjct: 269 HELLR-LQEIQLVGGQL-------------------------AVVEPYAFRGLNYLRVLN 302

Query: 414 LSGNNLQDIHNLLYQSNIKLTHLDLSRNKF 443
           +SGN L  +   ++ S   L  L L  N  
Sbjct: 303 VSGNQLTTLEESVFHSVGNLETLILDSNPL 332
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query497
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.86
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.86
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.85
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.21
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.71
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.39
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.2
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 95.12
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 94.62
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-47  Score=400.55  Aligned_cols=459  Identities=20%  Similarity=0.217  Sum_probs=335.4

Q ss_pred             eeeeccccceecCCCCcccccCchhhhhhHHHHHHHHHHHHHHHhccccCCCCCCCceeccCCCCcEEEEecCCCCCCC-
Q psy10289          4 TLIFMSKLKSLDLSYNDIVEINPEIFKDIQDTTMLFQVTIFLYLLHSSASVMCPYMCECALDDRGRYEIVCRRGDMANP-   82 (497)
Q Consensus         4 ~~~~~~~L~~Ldls~n~i~~i~~~~f~~l~~L~~l~~~~~~~~~~~~~~~~~~p~~~~c~~~~~~~~~~~c~~~~~~~~-   82 (497)
                      .|.++++|++||+++|.|+.+.+.+|.++++|+.|+        ...+.....+.......  .....++.....+... 
T Consensus        52 ~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~--------Ls~n~l~~~~~~~~~~l--~~L~~L~L~~n~i~~l~  121 (606)
T 3t6q_A           52 TFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLV--------LTANPLIFMAETALSGP--KALKHLFFIQTGISSID  121 (606)
T ss_dssp             TSTTCTTCSEEECTTCCCCEECTTTTTTCTTCCEEE--------CTTCCCSEECTTTTSSC--TTCCEEECTTSCCSCGG
T ss_pred             HhccCccceEEECCCCccceeChhhccCccccCeee--------CCCCcccccChhhhccc--ccccEeeccccCcccCC
Confidence            355666777777777777767667777776666653        11111111111111111  1112333333333332 


Q ss_pred             -CCCCCCCCCCceEEeecCCCCCCccccCccccCCCCCcEEEccCCCCCccCCCCCCCCCCCC--EEeccCCcCccCCcc
Q psy10289         83 -IPIGQMDLGTEVLKIVPSEENPNHLTIGPIFQQFQHLEELHITNSFIPAIGFHPFWGVPSLR--YLNLTHNNITSLLDY  159 (497)
Q Consensus        83 -~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~l~~L~--~L~l~~n~l~~~~~~  159 (497)
                       .++.. ...++.|+++.+..  ..+ ..+.+..+++|++|++++|.++.+.+..|..+++|+  .|++++|+++++.+.
T Consensus       122 ~~~~~~-l~~L~~L~L~~n~l--~~~-~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~L~l~~n~l~~~~~~  197 (606)
T 3t6q_A          122 FIPLHN-QKTLESLYLGSNHI--SSI-KLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAGIEPG  197 (606)
T ss_dssp             GSCCTT-CTTCCEEECCSSCC--CCC-CCCTTCCCTTCCEEECCSSCCCEECHHHHHTTTTCCSEEEECTTCCCCEECTT
T ss_pred             cchhcc-CCcccEEECCCCcc--ccc-CcccccCCcccCEEEcccCcccccChhhhhhhcccceeEEecCCCccCccChh
Confidence             11111 12456666655411  111 112333466666666666666666555566666666  666666666655544


Q ss_pred             ccCCC---------------------------------------------------CCCcEEeccCCCCccCCcccccCC
Q psy10289        160 NFKGM---------------------------------------------------MNLQELYLDFNKIESIPSSVFMHL  188 (497)
Q Consensus       160 ~~~~l---------------------------------------------------~~L~~L~L~~n~~~~~~~~~~~~l  188 (497)
                      .|...                                                   .+|+.|++++|.++.+++..|+.+
T Consensus       198 ~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~~L~~L~l~~n~l~~~~~~~~~~l  277 (606)
T 3t6q_A          198 AFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCF  277 (606)
T ss_dssp             TTTTCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGSEEEEEECTTCCCSSCCTTTTTTC
T ss_pred             HhhhccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcCceeEEEeecCccCccCHHHhccc
Confidence            43321                                                   156677777777777777778888


Q ss_pred             cCCcEEeccCCCCCCCChhhhcCCCCCCEEeccCCCCCccChhhhcCCccccEEEcCCCCCc-ccCcccccCCCCccEEE
Q psy10289        189 SDLRVLSLAHNRISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLE-NINPMMYSILADLIYLD  267 (497)
Q Consensus       189 ~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~~~l~-~~~~~~~~~l~~L~~L~  267 (497)
                      ++|++|++++|.++.+ |..+..+++|++|++++|.+.++.+..+..+++|+.|++++|.+. .+++..+..+++|++|+
T Consensus       278 ~~L~~L~l~~n~l~~l-p~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~  356 (606)
T 3t6q_A          278 SGLQELDLTATHLSEL-PSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELD  356 (606)
T ss_dssp             TTCSEEECTTSCCSCC-CSSCCSCTTCCEEECTTCCCSBGGGGCGGGCTTCSEEECCSCSSCCBCCSSTTTTCTTCCEEE
T ss_pred             cCCCEEeccCCccCCC-ChhhcccccCCEEECccCCcCcCchhhhhccCcCCEEECCCCCcccccchhhhhccCcCCEEE
Confidence            8999999999988876 556788899999999999998888888888999999999999887 56666788899999999


Q ss_pred             ccCCCCCccC--hhhhcCCccCceeeccCCcCCCcCccccCCCCCccEEEccCCccccccc-ccccCCCCCCEEECcCCC
Q psy10289        268 LGYNQLKYLL--ADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKRNRLAKVTT-TAFTNLTNLIELDISYNK  344 (497)
Q Consensus       268 l~~n~l~~~~--~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~-~~~~~~~~L~~L~l~~n~  344 (497)
                      +++|.+.+..  +..+..+++|++|++++|.+.+..+..+..+++|++|++++|.+.+..+ ..+..+++|++|++++|.
T Consensus       357 l~~n~l~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~  436 (606)
T 3t6q_A          357 LSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSL  436 (606)
T ss_dssp             CCSSCCCEEEESTTTTTTCTTCCEEECCSCSCEEECTTTTTTCTTCSEEECTTCCEECCTTCCTTTTCTTCCEEECTTCC
T ss_pred             CCCCccccccCcchhcccCCCCCEEECCCCcCCcCCHHHhcCCccCCeEECCCCcCCCcccchhhhCcccCCEEECCCCc
Confidence            9999998765  6778999999999999999988888889999999999999999987654 448899999999999999


Q ss_pred             CCccCcccccccccCCCEEEcCCCcCCCcch--hhHhhcCCCCCEEecCCCcCCcCCcccccCCCcCcEEeCcCCCCccc
Q psy10289        345 LDRLEVASFDPIENSLRDLKISGNNIQLSDV--KNVLDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQDI  422 (497)
Q Consensus       345 l~~~~~~~~~~~~~~L~~L~ls~n~i~~~~~--~~~~~~~~~L~~L~l~~n~i~~l~~~~~~~~~~L~~L~Ls~n~l~~~  422 (497)
                      +....+..+..++. |++|++++|.++...+  +..+..+++|+.|++++|+++.+++..|..+++|+.|++++|++++.
T Consensus       437 l~~~~~~~~~~l~~-L~~L~L~~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~  515 (606)
T 3t6q_A          437 LDISSEQLFDGLPA-LQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNRLTSS  515 (606)
T ss_dssp             CBTTCTTTTTTCTT-CCEEECTTCBCGGGEECSSCGGGGCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCGG
T ss_pred             cCCcCHHHHhCCCC-CCEEECCCCCCCccccccchhhccCCCccEEECCCCccCccChhhhccccCCCEEECCCCccCcC
Confidence            99988888888887 9999999999874322  25688899999999999999999888889999999999999999999


Q ss_pred             chhhhccCCCCCEEECCCCccccccCCCcccCCchhHHHHhhhhhHhhhhccCCCce
Q psy10289        423 HNLLYQSNIKLTHLDLSRNKFKGFDEKSYIMSEPKNIHKAAKNSFALQSSMGKNAEY  479 (497)
Q Consensus       423 ~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~  479 (497)
                      .+..+..++.| +|++++|+++++++..+......+.+++++|||.|+|...+...|
T Consensus       516 ~~~~l~~l~~L-~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~~~c~c~~~~~~~w  571 (606)
T 3t6q_A          516 SIEALSHLKGI-YLNLASNHISIILPSLLPILSQQRTINLRQNPLDCTCSNIYFLEW  571 (606)
T ss_dssp             GGGGGTTCCSC-EEECCSSCCCCCCGGGHHHHHTSSEEECTTCCEECSGGGHHHHHH
T ss_pred             ChhHhCccccc-EEECcCCcccccCHhhcccCCCCCEEeCCCCCccccCCcHHHHHH
Confidence            99999999999 999999999998887554322233458999999999986544333
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 497
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-12
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 62/302 (20%), Positives = 113/302 (37%), Gaps = 31/302 (10%)

Query: 141 PSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLSLAHNR 200
           P    L+L +N IT + D +FK + NL  L L  NKI  I    F  L  L  L L+ N+
Sbjct: 31  PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQ 90

Query: 201 ISKLAPRLFLKLSKLKSLDLSYNDIVEINPEIFKDIQELKTFKCRSCGLENIN--PMMYS 258
           + +L  ++      L+ L +  N+I ++   +F  + ++   +  +  L++       + 
Sbjct: 91  LKELPEKMP---KTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQ 147

Query: 259 ILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQVLCLKR 318
            +  L Y+ +    +  +          L  L LDGN    +   S      L  L L  
Sbjct: 148 GMKKLSYIRIADTNITTIPQGL---PPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSF 204

Query: 319 NRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNV 378
           N ++ V   +  N  +L EL ++ NKL ++     D     ++ + +  NNI        
Sbjct: 205 NSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADH--KYIQVVYLHNNNISAIG---- 258

Query: 379 LDKLVKLKALSIADMNYTDIPKGLFKMNPHLQFLNLSGNNLQ--DIHNLLYQSNIKLTHL 436
                          +    P G          ++L  N +Q  +I    ++       +
Sbjct: 259 ---------------SNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAV 303

Query: 437 DL 438
            L
Sbjct: 304 QL 305
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query497
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.86
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.86
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.34
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.12
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.97  E-value=6.3e-29  Score=241.97  Aligned_cols=298  Identities=24%  Similarity=0.394  Sum_probs=174.7

Q ss_pred             CCCCcEEEccCCCCCccCCCCCCCCCCCCEEeccCCcCccCCccccCCCCCCcEEeccCCCCccCCcccccCCcCCcEEe
Q psy10289        116 FQHLEELHITNSFIPAIGFHPFWGVPSLRYLNLTHNNITSLLDYNFKGMMNLQELYLDFNKIESIPSSVFMHLSDLRVLS  195 (497)
Q Consensus       116 ~~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~  195 (497)
                      +.+|++|++++++|+.+.  .+..+++|++|++++|+++++.+  ++++++|++|++++|.+..+++  ++++++|+.|+
T Consensus        43 l~~l~~L~l~~~~I~~l~--gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~~L~  116 (384)
T d2omza2          43 LDQVTTLQADRLGIKSID--GVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADITP--LANLTNLTGLT  116 (384)
T ss_dssp             HTTCCEEECCSSCCCCCT--TGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCGG--GTTCTTCCEEE
T ss_pred             hCCCCEEECCCCCCCCcc--ccccCCCCCEEeCcCCcCCCCcc--ccCCcccccccccccccccccc--ccccccccccc
Confidence            345555555555555442  34445555555555555555532  5555555555555555555443  44555555555


