Psyllid ID: psy10338


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYEKPGHYQ
ccccccccccccccHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccEEEEEEcccccccccccccccccccccccccEEEccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccccEEEEccEEEEEEccccccccccccEEEEEEcccEEEEcccEEEEEccccccEEEEEEEEccccccccc
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccEEHHHcHHcEccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHccccccEEEEccEcccccccEEEEEEEEEEEEHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHcEEEEccEccEcccHHHcccEEEEcccEEEEEEEEEEEEccccEEEEEEEEEEccccccccc
mdtfdktrppvaaGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIipvaaehdrtgeypwgiVKKAHElglinghipaseqnmgqrasdtrgitfedvrvpkenvllgegagfkiamdtfdktrppvaaGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSgglelsvfdGCLVAEELAYGCTGIMTAleasglgaycvtepgagsdvngvktkavkkgdewilNGQKMWItnggvanwqnrtrdfryekpghyq
mdtfdktrppvaagavglaQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVaaehdrtgeypWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPgagsdvngvkTKAVKKGDEWILNGQKMWitnggvanwqnrtrdfryekpghyq
MDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYEKPGHYQ
************AGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHI***************GITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDF*********
MDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRT************
MDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASE********DTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYEKPGHYQ
MDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYE******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASGLGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYEKPGHYQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
Q9VSA3419 Probable medium-chain spe yes N/A 0.346 0.257 0.720 1e-37
P41367421 Medium-chain specific acy yes N/A 0.179 0.133 0.818 7e-34
P08503421 Medium-chain specific acy yes N/A 0.179 0.133 0.784 5e-33
Q3SZB4421 Medium-chain specific acy yes N/A 0.179 0.133 0.784 1e-32
P45952421 Medium-chain specific acy yes N/A 0.179 0.133 0.772 2e-32
P11310421 Medium-chain specific acy yes N/A 0.144 0.106 0.738 2e-30
A5A6I0421 Medium-chain specific acy yes N/A 0.144 0.106 0.727 4e-30
Q22347417 Probable medium-chain spe no N/A 0.387 0.290 0.542 2e-29
A8XNF0417 Probable medium-chain spe N/A N/A 0.387 0.290 0.542 2e-29
Q8HXY8421 Medium-chain specific acy N/A N/A 0.160 0.118 0.715 7e-29
>sp|Q9VSA3|ACADM_DROME Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG12262 PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (397), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 87/111 (78%), Gaps = 3/111 (2%)

Query: 85  GIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTF 144
           G + +    GL  G     E NMGQRASDTRGITFEDVRVPKENVL+GEGAGFKIAM TF
Sbjct: 217 GFIVERDSPGLTPGR---KELNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTF 273

Query: 145 DKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSI 195
           DKTRPPVAAGAVGLAQRCLDEA KYALERK FGVPIA HQ +   +  ++I
Sbjct: 274 DKTRPPVAAGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMAI 324




This enzyme is specific for acyl chain lengths of 4 to 16.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 3EC: .EC: 9EC: 9EC: .EC: 3
>sp|P41367|ACADM_PIG Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADM PE=1 SV=3 Back     alignment and function description
>sp|P08503|ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadm PE=1 SV=1 Back     alignment and function description
>sp|Q3SZB4|ACADM_BOVIN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADM PE=2 SV=1 Back     alignment and function description
>sp|P45952|ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadm PE=1 SV=1 Back     alignment and function description
>sp|P11310|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADM PE=1 SV=1 Back     alignment and function description
>sp|A5A6I0|ACADM_PANTR Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pan troglodytes GN=ACADM PE=2 SV=1 Back     alignment and function description
>sp|Q22347|ACADM_CAEEL Probable medium-chain specific acyl-CoA dehydrogenase 10, mitochondrial OS=Caenorhabditis elegans GN=acdh-10 PE=2 SV=1 Back     alignment and function description
>sp|A8XNF0|ACAD1_CAEBR Probable medium-chain specific acyl-CoA dehydrogenase 1, mitochondrial OS=Caenorhabditis briggsae GN=CBG15946 PE=3 SV=1 Back     alignment and function description
>sp|Q8HXY8|ACADM_MACFA Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADM PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
170043822 422 acyl-coa dehydrogenase [Culex quinquefas 0.378 0.279 0.694 5e-38
312383488 1028 hypothetical protein AND_03389 [Anophele 0.214 0.065 0.774 6e-38
332025636 434 Putative medium-chain specific acyl-CoA 0.657 0.472 0.438 9e-38
253560542151 putative acyl-CoA dehydrogenase [Culex p 0.346 0.715 0.738 1e-37
58387602 419 AGAP005662-PA [Anopheles gambiae str. PE 0.378 0.281 0.685 2e-37
195126441 420 GI12250 [Drosophila mojavensis] gi|19391 0.208 0.154 0.836 1e-36
195442770 420 GK23895 [Drosophila willistoni] gi|19416 0.346 0.257 0.720 2e-36
195019873 419 GH14704 [Drosophila grimshawi] gi|193898 0.208 0.155 0.826 2e-36
195378841 420 GJ11482 [Drosophila virilis] gi|19540419 0.346 0.257 0.729 4e-36
195325801 419 GM24997 [Drosophila sechellia] gi|194118 0.346 0.257 0.720 6e-36
>gi|170043822|ref|XP_001849570.1| acyl-coa dehydrogenase [Culex quinquefasciatus] gi|167867122|gb|EDS30505.1| acyl-coa dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 94/121 (77%), Gaps = 3/121 (2%)

Query: 85  GIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTF 144
           G + +    GL  G     EQNMGQRASDTRGITFEDVRVPKENVL+GEGAGFKIAM TF
Sbjct: 220 GFIVERETPGLTPGR---KEQNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTF 276

Query: 145 DKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLML 204
           DKTRPPVAAGAVGLAQRCLDEA KYALERKAFGVPIAAHQ +   +  ++I     +L+ 
Sbjct: 277 DKTRPPVAAGAVGLAQRCLDEAMKYALERKAFGVPIAAHQAVSFMLADMAIGVETARLIT 336

Query: 205 L 205
           +
Sbjct: 337 M 337




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312383488|gb|EFR28556.1| hypothetical protein AND_03389 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|332025636|gb|EGI65798.1| Putative medium-chain specific acyl-CoA dehydrogenase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|253560542|gb|ACT32982.1| putative acyl-CoA dehydrogenase [Culex pipiens pipiens] Back     alignment and taxonomy information
>gi|58387602|ref|XP_315683.2| AGAP005662-PA [Anopheles gambiae str. PEST] gi|55238468|gb|EAA11811.3| AGAP005662-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195126441|ref|XP_002007679.1| GI12250 [Drosophila mojavensis] gi|193919288|gb|EDW18155.1| GI12250 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195442770|ref|XP_002069119.1| GK23895 [Drosophila willistoni] gi|194165204|gb|EDW80105.1| GK23895 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195019873|ref|XP_001985073.1| GH14704 [Drosophila grimshawi] gi|193898555|gb|EDV97421.1| GH14704 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195378841|ref|XP_002048190.1| GJ11482 [Drosophila virilis] gi|195404194|ref|XP_002060435.1| GJ19560 [Drosophila virilis] gi|194140953|gb|EDW57380.1| GJ19560 [Drosophila virilis] gi|194155348|gb|EDW70532.1| GJ11482 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195325801|ref|XP_002029619.1| GM24997 [Drosophila sechellia] gi|194118562|gb|EDW40605.1| GM24997 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
FB|FBgn0035811419 CG12262 [Drosophila melanogast 0.346 0.257 0.720 5.7e-36
UNIPROTKB|Q5T4U5454 ACADM "Medium-chain-specific a 0.317 0.218 0.666 4.9e-30
WB|WBGene00020812412 acdh-7 [Caenorhabditis elegans 0.317 0.240 0.627 3.2e-41
UNIPROTKB|P41367421 ACADM "Medium-chain specific a 0.317 0.235 0.735 8.5e-33
UNIPROTKB|F1P6W6421 ACADM "Uncharacterized protein 0.317 0.235 0.696 1.6e-31
TIGR_CMR|CHY_1732380 CHY_1732 "acyl-CoA dehydrogena 0.262 0.215 0.595 3e-33
ZFIN|ZDB-GENE-040426-1945426 acadm "acyl-Coenzyme A dehydro 0.266 0.194 0.795 1.8e-30
UNIPROTKB|B7Z9I1385 ACADM "Medium-chain-specific a 0.317 0.257 0.666 4.9e-30
UNIPROTKB|P11310421 ACADM "Medium-chain specific a 0.317 0.235 0.666 4.9e-30
RGD|2012421 Acadm "acyl-CoA dehydrogenase, 0.317 0.235 0.705 2.9e-32
FB|FBgn0035811 CG12262 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 388 (141.6 bits), Expect = 5.7e-36, P = 5.7e-36
 Identities = 80/111 (72%), Positives = 87/111 (78%)

Query:    85 GIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTF 144
             G + +    GL  G     E NMGQRASDTRGITFEDVRVPKENVL+GEGAGFKIAM TF
Sbjct:   217 GFIVERDSPGLTPGR---KELNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTF 273

Query:   145 DKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSI 195
             DKTRPPVAAGAVGLAQRCLDEA KYALERK FGVPIA HQ +   +  ++I
Sbjct:   274 DKTRPPVAAGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMAI 324


GO:0005739 "mitochondrion" evidence=ISS;IDA
GO:0003995 "acyl-CoA dehydrogenase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=ISS
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|Q5T4U5 ACADM "Medium-chain-specific acyl-CoA dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00020812 acdh-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P41367 ACADM "Medium-chain specific acyl-CoA dehydrogenase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6W6 ACADM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1732 CHY_1732 "acyl-CoA dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1945 acadm "acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z9I1 ACADM "Medium-chain-specific acyl-CoA dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P11310 ACADM "Medium-chain specific acyl-CoA dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2012 Acadm "acyl-CoA dehydrogenase, C-4 to C-12 straight chain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
cd01157378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 4e-49
cd01157 378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 9e-39
cd01158373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 9e-29
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 9e-28
COG1960393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 2e-25
cd01157 378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 2e-23
cd01157378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 1e-20
cd01160372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 2e-19
cd01158 373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 6e-19
cd01156376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 2e-18
cd01162375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 5e-18
cd00567 327 cd00567, ACAD, Acyl-CoA dehydrogenase 1e-16
cd01161409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 2e-16
pfam0277052 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, 5e-16
PLN02519404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 1e-14
pfam00441150 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, 6e-14
pfam02771113 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, 1e-13
COG1960 393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 3e-13
cd01162 375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 3e-13
cd01151386 cd01151, GCD, Glutaryl-CoA dehydrogenase 6e-13
cd01156 376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 7e-13
PTZ00461410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 1e-12
cd01161 409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 3e-12
cd01152 380 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehyd 3e-12
TIGR03207372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 4e-12
cd01160 372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 2e-11
cd01151 386 cd01151, GCD, Glutaryl-CoA dehydrogenase 2e-11
PLN02876822 PLN02876, PLN02876, acyl-CoA dehydrogenase 6e-11
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 8e-11
cd01155394 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases simil 8e-11
pfam00441150 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, 1e-10
cd01153 407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogena 6e-10
PTZ00461 410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 1e-09
cd01158373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 2e-09
COG1960393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 2e-09
TIGR03204 395 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, 3e-09
PRK12341381 PRK12341, PRK12341, putative acyl-CoA dehydrogenas 8e-09
PLN02519 404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 1e-08
cd01160372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 8e-08
cd01158 373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 2e-07
PRK12341 381 PRK12341, PRK12341, putative acyl-CoA dehydrogenas 4e-07
PLN02526 412 PLN02526, PLN02526, acyl-coenzyme A oxidase 4e-07
cd01156376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 5e-07
cd01155 394 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases simil 1e-06
PRK03354380 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogen 2e-06
cd01154418 cd01154, AidB, Proteins involved in DNA damage res 5e-06
cd01151386 cd01151, GCD, Glutaryl-CoA dehydrogenase 8e-06
cd01153407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogena 8e-06
TIGR03207372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 2e-05
cd01162 375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 3e-05
cd01156 376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 1e-04
PTZ00461410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 1e-04
PLN02526412 PLN02526, PLN02526, acyl-coenzyme A oxidase 1e-04
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 2e-04
COG1960 393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 3e-04
PLN02519404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 3e-04
cd01154418 cd01154, AidB, Proteins involved in DNA damage res 0.001
pfam02771113 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, 0.002
TIGR03207 372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 0.002
PRK03354 380 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogen 0.002
PTZ00456 622 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provis 0.002
cd01162375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 0.003
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
 Score =  167 bits (424), Expect = 4e-49
 Identities = 71/83 (85%), Positives = 73/83 (87%)

Query: 104 EQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCL 163
           E NMGQR SDTRGITFEDVRVPKENVL+GEGAGFKIAM  FDKTRPPVAAGAVGLAQR L
Sbjct: 197 ELNMGQRCSDTRGITFEDVRVPKENVLIGEGAGFKIAMGAFDKTRPPVAAGAVGLAQRAL 256

Query: 164 DEATKYALERKAFGVPIAAHQGM 186
           DEATKYALERK FG  IA HQ +
Sbjct: 257 DEATKYALERKTFGKLIAEHQAV 279


MCADs are mitochondrial beta-oxidation enzymes, which catalyze the alpha,beta dehydrogenation of the corresponding medium chain acyl-CoA by FAD, which becomes reduced. The reduced form of MCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. MCAD is a homotetramer. Length = 378

>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|145755 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|201229 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|217220 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal domain Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215473 PLN02876, PLN02876, acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173844 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>gnl|CDD|201229 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|132248 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>gnl|CDD|183454 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|183454 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173844 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>gnl|CDD|179566 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|173843 cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173843 cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>gnl|CDD|217220 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal domain Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|179566 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185635 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG0140|consensus 408 99.97
KOG0139|consensus398 99.97
KOG0141|consensus 421 99.96
PRK03354 380 crotonobetainyl-CoA dehydrogenase; Validated 99.92
cd01151 386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 99.92
TIGR03203 378 pimD_small pimeloyl-CoA dehydrogenase, small subun 99.92
PRK12341 381 putative acyl-CoA dehydrogenase; Provisional 99.91
cd01157 378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 99.91
PLN02519 404 isovaleryl-CoA dehydrogenase 99.91
TIGR03204 395 pimC_large pimeloyl-CoA dehydrogenase, large subun 99.9
PLN02526 412 acyl-coenzyme A oxidase 99.9
TIGR03207 372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 99.9
cd01156 376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 99.9
cd01162 375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 99.89
PTZ00461 410 isovaleryl-CoA dehydrogenase; Provisional 99.89
cd01160 372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 99.88
cd01161 409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 99.88
KOG0139|consensus 398 99.87
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 99.86
cd01158 373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 99.86
KOG0138|consensus 432 99.86
cd01152 380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 99.84
COG1960 393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 99.84
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 99.84
cd01153 407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 99.82
cd01155 394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 99.81
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 99.8
PLN02876 822 acyl-CoA dehydrogenase 99.8
cd01163 377 DszC Dibenzothiophene (DBT) desulfurization enzyme 99.75
KOG0140|consensus408 99.73
KOG0141|consensus421 99.7
PF0277052 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle doma 99.68
KOG0137|consensus 634 99.68
PLN02636 686 acyl-coenzyme A oxidase 99.67
cd01159 370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 99.66
cd01154 418 AidB Proteins involved in DNA damage response, sim 99.64
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 99.57
KOG0137|consensus 634 99.56
PLN02312 680 acyl-CoA oxidase 99.51
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subun 99.45
cd00567327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 99.43
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 99.41
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 99.41
PLN02636 686 acyl-coenzyme A oxidase 99.39
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 99.37
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 99.36
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 99.36
cd01160372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 99.36
PLN02312 680 acyl-CoA oxidase 99.35
PTZ00461410 isovaleryl-CoA dehydrogenase; Provisional 99.34
PRK12341381 putative acyl-CoA dehydrogenase; Provisional 99.34
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 99.34
cd01162375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 99.34
cd01155394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 99.33
cd01156376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 99.33
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 99.33
PLN02519404 isovaleryl-CoA dehydrogenase 99.32
PRK11561538 isovaleryl CoA dehydrogenase; Provisional 99.32
cd01151386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 99.3
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 99.3
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 99.29
KOG0138|consensus432 99.29
PLN02876822 acyl-CoA dehydrogenase 99.27
cd01158373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 99.22
cd01154418 AidB Proteins involved in DNA damage response, sim 99.21
KOG1469|consensus 392 99.21
PF02771113 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal 99.2
PLN02526412 acyl-coenzyme A oxidase 99.19
TIGR03204395 pimC_large pimeloyl-CoA dehydrogenase, large subun 99.19
cd01153407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 99.15
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 99.1
PRK11561 538 isovaleryl CoA dehydrogenase; Provisional 99.03
cd01163377 DszC Dibenzothiophene (DBT) desulfurization enzyme 99.02
PLN02443 664 acyl-coenzyme A oxidase 98.98
cd00567 327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 98.96
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 98.95
cd01159370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 98.94
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 98.94
KOG1469|consensus392 98.87
PLN02443 664 acyl-coenzyme A oxidase 98.81
cd01152380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 98.76
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 98.5
KOG0135|consensus 661 98.47
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 98.37
TIGR02309477 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxy 98.19
KOG0135|consensus 661 97.05
TIGR02309 477 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxy 96.07
KOG0136|consensus 670 95.48
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 94.63
PF08028134 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal 94.3
KOG0136|consensus 670 87.03
PF11794264 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N ter 82.55
>KOG0140|consensus Back     alignment and domain information
Probab=99.97  E-value=1.7e-30  Score=222.60  Aligned_cols=146  Identities=57%  Similarity=0.955  Sum_probs=136.5

Q ss_pred             CCCCCHHHHHHHHHHHHhhhhcccchhhhhhhcCCCCHHHHHHHHHcCCccccCCCCCCccCCcCCCcccEEEcceecCC
Q psy10338         47 YSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRVPK  126 (312)
Q Consensus        47 ~~~l~~~~~~l~~~~~~f~~~~~~p~~~~~d~~~~~p~~~~~~l~~~G~~~~~~P~~~~~~g~~~~~~~~v~f~dv~Vp~  126 (312)
                      +|.|+++|++|++.+++|.++++.|.+.+||..++||++++++..++|+....+|+                        
T Consensus        25 sf~L~e~qke~q~~A~kFa~~e~~P~aae~Dk~ge~P~~iirkA~~lG~~~~~ip~------------------------   80 (408)
T KOG0140|consen   25 SFGLTEDQKEFQEAARKFAKDEMIPNAAEYDKSGEFPWEIIRKAHELGFMNTYIPE------------------------   80 (408)
T ss_pred             ccCcchHHHHHHHHHHHHHHHhhccchhhhcccCCCcHHHHHHHHHcccCcccCcc------------------------
Confidence            48899999999999999999999999999999999999999999999999999998                        


Q ss_pred             CCccccCCccHHHHHhhhhccChhHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccchhhHHHHHHhhhHHHHHHHHHhc
Q psy10338        127 ENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLMLLG  206 (312)
Q Consensus       127 ~~llG~~g~G~~~~~~~l~~~R~~~aa~~~G~~~~~l~~a~~ya~~R~~fg~~l~~~q~v~~~l~~~a~~~~~~~~~~~~  206 (312)
                                                                                                      
T Consensus        81 --------------------------------------------------------------------------------   80 (408)
T KOG0140|consen   81 --------------------------------------------------------------------------------   80 (408)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccccccccCCCChhHhHHHHHHHHHHccCcchHHHhhhcc---------------------------cceeeecCC
Q psy10338        207 VHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALEASG---------------------------LGAYCVTEP  259 (312)
Q Consensus       207 ~g~~~~~~p~~~GG~g~~~~~~~~v~e~l~~~~~~~~~~~~g~~---------------------------~~~~a~tEp  259 (312)
                                .|||.|++..+.+++.|+|+.+|.++...+.++.                           ++++|+|||
T Consensus        81 ----------~~GG~Gls~l~t~lI~E~LayGCtg~~~~I~~~~l~~~pi~~~gneeqKkk~lg~l~~~p~~asYcvTEP  150 (408)
T KOG0140|consen   81 ----------DYGGLGLSRLDTCLIFEALAYGCTGIQTAISIHNLAAWPIILSGNEEQKKKYLGRLAEEPKVASYCVTEP  150 (408)
T ss_pred             ----------ccCCCCchhHHHHHHHHHHHccchhHHHHHhccchhhhhehhcCcHHHHHhhhhhhhcchhhhhhhccCC
Confidence                      6799999999999999999999999887665433                           348999999


Q ss_pred             CCCCCcCCceeEEEEeCCEEEEeeeeeeeeCCCcccEEEEEeccCCC
Q psy10338        260 GAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYE  306 (312)
Q Consensus       260 ~~gsd~~~~~t~A~~~~~g~~l~G~k~~vs~~~~ad~~~v~~~~~~~  306 (312)
                      ++|||+.+++|+|++.||.|+|||+|.||||+.+|+|++|.++++++
T Consensus       151 gAGSDvagikTka~KkGDeYiiNGsKawItg~G~anwyfVlaRtd~~  197 (408)
T KOG0140|consen  151 GAGSDVAGIKTKAEKKGDEYIINGSKAWITGAGHANWYFVLARTDPD  197 (408)
T ss_pred             CCCcchhhhhhhhhhcCCEEEEcCceeeeecCCccceEEEEEecCCC
Confidence            99999999999999999999999999999999999999999877765



>KOG0139|consensus Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>KOG0139|consensus Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>KOG0140|consensus Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>PF02770 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle domain; InterPro: IPR006091 Acyl-CoA dehydrogenases (1 Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>PF02771 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal domain; InterPro: IPR006092 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0135|consensus Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>KOG0135|consensus Back     alignment and domain information
>TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>KOG0136|consensus Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>PF08028 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR013107 Acyl Co-A dehydrogenases (1 Back     alignment and domain information
>KOG0136|consensus Back     alignment and domain information
>PF11794 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N terminal; InterPro: IPR024674 This domain is found in the N terminus of HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
3mdd_A385 Crystal Structures Of Medium Chain Acyl-Coa Dehydro 4e-35
3mdd_A 385 Crystal Structures Of Medium Chain Acyl-Coa Dehydro 8e-29
1udy_A396 Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaocta 5e-35
1udy_A 396 Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaocta 8e-29
1ege_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 1e-31
1ege_A 396 Structure Of T255e, E376g Mutant Of Human Medium Ch 8e-29
2a1t_A421 Structure Of The Human Mcad:etf E165betaa Complex L 2e-31
2a1t_A 421 Structure Of The Human Mcad:etf E165betaa Complex L 1e-28
1egd_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 8e-31
1egd_A 396 Structure Of T255e, E376g Mutant Of Human Medium Ch 9e-29
1ukw_A379 Crystal Structure Of Medium-Chain Acyl-Coa Dehydrog 3e-23
1ukw_A 379 Crystal Structure Of Medium-Chain Acyl-Coa Dehydrog 1e-16
1jqi_A388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 5e-17
1jqi_A 388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 3e-07
2vig_A391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 9e-15
2vig_A 391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 5e-07
3pfd_A393 Crystal Structure Of An Acyl-Coa Dehydrogenase From 2e-14
3pfd_A 393 Crystal Structure Of An Acyl-Coa Dehydrogenase From 9e-10
1buc_A383 Three-Dimensional Structure Of Butyryl-Coa Dehydrog 9e-14
1buc_A 383 Three-Dimensional Structure Of Butyryl-Coa Dehydrog 4e-07
3mpi_A397 Structure Of The Glutaryl-Coenzyme A Dehydrogenase 2e-13
3mpi_A 397 Structure Of The Glutaryl-Coenzyme A Dehydrogenase 8e-08
2z1q_A 577 Crystal Structure Of Acyl Coa Dehydrogenase Length 3e-12
2z1q_A 577 Crystal Structure Of Acyl Coa Dehydrogenase Length 1e-07
2jif_A404 Structure Of Human Short-Branched Chain Acyl-Coa De 3e-12
2jif_A 404 Structure Of Human Short-Branched Chain Acyl-Coa De 7e-08
3nf4_A387 Crystal Structure Of Acyl-Coa Dehydrogenase From My 1e-10
3nf4_A 387 Crystal Structure Of Acyl-Coa Dehydrogenase From My 2e-05
2dvl_A372 Crystal Structure Of Project Tt0160 From Thermus Th 3e-10
2dvl_A 372 Crystal Structure Of Project Tt0160 From Thermus Th 9e-06
3sf6_A 403 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 5e-10
3r7k_A403 Crystal Structure Of A Probable Acyl Coa Dehydrogen 6e-10
3r7k_A 403 Crystal Structure Of A Probable Acyl Coa Dehydrogen 1e-07
3oib_A403 Crystal Structure Of A Putative Acyl-Coa Dehydrogen 3e-09
3oib_A 403 Crystal Structure Of A Putative Acyl-Coa Dehydrogen 1e-06
3swo_A 399 Crystal Structure Of A Glutaryl-Coa Dehydrogenase F 9e-09
2eba_A 385 Crystal Structure Of The Putative Glutaryl-coa Dehy 1e-08
3eom_A396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 2e-08
3eom_A 396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 4e-04
3gqt_A399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 2e-08
3gqt_A 399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 4e-04
3d6b_A395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 2e-08
3d6b_A 395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 4e-04
2uxw_A 607 Crystal Structure Of Human Very Long Chain Acyl-coa 2e-08
2uxw_A 607 Crystal Structure Of Human Very Long Chain Acyl-coa 2e-07
3b96_A 587 Structural Basis For Substrate Fatty-Acyl Chain Spe 2e-08
3b96_A 587 Structural Basis For Substrate Fatty-Acyl Chain Spe 1e-07
1ivh_A 394 Structure Of Human Isovaleryl-coa Dehydrogenase At 2e-08
3owa_A 597 Crystal Structure Of Acyl-Coa Dehydrogenase Complex 4e-08
3owa_A 597 Crystal Structure Of Acyl-Coa Dehydrogenase Complex 7e-07
1rx0_A 393 Crystal Structure Of Isobutyryl-Coa Dehydrogenase C 6e-08
1ws9_A387 Crystal Structure Of Project Id Tt0172 From Thermus 9e-08
1ws9_A 387 Crystal Structure Of Project Id Tt0172 From Thermus 1e-06
1sir_A394 The Crystal Structure And Mechanism Of Human Glutar 1e-07
1siq_A392 The Crystal Structure And Mechanism Of Human Glutar 1e-07
2r0m_A394 The Effect Of A Glu370asp Mutation In Glutaryl-Coa 1e-07
2pg0_A 385 Crystal Structure Of Acyl-Coa Dehydrogenase From Ge 1e-07
4hr3_A415 Structure Of A Putative Acyl-Coa Dehydrogenase From 2e-06
2wbi_A428 Crystal Structure Of Human Acyl-Coa Dehydrogenase 1 3e-06
3mkh_A438 Podospora Anserina Nitroalkane Oxidase Length = 438 3e-05
3mkh_A 438 Podospora Anserina Nitroalkane Oxidase Length = 438 2e-04
1r2j_A366 Fkbi For Biosynthesis Of Methoxymalonyl Extender Un 2e-04
2ix5_A436 Short Chain Specific Acyl-Coa Oxidase From Arabidop 3e-04
2ix5_A 436 Short Chain Specific Acyl-Coa Oxidase From Arabidop 6e-04
2ix6_A449 Short Chain Specific Acyl-Coa Oxidase From Arabidop 3e-04
2ix6_A 449 Short Chain Specific Acyl-Coa Oxidase From Arabidop 6e-04
>pdb|3MDD|A Chain A, Crystal Structures Of Medium Chain Acyl-Coa Dehydrogenase From Pig Liver Mitochondria With And Without Substrate Length = 385 Back     alignment and structure

Iteration: 1

Score = 144 bits (364), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 72/88 (81%), Positives = 74/88 (84%) Query: 99 HIPASEQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGL 158 I E NMGQR SDTRGI FEDVRVPKENVL GEGAGFKIAM TFDKTRPPVAAGAVGL Sbjct: 197 QIGRKEINMGQRCSDTRGIVFEDVRVPKENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGL 256 Query: 159 AQRCLDEATKYALERKAFGVPIAAHQGM 186 AQR LDEATKYALERK FG +A HQG+ Sbjct: 257 AQRALDEATKYALERKTFGKLLAEHQGI 284
>pdb|3MDD|A Chain A, Crystal Structures Of Medium Chain Acyl-Coa Dehydrogenase From Pig Liver Mitochondria With And Without Substrate Length = 385 Back     alignment and structure
>pdb|1UDY|A Chain A, Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaoctanoyl-Coa Length = 396 Back     alignment and structure
>pdb|1UDY|A Chain A, Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaoctanoyl-Coa Length = 396 Back     alignment and structure
>pdb|1EGE|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|1EGE|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|2A1T|A Chain A, Structure Of The Human Mcad:etf E165betaa Complex Length = 421 Back     alignment and structure
>pdb|2A1T|A Chain A, Structure Of The Human Mcad:etf E165betaa Complex Length = 421 Back     alignment and structure
>pdb|1EGD|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|1EGD|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|1UKW|A Chain A, Crystal Structure Of Medium-Chain Acyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 379 Back     alignment and structure
>pdb|1UKW|A Chain A, Crystal Structure Of Medium-Chain Acyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 379 Back     alignment and structure
>pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure
>pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure
>pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>pdb|3PFD|A Chain A, Crystal Structure Of An Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Reduced Flavin Adenine Dinucleotide Solved By Combined Iodide Ion Sad Mr Length = 393 Back     alignment and structure
>pdb|3PFD|A Chain A, Crystal Structure Of An Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Reduced Flavin Adenine Dinucleotide Solved By Combined Iodide Ion Sad Mr Length = 393 Back     alignment and structure
>pdb|1BUC|A Chain A, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase From Megasphaera Elsdenii Length = 383 Back     alignment and structure
>pdb|1BUC|A Chain A, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase From Megasphaera Elsdenii Length = 383 Back     alignment and structure
>pdb|3MPI|A Chain A, Structure Of The Glutaryl-Coenzyme A Dehydrogenase Glutaryl-Coa Complex Length = 397 Back     alignment and structure
>pdb|3MPI|A Chain A, Structure Of The Glutaryl-Coenzyme A Dehydrogenase Glutaryl-Coa Complex Length = 397 Back     alignment and structure
>pdb|2Z1Q|A Chain A, Crystal Structure Of Acyl Coa Dehydrogenase Length = 577 Back     alignment and structure
>pdb|2Z1Q|A Chain A, Crystal Structure Of Acyl Coa Dehydrogenase Length = 577 Back     alignment and structure
>pdb|2JIF|A Chain A, Structure Of Human Short-Branched Chain Acyl-Coa Dehydrogenase (Acadsb) Length = 404 Back     alignment and structure
>pdb|2JIF|A Chain A, Structure Of Human Short-Branched Chain Acyl-Coa Dehydrogenase (Acadsb) Length = 404 Back     alignment and structure
>pdb|3NF4|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Flavin Adenine Dinucleotide Length = 387 Back     alignment and structure
>pdb|3NF4|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Flavin Adenine Dinucleotide Length = 387 Back     alignment and structure
>pdb|2DVL|A Chain A, Crystal Structure Of Project Tt0160 From Thermus Thermophilus Hb8 Length = 372 Back     alignment and structure
>pdb|2DVL|A Chain A, Crystal Structure Of Project Tt0160 From Thermus Thermophilus Hb8 Length = 372 Back     alignment and structure
>pdb|3SF6|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis Length = 403 Back     alignment and structure
>pdb|3R7K|A Chain A, Crystal Structure Of A Probable Acyl Coa Dehydrogenase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 403 Back     alignment and structure
>pdb|3R7K|A Chain A, Crystal Structure Of A Probable Acyl Coa Dehydrogenase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 403 Back     alignment and structure
>pdb|3OIB|A Chain A, Crystal Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Smegmatis, Iodide Soak Length = 403 Back     alignment and structure
>pdb|3OIB|A Chain A, Crystal Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Smegmatis, Iodide Soak Length = 403 Back     alignment and structure
>pdb|3SWO|A Chain A, Crystal Structure Of A Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis In Complex With Fadh2 Length = 399 Back     alignment and structure
>pdb|2EBA|A Chain A, Crystal Structure Of The Putative Glutaryl-coa Dehydrogenase From Thermus Thermophilus Length = 385 Back     alignment and structure
>pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
>pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
>pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2,3,4- Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2,3,4- Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>pdb|2UXW|A Chain A, Crystal Structure Of Human Very Long Chain Acyl-coa Dehydrogenase (acadvl) Length = 607 Back     alignment and structure
>pdb|2UXW|A Chain A, Crystal Structure Of Human Very Long Chain Acyl-coa Dehydrogenase (acadvl) Length = 607 Back     alignment and structure
>pdb|3B96|A Chain A, Structural Basis For Substrate Fatty-Acyl Chain Specificity: Crystal Structure Of Human Very-Long-Chain Acyl-Coa Dehydrogenase Length = 587 Back     alignment and structure
>pdb|3B96|A Chain A, Structural Basis For Substrate Fatty-Acyl Chain Specificity: Crystal Structure Of Human Very-Long-Chain Acyl-Coa Dehydrogenase Length = 587 Back     alignment and structure
>pdb|1IVH|A Chain A, Structure Of Human Isovaleryl-coa Dehydrogenase At 2.6 Angstroms Resolution: Structural Basis For Substrate Specificity Length = 394 Back     alignment and structure
>pdb|3OWA|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase Complexed With Fad From Bacillus Anthracis Length = 597 Back     alignment and structure
>pdb|3OWA|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase Complexed With Fad From Bacillus Anthracis Length = 597 Back     alignment and structure
>pdb|1RX0|A Chain A, Crystal Structure Of Isobutyryl-Coa Dehydrogenase Complexed With SubstrateLIGAND. Length = 393 Back     alignment and structure
>pdb|1WS9|A Chain A, Crystal Structure Of Project Id Tt0172 From Thermus Thermophilus Hb8 Length = 387 Back     alignment and structure
>pdb|1WS9|A Chain A, Crystal Structure Of Project Id Tt0172 From Thermus Thermophilus Hb8 Length = 387 Back     alignment and structure
>pdb|1SIR|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 394 Back     alignment and structure
>pdb|1SIQ|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 392 Back     alignment and structure
>pdb|2R0M|A Chain A, The Effect Of A Glu370asp Mutation In Glutaryl-Coa Dehydrogenase On Proton Transfer To The Dienolate Intermediate Length = 394 Back     alignment and structure
>pdb|2PG0|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Geobacillus Kaustophilus Length = 385 Back     alignment and structure
>pdb|4HR3|A Chain A, Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Abscessus Length = 415 Back     alignment and structure
>pdb|2WBI|A Chain A, Crystal Structure Of Human Acyl-Coa Dehydrogenase 11 Length = 428 Back     alignment and structure
>pdb|3MKH|A Chain A, Podospora Anserina Nitroalkane Oxidase Length = 438 Back     alignment and structure
>pdb|3MKH|A Chain A, Podospora Anserina Nitroalkane Oxidase Length = 438 Back     alignment and structure
>pdb|1R2J|A Chain A, Fkbi For Biosynthesis Of Methoxymalonyl Extender Unit Of Fk520 Polyketide Immunosuppresant Length = 366 Back     alignment and structure
>pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa Length = 436 Back     alignment and structure
>pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa Length = 436 Back     alignment and structure
>pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Back     alignment and structure
>pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 4e-44
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 2e-32
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 2e-18
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 6e-18
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 1e-43
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 4e-31
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 2e-18
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 7e-18
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 4e-41
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 1e-28
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 2e-16
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 1e-15
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 2e-40
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 9e-29
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 2e-16
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 4e-16
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 1e-38
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 3e-27
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 5e-16
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 2e-14
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 2e-37
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 1e-27
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 5e-15
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 4e-09
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 3e-36
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 2e-21
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 2e-14
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 2e-14
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 5e-36
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 9e-24
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 3e-14
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 5e-14
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 2e-35
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 6e-24
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 6e-14
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 7e-14
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 2e-35
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 5e-24
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 7e-14
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 8e-14
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 3e-35
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 8e-24
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 4e-14
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-13
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 4e-35
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 5e-23
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 7e-13
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 9e-13
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 1e-34
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 5e-22
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 3e-13
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 3e-10
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 5e-34
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 2e-24
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 7e-13
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 2e-12
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 2e-33
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 5e-22
2z1q_A577 Acyl-COA dehydrogenase; FAD, structural genomics, 5e-12
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 1e-11
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 7e-33
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 5e-22
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 5e-12
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 9e-10
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 9e-33
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 3e-22
3owa_A597 Acyl-COA dehydrogenase; structural genomics, cente 1e-11
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 2e-10
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 4e-32
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 1e-21
2uxw_A607 VERY-long-chain specific acyl-COA dehydrogenase; f 6e-11
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 2e-07
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 6e-31
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 5e-22
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 2e-11
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 4e-09
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 8e-31
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 2e-22
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 2e-11
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 1e-08
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 5e-30
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 8e-19
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 2e-11
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 9e-09
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 1e-29
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 2e-13
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 6e-11
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 9e-10
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 4e-29
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 3e-20
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 3e-11
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 3e-10
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 4e-29
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 4e-21
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 7e-10
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 3e-08
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 2e-28
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 7e-20
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 5e-11
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 7e-10
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 5e-28
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 1e-18
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 4e-11
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 6e-10
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 9e-28
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 3e-19
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 7e-11
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 1e-08
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 2e-27
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 1e-19
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 5e-11
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 6e-10
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 3e-26
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 4e-17
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 1e-10
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 5e-09
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 5e-17
2wbi_A 428 Acyl-COA dehydrogenase family member 11; human, ph 8e-10
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 9e-06
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 4e-15
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 3e-10
2ddh_A661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 2e-04
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 3e-13
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 1e-09
1w07_A659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 8e-05
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 2e-09
2jbr_A 422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 2e-08
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 2e-08
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 3e-06
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 9e-05
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta bar 5e-08
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 5e-07
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 6e-08
2rfq_A 394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 2e-04
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 3e-06
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 6e-04
1u8v_A 490 Gamma-aminobutyrate metabolism dehydratase/isomera 3e-05
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 1e-04
2yyk_A 481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 4e-05
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 8e-05
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
 Score =  154 bits (391), Expect = 4e-44
 Identities = 63/82 (76%), Positives = 68/82 (82%)

Query: 104 EQNMGQRASDTRGITFEDVRVPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCL 163
           E NMGQR SDTRGI FEDV+VPKENVL+G+GAGFK+AM  FDK RP VAAGAVGLAQR L
Sbjct: 212 ELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKERPVVAAGAVGLAQRAL 271

Query: 164 DEATKYALERKAFGVPIAAHQG 185
           DEATKYALERK FG  +  HQ 
Sbjct: 272 DEATKYALERKTFGKLLVEHQA 293


>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Length = 541 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Length = 541 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Length = 541 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Length = 515 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Length = 515 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Length = 490 Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Length = 490 Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Length = 481 Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Length = 481 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 99.95
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 99.94
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 99.94
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 99.94
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.94
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 99.94
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 99.94
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 99.94
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 99.94
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 99.93
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 99.93
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 99.93
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 99.93
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 99.93
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 99.93
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 99.93
4hr3_A 415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 99.93
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 99.93
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 99.93
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 99.93
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.93
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 99.92
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 99.91
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 99.9
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 99.9
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 99.88
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 99.88
2wbi_A 428 Acyl-COA dehydrogenase family member 11; human, ph 99.87
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 99.86
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 99.85
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 99.84
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 99.84
2jbr_A 422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 99.79
2rfq_A 394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 99.78
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 99.5
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.48
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 99.47
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 99.47
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.47
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 99.47
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 99.47
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 99.47
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 99.47
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 99.46
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 99.46
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 99.46
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 99.46
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 99.45
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 99.45
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 99.45
4hr3_A415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 99.45
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 99.44
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 99.44
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 99.43
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 99.42
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 99.42
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 99.42
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 99.42
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 99.4
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 99.4
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 99.4
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 99.39
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 99.38
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 99.37
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 99.37
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 99.26
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 99.22
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 99.22
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 99.12
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 99.1
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 99.07
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 99.03
2yyk_A 481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 99.02
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 99.01
1u8v_A 490 Gamma-aminobutyrate metabolism dehydratase/isomera 98.99
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 98.96
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 98.91
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 98.43
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 98.11
4g5e_A517 2,4,6-trichlorophenol 4-monooxygenase; oxidoreduct 98.02
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta bar 97.92
4g5e_A 517 2,4,6-trichlorophenol 4-monooxygenase; oxidoreduct 97.61
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
Probab=99.95  E-value=2e-27  Score=221.13  Aligned_cols=148  Identities=30%  Similarity=0.491  Sum_probs=128.7

Q ss_pred             cccCCCCCHHHHHHHHHHHHhhhhcccchhhhhhhcCCCCHHHHHHHHHcCCccccCCCCCCccCCcCCCcccEEEccee
Q psy10338         44 QVFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVR  123 (312)
Q Consensus        44 ~~m~~~l~~~~~~l~~~~~~f~~~~~~p~~~~~d~~~~~p~~~~~~l~~~G~~~~~~P~~~~~~g~~~~~~~~v~f~dv~  123 (312)
                      .+|+|.++++|++|++.+++|+++++.|...++|+.+.+|+++|++|.+.||+++.+|+                     
T Consensus        13 ~~m~~~~~~e~~~l~~~~r~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~G~~~~~~P~---------------------   71 (393)
T 3pfd_A           13 SFELFQLPEEHIALREAIRALAEKEIAPYAAEVDEKARFPEEALAALNSSGFSAIHVPE---------------------   71 (393)
T ss_dssp             ---------CHHHHHHHHHHHHHHHTGGGHHHHHHTTCCCHHHHHHHHHHTCSCTTSCG---------------------
T ss_pred             cccCCCCCHHHHHHHHHHHHHHHHhCchHHHHHhhhCCCCHHHHHHHHHCCCCCCCCCh---------------------
Confidence            46899999999999999999999999999999999999999999999999999999998                     


Q ss_pred             cCCCCccccCCccHHHHHhhhhccChhHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccchhhHHHHHHhhhHHHHHHHH
Q psy10338        124 VPKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLM  203 (312)
Q Consensus       124 Vp~~~llG~~g~G~~~~~~~l~~~R~~~aa~~~G~~~~~l~~a~~ya~~R~~fg~~l~~~q~v~~~l~~~a~~~~~~~~~  203 (312)
                                                                                                      
T Consensus        72 --------------------------------------------------------------------------------   71 (393)
T 3pfd_A           72 --------------------------------------------------------------------------------   71 (393)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HhcccccccccccccCCCChhHhHHHHHHHHHHccCcchHHHhh---------------------------hcccceeee
Q psy10338        204 LLGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTALE---------------------------ASGLGAYCV  256 (312)
Q Consensus       204 ~~~~g~~~~~~p~~~GG~g~~~~~~~~v~e~l~~~~~~~~~~~~---------------------------g~~~~~~a~  256 (312)
                                   +|||.|++..+++.++|+++++|.+++++..                           |+.++++++
T Consensus        72 -------------~~GG~g~~~~~~~~v~eela~~~~~~~~~~~~~~~~~~~l~~~g~~~q~~~~l~~~~~G~~~~~~a~  138 (393)
T 3pfd_A           72 -------------EYGGQGADSVATCIVIEEVARVDCSASLIPAVNKLGTMGLILRGSEELKKQVLPAVASGEAMASYAL  138 (393)
T ss_dssp             -------------GGTCCCCCHHHHHHHHHHHHTTCHHHHHHHHHHHHTTHHHHHHCCHHHHHHHHHHHHTTSCCEEEEC
T ss_pred             -------------hHCCCCCCHHHHHHHHHHHHhhCchHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHhCCCceeEEEE
Confidence                         7899999999999999999999998876432                           445679999


Q ss_pred             cCCCCCCCcCCceeEEEEeCCEEEEeeeeeeeeCCCcccEEEEEeccCC
Q psy10338        257 TEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRY  305 (312)
Q Consensus       257 tEp~~gsd~~~~~t~A~~~~~g~~l~G~k~~vs~~~~ad~~~v~~~~~~  305 (312)
                      |||++|||+.+++|+|++++|||+|||+|.|+||+.+|||++|++.+++
T Consensus       139 tEp~~gsd~~~~~t~A~~~~~g~~lnG~K~~~s~~~~Ad~~~v~a~~~~  187 (393)
T 3pfd_A          139 SEREAGSDAASMRTRAVADGDDWILNGSKCWITNGGKSTWYTVMAVTDP  187 (393)
T ss_dssp             CBTTBSSCGGGCCCEEEEETTEEEEEEEEEEEETTTTCSEEEEEEESCG
T ss_pred             cCCCCCCCcccCeeEEEEcCCEEEEeeEEEEecCCcccCEEEEEEEeCC
Confidence            9999999999999999999999999999999999999999999976654



>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>4g5e_A 2,4,6-trichlorophenol 4-monooxygenase; oxidoreductase; 2.50A {Cupriavidus necator JMP134} Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure
>4g5e_A 2,4,6-trichlorophenol 4-monooxygenase; oxidoreductase; 2.50A {Cupriavidus necator JMP134} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 7e-15
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 1e-07
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 3e-05
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 9e-14
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 6e-10
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 7e-08
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 8e-12
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 2e-09
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 5e-06
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 3e-11
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 9e-07
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 6e-05
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 7e-11
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 3e-06
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 5e-06
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 4e-10
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 9e-07
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 7e-06
d2c12a2259 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium ox 3e-09
d2c12a2259 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium ox 9e-06
d1r2ja2210 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygro 3e-09
d1r2ja2210 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygro 4e-08
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 4e-09
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 4e-06
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 0.001
d2d29a1153 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Therm 2e-08
d2d29a1153 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Therm 4e-04
d1w07a1189 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, do 5e-08
d1w07a1189 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, do 8e-06
d1r2ja1153 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hy 1e-07
d1r2ja1153 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hy 2e-06
d1jqia1153 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C- 1e-07
d1jqia1153 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C- 6e-04
d1ivha1151 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, 1e-07
d1ivha1151 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, 6e-04
d2c12a1170 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium 2e-07
d2c12a1170 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium 2e-06
d1siqa2236 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH 2e-07
d1siqa2236 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH 5e-07
d1rx0a1153 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase 2e-07
d1rx0a1153 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase 0.002
d1buca1151 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C- 3e-07
d1buca1151 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C- 0.001
d1ukwa1152 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydro 4e-07
d3mdea1154 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydro 6e-07
d2ddha3267 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, 1e-06
d1u8va2275 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase 7e-06
d1u8va2275 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase 8e-04
d1w07a3271 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domai 6e-05
d2ddha1183 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase- 2e-04
d2ddha1183 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase- 2e-04
d1siqa1154 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GC 3e-04
d1siqa1154 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GC 6e-04
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Isovaleryl-coa dehydrogenase, NM domains
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.6 bits (172), Expect = 7e-15
 Identities = 28/67 (41%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 248 ASG--LGAYCVTEPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRY 305
            SG  +GA  ++EP AGSDV  +K KA KKG+ +ILNG K WITNG  A+          
Sbjct: 120 ISGEYIGALAMSEPNAGSDVVSMKLKAEKKGNHYILNGNKFWITNGPDADVLIVYAKTDL 179

Query: 306 EKPGHYQ 312
                 +
Sbjct: 180 AAVPASR 186


>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 259 Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 259 Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 210 Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 210 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 153 Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 153 Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 153 Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 153 Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 153 Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 153 Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 170 Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 170 Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Length = 151 Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Length = 151 Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Length = 152 Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 267 Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Length = 275 Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Length = 275 Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 271 Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 99.97
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 99.96
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.96
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 99.95
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.95
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.95
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 99.94
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.94
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 99.92
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.91
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 99.3
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 99.09
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 98.88
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 98.86
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 98.85
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 98.84
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 98.84
d1siqa1154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 98.75
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 98.74
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 98.73
d1u8va2275 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains 98.71
d2c12a1170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 98.58
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 98.57
d1w07a1189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 98.21
d1siqa1154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 97.91
d2ddha1183 Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 { 97.82
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 97.72
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 97.7
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 97.61
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 97.59
d2c12a1170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 97.59
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 97.49
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 97.44
d1w07a1189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 97.23
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 97.02
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 96.91
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 96.88
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 96.62
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 96.54
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 96.38
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 96.32
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 96.23
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 96.13
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 96.09
d2ddha1183 Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 { 96.07
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 96.05
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 95.67
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 95.37
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 94.16
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Medium chain acyl-CoA dehydrogenase, NM domains
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.97  E-value=3.3e-30  Score=220.66  Aligned_cols=148  Identities=66%  Similarity=1.023  Sum_probs=129.1

Q ss_pred             ccCCCCCHHHHHHHHHHHHhhhhcccchhhhhhhcCCCCHHHHHHHHHcCCccccCCCCCCccCCcCCCcccEEEcceec
Q psy10338         45 VFYSELNETQQEFQALARKFCREEIIPVAAEHDRTGEYPWGIVKKAHELGLINGHIPASEQNMGQRASDTRGITFEDVRV  124 (312)
Q Consensus        45 ~m~~~l~~~~~~l~~~~~~f~~~~~~p~~~~~d~~~~~p~~~~~~l~~~G~~~~~~P~~~~~~g~~~~~~~~v~f~dv~V  124 (312)
                      .|||+||+||++|++.+++|+++++.|.+.++|+++.+|+++|+++.++||+++.+|+                      
T Consensus         1 ~mdf~lseeq~~l~~~~r~f~~~~~~p~a~~~d~~~~~p~~~~~~l~~~Gl~~~~vP~----------------------   58 (231)
T d3mdea2           1 GFSFELTEQQKEFQATARKFAREEIIPVAAEYDRTGEYPVPLLKRAWELGLMNTHIPE----------------------   58 (231)
T ss_dssp             CCCCCCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHCCCCHHHHHHHHHHTCSSTTSCG----------------------
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHhCchhHHHHHHcCCCCHHHHHHHHHhhhccccccc----------------------
Confidence            4999999999999999999999999999999999999999999999999999999998                      


Q ss_pred             CCCCccccCCccHHHHHhhhhccChhHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccchhhHHHHHHhhhHHHHHHHHH
Q psy10338        125 PKENVLLGEGAGFKIAMDTFDKTRPPVAAGAVGLAQRCLDEATKYALERKAFGVPIAAHQGMYLKIQYVSIFEREIQLML  204 (312)
Q Consensus       125 p~~~llG~~g~G~~~~~~~l~~~R~~~aa~~~G~~~~~l~~a~~ya~~R~~fg~~l~~~q~v~~~l~~~a~~~~~~~~~~  204 (312)
                                                                                                      
T Consensus        59 --------------------------------------------------------------------------------   58 (231)
T d3mdea2          59 --------------------------------------------------------------------------------   58 (231)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hcccccccccccccCCCChhHhHHHHHHHHHHccCcchHHHh---------------------------hhcccceeeec
Q psy10338        205 LGVHNCNVFLVSVSGGLELSVFDGCLVAEELAYGCTGIMTAL---------------------------EASGLGAYCVT  257 (312)
Q Consensus       205 ~~~g~~~~~~p~~~GG~g~~~~~~~~v~e~l~~~~~~~~~~~---------------------------~g~~~~~~a~t  257 (312)
                                  +|||.|.+....+.+.|++++.+.+.++..                           .|+.++++++|
T Consensus        59 ------------~~GG~g~~~~~~~~~~e~l~~~~~~~~~~~~~~~~~~~~l~~~g~~~qk~~~l~~l~~g~~~~~~a~t  126 (231)
T d3mdea2          59 ------------SFGGLGLGIIDSCLITEELAYGCTGVQTAIEANTLGQVPLIIGGNYQQQKKYLGRMTEEPLMCAYCVT  126 (231)
T ss_dssp             ------------GGTCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHTTSCCEEEEECC
T ss_pred             ------------cccCccccccccccchhhhcccccccccccccccccchhhhhcCcccccccccchhcCCceEEEEEec
Confidence                        456666666666666676666665555332                           25667799999


Q ss_pred             CCCCCCCcCCceeEEEEeCCEEEEeeeeeeeeCCCcccEEEEEeccCCC
Q psy10338        258 EPGAGSDVNGVKTKAVKKGDEWILNGQKMWITNGGVANWQNRTRDFRYE  306 (312)
Q Consensus       258 Ep~~gsd~~~~~t~A~~~~~g~~l~G~k~~vs~~~~ad~~~v~~~~~~~  306 (312)
                      ||++|||+.+++|+|++++|||+|||+|+||||+..||+++|.+.++.+
T Consensus       127 Ep~~Gsd~~~~~t~a~~~~~g~~lnG~K~~vt~~~~a~~~~~~a~t~~~  175 (231)
T d3mdea2         127 EPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPD  175 (231)
T ss_dssp             BTTBSSCGGGCCCEEEEETTEEEEEEEEEEEETTTTEEEEEEEEECCCC
T ss_pred             CCCCCCCccCCEEEEEEECCEEEEEEEEEEeCCchhccccceecccccc
Confidence            9999999999999999999999999999999999999999998766544



>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure