Psyllid ID: psy1102


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MGLSVPTGGFLGTELALLISWCFLLSEYHVEYFSENSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTDFINLACGSMICQTVWTWWGGAPPQSLNWNLLGSASPF
cccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHcccccc
cccccccHHHHHHHHHHHHHHHHHHcHccHHHcccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHccccccc
mglsvptggflGTELALLISWCFLLSEYHVEyfsenstnineeQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRtrtrhshtDFINLACGSMICQtvwtwwggappqslnwnllgsaspf
mglsvptgGFLGTELALLISWCFLLSEYHVEYFSENSTNINEEQSQRLLDTSEEIERTgkhletgyriaiETEKIATDVLKDLESQRETlqrtrtrhshtDFINLACGSMICQTVWTWWGGAPPQSLnwnllgsaspf
MGLSVPTGGFLGTELALLISWCFLLSEYHVEYFSENSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTDFINLACGSMICQTVWTWWGGAPPQSLNWNLLGSASPF
******TGGFLGTELALLISWCFLLSEYHVEYFS***************************LETGYRIAIETEKIATDVLK****************SHTDFINLACGSMICQTVWTWWGGAPPQSLNWNLL******
*****PTGGFLGTELALLISWCFLLSEYH**************************************IAIETEKIATDVLKDLESQRETLQRT**RH**************************PQSLNWNLLGSASP*
MGLSVPTGGFLGTELALLISWCFLLSEYHVEYFSENSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQ***********SHTDFINLACGSMICQTVWTWWGGAPPQSLNWNLLGSASPF
***SVPTGGFLGTELALLISWCFLLSEYHVEYFSENSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTDFINLACGSMICQTVWTWWGGAPPQSLNWNLLGS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSVPTGGFLGTELALLISWCFLLSEYHVEYFSENSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETxxxxxxxxxxxxxxxxxxxxxxxxxxxxDFINLACGSMICQTVWTWWGGAPPQSLNWNLLGSASPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q96AJ9217 Vesicle transport through yes N/A 0.528 0.336 0.445 2e-09
O89116217 Vesicle transport through yes N/A 0.550 0.350 0.415 3e-09
Q9JI51224 Vesicle transport through yes N/A 0.565 0.348 0.430 6e-09
Q04338217 t-SNARE VTI1 OS=Saccharom yes N/A 0.427 0.271 0.423 9e-07
O88384232 Vesicle transport through no N/A 0.594 0.353 0.360 2e-05
P58200232 Vesicle transport through no N/A 0.594 0.353 0.348 6e-05
Q9UEU0232 Vesicle transport through no N/A 0.594 0.353 0.348 8e-05
Q2KIU0232 Vesicle transport through yes N/A 0.594 0.353 0.337 0.0001
>sp|Q96AJ9|VTI1A_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens GN=VTI1A PE=1 SV=2 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 39  NINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHS 98
           N +E Q   LLD +E +ER+ + LE GY+IA+ETE+I  ++L++L   RE +QR R R  
Sbjct: 109 NSSENQRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLR 168

Query: 99  HTDFINLACGSMIC 112
            TD  NL   S I 
Sbjct: 169 ETD-ANLGKSSRIL 181




V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. Involved in vesicular transport from the late endosomes to the trans-Golgi network. Along with VAMP7, involved in an non-conventional RAB1-dependent traffic route to the cell surface used by KCNIP1 and KCND2. May be involved in increased cytokine secretion associated with cellular senescence.
Homo sapiens (taxid: 9606)
>sp|O89116|VTI1A_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1A OS=Mus musculus GN=Vti1a PE=1 SV=1 Back     alignment and function description
>sp|Q9JI51|VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus GN=Vti1a PE=1 SV=1 Back     alignment and function description
>sp|Q04338|VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTI1 PE=1 SV=3 Back     alignment and function description
>sp|O88384|VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus GN=Vti1b PE=1 SV=1 Back     alignment and function description
>sp|P58200|VTI1B_RAT Vesicle transport through interaction with t-SNAREs homolog 1B OS=Rattus norvegicus GN=Vti1b PE=1 SV=2 Back     alignment and function description
>sp|Q9UEU0|VTI1B_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens GN=VTI1B PE=1 SV=3 Back     alignment and function description
>sp|Q2KIU0|VTI1B_BOVIN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Bos taurus GN=VTI1B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
270012334211 hypothetical protein TcasGA2_TC006472 [T 0.478 0.312 0.545 7e-13
307178357219 Vesicle transport through interaction wi 0.456 0.287 0.587 7e-13
91088835218 PREDICTED: similar to CG3279 CG3279-PA [ 0.478 0.302 0.545 7e-13
383857557217 PREDICTED: vesicle transport through int 0.521 0.331 0.540 1e-12
332026915217 Vesicle transport through interaction wi 0.456 0.290 0.571 2e-12
350422666219 PREDICTED: vesicle transport through int 0.521 0.328 0.527 2e-12
340723947219 PREDICTED: vesicle transport through int 0.521 0.328 0.527 2e-12
170041713220 SNARE Vti1a protein [Culex quinquefascia 0.478 0.3 0.545 2e-12
328785300219 PREDICTED: vesicle transport through int 0.521 0.328 0.540 2e-12
322778811226 hypothetical protein SINV_07175 [Solenop 0.456 0.278 0.555 3e-12
>gi|270012334|gb|EFA08782.1| hypothetical protein TcasGA2_TC006472 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%)

Query: 36  NSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRT 95
           N   I+ +Q QRLLD SE +ERTG+ LE GYR+ +ET+ I T VL++L  QRET++RTR+
Sbjct: 101 NDVRISSDQKQRLLDNSERMERTGRQLEEGYRVVLETQDIGTQVLQNLNEQRETIKRTRS 160

Query: 96  RHSHTD 101
           R   TD
Sbjct: 161 RLRETD 166




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307178357|gb|EFN67106.1| Vesicle transport through interaction with t-SNAREs-like protein 1A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91088835|ref|XP_970611.1| PREDICTED: similar to CG3279 CG3279-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383857557|ref|XP_003704271.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332026915|gb|EGI67016.1| Vesicle transport through interaction with t-SNAREs-like protein 1A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350422666|ref|XP_003493243.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723947|ref|XP_003400348.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|170041713|ref|XP_001848598.1| SNARE Vti1a protein [Culex quinquefasciatus] gi|167865258|gb|EDS28641.1| SNARE Vti1a protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328785300|ref|XP_623763.3| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|322778811|gb|EFZ09227.1| hypothetical protein SINV_07175 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
FB|FBgn0260862230 Vti1 [Drosophila melanogaster 0.492 0.295 0.529 2.7e-13
ZFIN|ZDB-GENE-050809-135191 vti1a "vesicle transport throu 0.601 0.434 0.4 2.8e-11
UNIPROTKB|E1BYU6187 VTI1A "Uncharacterized protein 0.521 0.385 0.452 3.5e-11
UNIPROTKB|Q96AJ9217 VTI1A "Vesicle transport throu 0.521 0.331 0.452 3.5e-11
UNIPROTKB|J9NRK3217 VTI1A "Uncharacterized protein 0.521 0.331 0.438 4.5e-11
RGD|621490224 Vti1a "vesicle transport throu 0.557 0.343 0.435 7.4e-11
MGI|MGI:1855699217 Vti1a "vesicle transport throu 0.521 0.331 0.438 1.5e-10
UNIPROTKB|E1BUX5232 VTI1B "Uncharacterized protein 0.463 0.275 0.434 7e-09
SGD|S000004810217 VTI1 "Protein involved in cis- 0.427 0.271 0.423 3.4e-08
MGI|MGI:1855688232 Vti1b "vesicle transport throu 0.5 0.297 0.388 4.5e-08
FB|FBgn0260862 Vti1 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 174 (66.3 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 36/68 (52%), Positives = 44/68 (64%)

Query:    34 SENSTNINEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRT 93
             S    +I+ +Q QRLLD SE IERTG  L  GYR+A+ETE++   VL DL  QRETLQ  
Sbjct:   110 SYEDVSISTDQRQRLLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGA 169

Query:    94 RTRHSHTD 101
             R R   T+
Sbjct:   170 RARLRETN 177




GO:0005484 "SNAP receptor activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0016192 "vesicle-mediated transport" evidence=IEA;ISS
GO:0006886 "intracellular protein transport" evidence=IEA
ZFIN|ZDB-GENE-050809-135 vti1a "vesicle transport through interaction with t-SNAREs homolog 1A (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYU6 VTI1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q96AJ9 VTI1A "Vesicle transport through interaction with t-SNAREs homolog 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRK3 VTI1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621490 Vti1a "vesicle transport through interaction with t-SNAREs 1A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1855699 Vti1a "vesicle transport through interaction with t-SNAREs 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUX5 VTI1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
SGD|S000004810 VTI1 "Protein involved in cis-Golgi membrane traffic" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
MGI|MGI:1855688 Vti1b "vesicle transport through interaction with t-SNAREs 1B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
pfam1235266 pfam12352, V-SNARE_C, Snare region anchored in the 1e-08
smart0039766 smart00397, t_SNARE, Helical region found in SNARE 0.004
>gnl|CDD|152787 pfam12352, V-SNARE_C, Snare region anchored in the vesicle membrane C-terminus Back     alignment and domain information
 Score = 48.4 bits (116), Expect = 1e-08
 Identities = 20/44 (45%), Positives = 27/44 (61%)

Query: 53 EEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTR 96
          E + R    L+  +RIA ET  I   +L+DL SQRETL+R R +
Sbjct: 1  ERLLREHDRLKNSHRIADETISIGQAILEDLHSQRETLKRARNK 44


Within the SNARE proteins interactions in the C-terminal half of the SNARE helix are critical to the driving of membrane fusion; whereas interactions in the N-terminal half of the SNARE domain are important for promoting priming or docking of the vesicle pfam05008. Length = 66

>gnl|CDD|197699 smart00397, t_SNARE, Helical region found in SNAREs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG1666|consensus220 99.91
PF1235266 V-SNARE_C: Snare region anchored in the vesicle me 99.48
KOG3065|consensus 273 97.75
PF0390892 Sec20: Sec20; InterPro: IPR005606 Sec20 is a membr 97.19
smart0039766 t_SNARE Helical region found in SNAREs. All alpha- 97.18
KOG3251|consensus213 90.88
cd0019360 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fu 89.01
KOG0812|consensus311 87.26
PF0573963 SNARE: SNARE domain; InterPro: IPR000727 The proce 80.1
>KOG1666|consensus Back     alignment and domain information
Probab=99.91  E-value=4.7e-25  Score=180.45  Aligned_cols=90  Identities=36%  Similarity=0.497  Sum_probs=82.6

Q ss_pred             hhhhhhhccCCCCC---CCHHHHHHHHhhhHHHHHhhHhHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHhhhcccccccc
Q psy1102          26 SEYHVEYFSENSTN---INEEQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTDF  102 (138)
Q Consensus        26 ~~~~~elf~~~~~~---~s~dQR~rLL~~terLerTs~rL~~S~Ria~ETE~IG~~IL~dL~~QREqL~rtr~rL~etDs  102 (138)
                      +-++++++.....+   .+++||++||+||++|+||+++|++|+|||.|||+||.+|++||+.|||+|+|||.+|+++|+
T Consensus        98 ~~~rde~~~~~~add~~~~~dQR~rLl~nTerLeRst~rl~ds~Ria~ETEqIG~~IL~dL~~QRe~L~rar~rL~~td~  177 (220)
T KOG1666|consen   98 AGDRDELLEALEADDQNISADQRARLLQNTERLERSTDRLKDSQRIALETEQIGSEILEDLHGQREQLERARERLRETDA  177 (220)
T ss_pred             cchHHHHHhhhhccccccchhHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchh
Confidence            55777777744433   589999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccchhhhHhhh
Q psy1102         103 INLACGSMICQTVW  116 (138)
Q Consensus       103 ~~L~~S~ri~~~~~  116 (138)
                      + +++|++|+.+|-
T Consensus       178 ~-lgkS~kiL~tM~  190 (220)
T KOG1666|consen  178 N-LGKSRKILTTMT  190 (220)
T ss_pred             h-hhHHHHHHHHHH
Confidence            6 999999999885



>PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C Back     alignment and domain information
>KOG3065|consensus Back     alignment and domain information
>PF03908 Sec20: Sec20; InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway Back     alignment and domain information
>smart00397 t_SNARE Helical region found in SNAREs Back     alignment and domain information
>KOG3251|consensus Back     alignment and domain information
>cd00193 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent Back     alignment and domain information
>KOG0812|consensus Back     alignment and domain information
>PF05739 SNARE: SNARE domain; InterPro: IPR000727 The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2nps_C81 Crystal Structure Of The Early Endosomal Snare Comp 3e-09
>pdb|2NPS|C Chain C, Crystal Structure Of The Early Endosomal Snare Complex Length = 81 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Query: 48 LLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTDFINLAC 107 LLD +E +ER+ + LE GY+IA+ETE+I ++L++L RE +QR R R TD NL Sbjct: 7 LLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDA-NLGK 65 Query: 108 GSMIC 112 S I Sbjct: 66 SSRIL 70

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2nps_C81 Vesicle transport through interaction with T- snar 8e-16
1gl2_C65 VTI1B, vesicle transport V-snare protein VTI1-like 5e-13
>2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Length = 81 Back     alignment and structure
 Score = 66.4 bits (162), Expect = 8e-16
 Identities = 26/58 (44%), Positives = 38/58 (65%)

Query: 44  QSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTD 101
               LLD +E +ER+ + LE GY+IA+ETE+I  ++L++L   RE +QR R R   TD
Sbjct: 3   MRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETD 60


>1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
2nps_C81 Vesicle transport through interaction with T- snar 99.89
1gl2_C65 VTI1B, vesicle transport V-snare protein VTI1-like 99.79
1n7s_C79 SNAP-25A; neuronal snare protein complex, four hel 99.59
1nhl_A54 Synaptosomal-associated protein 23; snare, coiled- 99.28
1l4a_C83 S-SNAP25 fusion protein; snare, snare complex, mem 98.62
3b5n_C70 Protein transport protein SEC9; snare complex, syn 98.57
>2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Back     alignment and structure
Probab=99.89  E-value=2.5e-24  Score=150.39  Aligned_cols=74  Identities=39%  Similarity=0.602  Sum_probs=71.6

Q ss_pred             HHHHHHHhhhHHHHHhhHhHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHhhhcccccccccccccchhhhHhhhh
Q psy1102          43 EQSQRLLDTSEEIERTGKHLETGYRIAIETEKIATDVLKDLESQRETLQRTRTRHSHTDFINLACGSMICQTVWT  117 (138)
Q Consensus        43 dQR~rLL~~terLerTs~rL~~S~Ria~ETE~IG~~IL~dL~~QREqL~rtr~rL~etDs~~L~~S~ri~~~~~~  117 (138)
                      +||++||+++++|++|+++|++|+++|+|||+||.+|+++|++|||+|++++++|+++|++ +++|++||..|..
T Consensus         2 ~qR~~Ll~~t~~L~rt~~~L~~s~r~~~ETE~iG~~il~~L~~QRE~l~~~~~~l~~~d~~-l~~s~k~l~~M~r   75 (81)
T 2nps_C            2 SMRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDAN-LGKSSRILTGMLR   75 (81)
T ss_dssp             TTTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH
T ss_pred             cHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhHHhH-HHHHHHHHHHHHH
Confidence            5899999999999999999999999999999999999999999999999999999999997 9999999999864



>1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_C SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1sfc_C 1urq_C 3hd7_C* 3hd9_C 3ipd_C 3rk2_C 3rk3_C 3rl0_C 1kil_C 1jth_A Back     alignment and structure
>1nhl_A Synaptosomal-associated protein 23; snare, coiled-coil, protein transport; 2.30A {Homo sapiens} SCOP: h.1.15.1 Back     alignment and structure
>1l4a_C S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>3b5n_C Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00