Q ss_pred             ccCCCCCCCChhhhcCCCCCCEEe-------------------------------------------ccCCCCCccChhh
Q psy10289        196 LAHNRISKLAPRLFLKLSKLKSLD-------------------------------------------LSYNDIVEINPEI  232 (497)
Q Consensus       196 l~~n~i~~~~~~~~~~l~~L~~L~-------------------------------------------l~~n~i~~~~~~~  232 (497)
                      ++++.++...+.  .....+....                                           ...+....  ...
T Consensus       117 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~  192 (384)
T d2omza2         117 LFNNQITDIDPL--KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSD--ISV  192 (384)
T ss_dssp             CCSSCCCCCGGG--TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCC--CGG
T ss_pred             cccccccccccc--cccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccc--ccc
Confidence            555555443221  1122222222                                           22222111  233


Q ss_pred             hcCCccccEEEcCCCCCcccCcccccCCCCccEEEccCCCCCccChhhhcCCccCceeeccCCcCCCcCccccCCCCCcc
Q psy10289        233 FKDIQELKTFKCRSCGLENINPMMYSILADLIYLDLGYNQLKYLLADELEDLKKLETLLLDGNHFPVILEKSFSSQFKLQ  312 (497)
Q Consensus       233 ~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~  312 (497)
                      +..+++++.+.+++|.++.+.+  +..+++|++|++++|.+++.  ..+..+++|+.+++++|.+.+..+  +..+++|+
T Consensus       193 ~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~  266 (384)
T d2omza2         193 LAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLAP--LSGLTKLT  266 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCGG--GTTCTTCS
T ss_pred             cccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCCc--ccccccCC
Confidence            4556667777777777666544  23456677777777776653  346666777777777777666432  55666777


Q ss_pred             EEEccCCcccccccccccCCCCCCEEECcCCCCCccCcccccccccCCCEEEcCCCcCCCcchhhHhhcCCCCCEEecCC
Q psy10289        313 VLCLKRNRLAKVTTTAFTNLTNLIELDISYNKLDRLEVASFDPIENSLRDLKISGNNIQLSDVKNVLDKLVKLKALSIAD  392 (497)
Q Consensus       313 ~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~ls~n~i~~~~~~~~~~~~~~L~~L~l~~  392 (497)
                      +|+++++.+.++.+  +..++.++.+.++.|.+.++.  .+..++. ++.|++++|.++.  ++ .+..+++|++|++++
T Consensus       267 ~L~l~~~~l~~~~~--~~~~~~l~~l~~~~n~l~~~~--~~~~~~~-l~~L~ls~n~l~~--l~-~l~~l~~L~~L~L~~  338 (384)
T d2omza2         267 ELKLGANQISNISP--LAGLTALTNLELNENQLEDIS--PISNLKN-LTYLTLYFNNISD--IS-PVSSLTKLQRLFFAN  338 (384)
T ss_dssp             EEECCSSCCCCCGG--GTTCTTCSEEECCSSCCSCCG--GGGGCTT-CSEEECCSSCCSC--CG-GGGGCTTCCEEECCS
T ss_pred             EeeccCcccCCCCc--ccccccccccccccccccccc--ccchhcc-cCeEECCCCCCCC--Cc-ccccCCCCCEEECCC
Confidence            77777777666543  566677777777777766543  2444444 7777777777652  22 256677777777777


Q ss_pred             CcCCcCCcccccCCCcCcEEeCcCCCCcccchhhhccCCCCCEEECCCC
Q psy10289        393 MNYTDIPKGLFKMNPHLQFLNLSGNNLQDIHNLLYQSNIKLTHLDLSRN  441 (497)
Q Consensus       393 n~i~~l~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~L~l~~n  441 (497)
                      |+++.++.  +..+++|++|++++|+++++++  +.++++|+.|+|++|
T Consensus       339 n~l~~l~~--l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         339 NKVSDVSS--LANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             SCCCCCGG--GGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCCCChh--HcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            77776653  5667777777777777777654  566777777777765
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure