Psyllid ID: psy11425

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670--
MSEKDYMNEEQLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDPADRATIEEENTLELRARDRERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFIISAPSGAGKSTLVNELLKKDHKIKLSISTTTRPMRPGEKNGREYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKGHTKKIIGCDNDKVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYEKK
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHccccEEEEEEEEcccccccccccccEEEEcccHHHHHHHHccccEEEHHHccccccccccHHHHHHcccccEEEEEEcccHHHHHHHccccEEEEEccccHHHHHHHHHHHccccHHHHHHHHHcccccccccccccEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccccHHHHHHHHHcccccEEEEcccccccccccccEEEEEccccccccEEEEccccccccccccccccccHHHHHHHHHHHccccEEEcccccHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccEEEEcccccEEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccEEEEccEEEcccccccccEcccEEEccHHHHHHHHHcccEEEEEEEccEEEEEEHHHHHHHHHHccEEEEEccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccEEEEEEcccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEEccccEEccccHHccccccHHHHHHHHHHHcccccEEEEcccccccccccccEEEEEEccccccHcEEccccccHHHcccccEEccHHHHHHHHHHHHccccEEEEccccccHHHHHHcccccHHHHHHHHHHHHcccHHHHHHcccHccccccccccEEEEEEcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHcc
msekdymnEEQLAFFKFRLKKLENDLLKNIVKTTEYLREtilvpdpadratieeENTLELRARDRERKLLIKIQQSIINIdkkeygwckdtgepiGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFiisapsgagksTLVNELLKKDHKIKLsistttrpmrpgekngreyYFTNIDNFKKLQKSGKFLEWAEVhgnfygtsfFPIVREIKSNVDILLEIDFQGAKQIKKkfpnaigifilppsldSLKERLYKRGQDKYDVISRRILSANKeisyankfdYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKghtkkiigcdndkVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHslkdipmnlpsgFILCAILkredprdafisndyislstlpknavvgtNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMlfspnqilpapgqgaiAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIitnpnglkIITAevngpidtpetVGLYAAELLKKKGAIEIIKSYEKK
msekdymneEQLAFFKFRLKKLENDLLKNIVKtteylretilvpdpadratieeentlelrardrERKLLIKIQQsiinidkkeygwCKDTGEPIGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFIIsapsgagkSTLVNELLkkdhkiklsistttrpmrpgeknGREYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKrgqdkydvISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLlkghtkkiigcdndkVTVIALReishgkigveIRLAIWQAEYVRKKIIELYPWCKVEILGIttkgdkifekvplkineKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISndyislstlpknavvgtNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSpnqilpapgQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELlkkkgaieiiksyekk
MSEKDYMNEEQLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDPADRATIEEENTLELRARDRERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFIISAPSGAGKSTLVNELLKKDHKIKLSISTTTRPMRPGEKNGREYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKGHTKKIIGCDNDKVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYEKK
**********QLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDP******************RERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATLSLE*********KSFKSFGNIFIISAPSGAGKSTLVNELLK***********************REYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKGHTKKIIGCDNDKVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIK*****
********EEQLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDPADRATIEEENTLELRARDRERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATL***************KSFGNIFIISAPSGAGKSTLVNELLKKDHKIKLSIS**************EYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQL******************I**REIS****GVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYEK*
********EEQLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDPADRATIEEENTLELRARDRERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFIISAPSGAGKSTLVNELLKKDHKIKLSISTTTRPMRPGEKNGREYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKGHTKKIIGCDNDKVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYEKK
***KDYMNEEQLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDPADRATIEEENTLELRARDRERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFIISAPSGAGKSTLVNELLKKDHKIKLSISTTTRPMRPGEKNGREYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKGHTKKIIGCDNDKVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYEKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEKDYMNEEQLAFFKFRLKKLENDLLKNIVKTTEYLRETILVPDPADRATIEEENTLELRARDRERKLLIKIQQSIINIDKKEYGWCKDTGEPIGILRLLAKPMATLSLEAQQRHELKKKSFKSFGNIFIISAPSGAGKSTLVNELLKKDHKIKLSISTTTRPMRPGEKNGREYYFTNIDNFKKLQKSGKFLEWAEVHGNFYGTSFFPIVREIKSNVDILLEIDFQGAKQIKKKFPNAIGIFILPPSLDSLKERLYKRGQDKYDVISRRILSANKEISYANKFDYIIINNKFSKALLQLKAIINANRCFMARVTIEDGLKKINNRFKLTLCAVYRARQLLKGHTKKIIGCDNDKVTVIALREISHGKIGVEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYEKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query672 2.2.26 [Sep-21-2011]
Q7VVU9314 Porphobilinogen deaminase yes N/A 0.431 0.923 0.522 3e-85
Q7W785314 Porphobilinogen deaminase yes N/A 0.431 0.923 0.522 6e-85
Q7WKM1314 Porphobilinogen deaminase yes N/A 0.431 0.923 0.522 6e-85
B2JEN9327 Porphobilinogen deaminase yes N/A 0.437 0.899 0.513 5e-84
B2T1D1342 Porphobilinogen deaminase yes N/A 0.437 0.859 0.513 5e-84
Q7P207309 Porphobilinogen deaminase yes N/A 0.437 0.951 0.501 9e-84
A9IKF3313 Porphobilinogen deaminase yes N/A 0.395 0.849 0.539 6e-83
Q82WS2308 Porphobilinogen deaminase yes N/A 0.437 0.954 0.508 7e-82
Q9K0P6311 Porphobilinogen deaminase yes N/A 0.433 0.935 0.496 1e-81
C1D679308 Porphobilinogen deaminase yes N/A 0.437 0.954 0.501 1e-81
>sp|Q7VVU9|HEM3_BORPE Porphobilinogen deaminase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemC PE=3 SV=1 Back     alignment and function desciption
 Score =  316 bits (810), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 204/293 (69%), Gaps = 3/293 (1%)

Query: 374 RLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKG 433
           RLA+WQAE+VR  +   YP C VE+L +TT+GD+I ++   K+  KGLF KELE A++ G
Sbjct: 15  RLALWQAEHVRDLLRARYPACSVELLTLTTRGDQILDRTLSKVGGKGLFVKELETALLDG 74

Query: 434 KADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRK 493
           +ADLAVHSLKD+P++L + F L  +L+R DPRDAF+SNDY SL+ LP  A VGT+SLRR+
Sbjct: 75  RADLAVHSLKDVPVDLHAPFELSCVLERADPRDAFVSNDYGSLADLPPGAAVGTSSLRRE 134

Query: 494 VLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQIL 553
             I++ +P L++K LRGN+DTRL KLD G+YAAI+LAAAGL+RL L  RIR L  P+  L
Sbjct: 135 SQIRARYPHLVVKPLRGNLDTRLGKLDNGDYAAIVLAAAGLERLGLAARIRALLEPDDSL 194

Query: 554 PAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVN 613
           PA GQGA+ IEIL  R ++  ML PL    +   V AERAVSR   GSC++ LAA+A ++
Sbjct: 195 PAAGQGALGIEILQGRADVRAMLAPLGDAATLACVTAERAVSRMLGGSCQVPLAAYARID 254

Query: 614 NFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEII 666
                E+ LRA++  P+G +I+ AE  GP D  + +G  AA  L   GA  I+
Sbjct: 255 G---DELALRALVAAPDGRRIVRAERRGPRDQAQAIGESAARDLLADGADAIL 304
Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps.
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) (taxid: 257313)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 6EC: 1
>sp|Q7W785|HEM3_BORPA Porphobilinogen deaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|Q7WKM1|HEM3_BORBR Porphobilinogen deaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|B2JEN9|HEM3_BURP8 Porphobilinogen deaminase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|B2T1D1|HEM3_BURPP Porphobilinogen deaminase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|Q7P207|HEM3_CHRVO Porphobilinogen deaminase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hemC PE=3 SV=2 Back     alignment and function description
>sp|A9IKF3|HEM3_BORPD Porphobilinogen deaminase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|Q82WS2|HEM3_NITEU Porphobilinogen deaminase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|Q9K0P6|HEM3_NEIMB Porphobilinogen deaminase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hemC PE=3 SV=1 Back     alignment and function description
>sp|C1D679|HEM3_LARHH Porphobilinogen deaminase OS=Laribacter hongkongensis (strain HLHK9) GN=hemC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query672
399020182317 porphobilinogen deaminase [Herbaspirillu 0.434 0.921 0.566 5e-97
134094241317 porphobilinogen deaminase [Herminiimonas 0.437 0.927 0.585 2e-91
395761656336 porphobilinogen deaminase [Janthinobacte 0.437 0.875 0.56 2e-87
409406649318 porphobilinogen deaminase [Herbaspirillu 0.434 0.918 0.538 3e-87
152980451317 hydroxymethylbilane synthase [Janthinoba 0.434 0.921 0.569 6e-87
340786600313 porphobilinogen deaminase [Collimonas fu 0.434 0.932 0.566 1e-86
293604316315 hydroxymethylbilane synthase [Achromobac 0.433 0.923 0.517 5e-85
300312229318 porphobilinogen deaminase [Herbaspirillu 0.434 0.918 0.545 6e-85
427403586321 porphobilinogen deaminase [Massilia timo 0.437 0.915 0.558 7e-85
430807589317 porphobilinogen deaminase [Cupriavidus s 0.437 0.927 0.52 8e-85
>gi|399020182|ref|ZP_10722321.1| porphobilinogen deaminase [Herbaspirillum sp. CF444] gi|398095834|gb|EJL86166.1| porphobilinogen deaminase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
 Score =  362 bits (928), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 167/295 (56%), Positives = 220/295 (74%), Gaps = 3/295 (1%)

Query: 372 EIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAII 431
           E RLA+WQAE+VR ++  LYP C + ILG+TT+GD+I ++   K+  KGLF KELE+A+ 
Sbjct: 15  ESRLAMWQAEHVRDRLAALYPQCSIIILGMTTRGDQILDRTLSKVGGKGLFVKELEVAMA 74

Query: 432 KGKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLR 491
           +G+AD AVHSLKD+PM LP GF+L  IL+REDPRDAF+SNDY  L  LP  AVVGT+SLR
Sbjct: 75  EGRADFAVHSLKDVPMELPQGFVLGGILEREDPRDAFVSNDYAGLDDLPHGAVVGTSSLR 134

Query: 492 RKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQ 551
           R+ LI + +P L+IK LRGN+DTRL KLD+GEYAAIILA AGLKRL L+ RIR   +P Q
Sbjct: 135 RQALIAARYPHLVIKPLRGNLDTRLAKLDRGEYAAIILAVAGLKRLGLESRIRSAIAPEQ 194

Query: 552 ILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAM 611
            LPAPGQGA+AIEIL +R +L  +L P+NH  +++ V AER +SR F GSC+I LAAFA 
Sbjct: 195 SLPAPGQGAMAIEILADRTDLQRVLAPINHLPTDRAVTAERTLSRTFGGSCQIPLAAFAT 254

Query: 612 VNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEII 666
           +      ++++RA++  P+G +I  AE +GP D PE +G   A+LL+ +GA  I+
Sbjct: 255 IEG---DKMHMRAMVATPDGKQIAAAEASGPADAPEALGRQVADLLQAQGAEAIL 306

Source: Herbaspirillum sp. CF444

Species: Herbaspirillum sp. CF444

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|134094241|ref|YP_001099316.1| porphobilinogen deaminase [Herminiimonas arsenicoxydans] gi|133738144|emb|CAL61189.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|395761656|ref|ZP_10442325.1| porphobilinogen deaminase [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|409406649|ref|ZP_11255111.1| porphobilinogen deaminase [Herbaspirillum sp. GW103] gi|386435198|gb|EIJ48023.1| porphobilinogen deaminase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|152980451|ref|YP_001352832.1| hydroxymethylbilane synthase [Janthinobacterium sp. Marseille] gi|151280528|gb|ABR88938.1| hydroxymethylbilane synthase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|340786600|ref|YP_004752065.1| porphobilinogen deaminase [Collimonas fungivorans Ter331] gi|340551867|gb|AEK61242.1| Porphobilinogen deaminase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|293604316|ref|ZP_06686723.1| hydroxymethylbilane synthase [Achromobacter piechaudii ATCC 43553] gi|292817193|gb|EFF76267.1| hydroxymethylbilane synthase [Achromobacter piechaudii ATCC 43553] Back     alignment and taxonomy information
>gi|300312229|ref|YP_003776321.1| porphobilinogen deaminase [Herbaspirillum seropedicae SmR1] gi|300075014|gb|ADJ64413.1| porphobilinogen deaminase protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|427403586|ref|ZP_18894468.1| porphobilinogen deaminase [Massilia timonae CCUG 45783] gi|425717569|gb|EKU80525.1| porphobilinogen deaminase [Massilia timonae CCUG 45783] Back     alignment and taxonomy information
>gi|430807589|ref|ZP_19434704.1| porphobilinogen deaminase [Cupriavidus sp. HMR-1] gi|429500112|gb|EKZ98496.1| porphobilinogen deaminase [Cupriavidus sp. HMR-1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query672
UNIPROTKB|P06983313 hemC [Escherichia coli K-12 (t 0.428 0.920 0.470 4.7e-64
TIGR_CMR|CHY_1208311 CHY_1208 "porphobilinogen deam 0.437 0.945 0.383 2.4e-51
ZFIN|ZDB-GENE-040426-1375358 hmbsa "hydroxymethylbilane syn 0.355 0.667 0.436 1.8e-50
UNIPROTKB|F1NKN8349 HMBS "Uncharacterized protein" 0.358 0.690 0.440 3.7e-48
TIGR_CMR|BA_4696309 BA_4696 "porphobilinogen deami 0.436 0.948 0.4 6e-48
DICTYBASE|DDB_G0284697325 hemC "porphobilinogen deaminas 0.444 0.92 0.392 1.2e-47
ZFIN|ZDB-GENE-050522-491360 hmbsb "hydroxymethylbilane syn 0.388 0.725 0.416 3.3e-47
MGI|MGI:96112361 Hmbs "hydroxymethylbilane synt 0.425 0.792 0.367 4.2e-47
RGD|2801361 Hmbs "hydroxymethylbilane synt 0.425 0.792 0.370 5.5e-47
UNIPROTKB|Q5M893361 Hmbs "Hydroxymethylbilane synt 0.425 0.792 0.370 5.5e-47
UNIPROTKB|P06983 hemC [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 653 (234.9 bits), Expect = 4.7e-64, P = 4.7e-64
 Identities = 138/293 (47%), Positives = 191/293 (65%)

Query:   375 LAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGK 434
             LA+WQA YV+ K++  +P   VE++ + T+GD I +    K+  KGLF KELE+A+++ +
Sbjct:    15 LALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILDTPLAKVGGKGLFVKELEVALLENR 74

Query:   435 ADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKV 494
             AD+AVHS+KD+P+  P G  L  I +REDPRDAF+SN+Y SL  LP  ++VGT+SLRR+ 
Sbjct:    75 ADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGSIVGTSSLRRQC 134

Query:   495 LIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILP 554
              +    P LII+SLRGN+ TRL+KLD GEY AIILA AGLKRL L+ RIR    P   LP
Sbjct:   135 QLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRIRAALPPEISLP 194

Query:   555 APGQGAIAIEI-LDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVN 613
             A GQGA+ IE  LD+ +   E+L  LNH+ +   V AERA++    G C++ + ++A   
Sbjct:   195 AVGQGAVGIECRLDDSRT-RELLAALNHHETALRVTAERAMNTRLEGGCQVPIGSYA--- 250

Query:   614 NFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEII 666
                + EI LRA++  P+G +II  E  G     E +G+  AE L   GA EI+
Sbjct:   251 ELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNGAREIL 303
GO:0004418 "hydroxymethylbilane synthase activity" evidence=IEA;IMP
GO:0006783 "heme biosynthetic process" evidence=IMP
GO:0033014 "tetrapyrrole biosynthetic process" evidence=IMP
GO:0018160 "peptidyl-pyrromethane cofactor linkage" evidence=IEA;IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006782 "protoporphyrinogen IX biosynthetic process" evidence=IEA
TIGR_CMR|CHY_1208 CHY_1208 "porphobilinogen deaminase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1375 hmbsa "hydroxymethylbilane synthase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKN8 HMBS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4696 BA_4696 "porphobilinogen deaminase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284697 hemC "porphobilinogen deaminase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-491 hmbsb "hydroxymethylbilane synthase, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:96112 Hmbs "hydroxymethylbilane synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2801 Hmbs "hydroxymethylbilane synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M893 Hmbs "Hydroxymethylbilane synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2T1D1HEM3_BURPP2, ., 5, ., 1, ., 6, 10.51330.43750.8596yesN/A
A3NSN6HEM3_BURP02, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
Q21XQ9HEM3_RHOFD2, ., 5, ., 1, ., 6, 10.52300.37940.8095yesN/A
Q2T071HEM3_BURTA2, ., 5, ., 1, ., 6, 10.53150.39580.8085yesN/A
A2SAH5HEM3_BURM92, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
A3N700HEM3_BURP62, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
Q3JUW3HEM3_BURP12, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
B1JWR0HEM3_BURCC2, ., 5, ., 1, ., 6, 10.50660.43750.8802yesN/A
C1D679HEM3_LARHH2, ., 5, ., 1, ., 6, 10.50160.43750.9545yesN/A
Q7W785HEM3_BORPA2, ., 5, ., 1, ., 6, 10.52210.43150.9235yesN/A
B2JEN9HEM3_BURP82, ., 5, ., 1, ., 6, 10.51330.43750.8990yesN/A
A3MLK5HEM3_BURM72, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
Q82WS2HEM3_NITEU2, ., 5, ., 1, ., 6, 10.50840.43750.9545yesN/A
A9IKF3HEM3_BORPD2, ., 5, ., 1, ., 6, 10.53900.39580.8498yesN/A
Q8XWW3HEM3_RALSO2, ., 5, ., 1, ., 6, 10.56920.38390.7724yesN/A
Q62LC0HEM3_BURMA2, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
Q0BCU9HEM3_BURCM2, ., 5, ., 1, ., 6, 10.50330.43750.8963yesN/A
Q7VVU9HEM3_BORPE2, ., 5, ., 1, ., 6, 10.52210.43150.9235yesN/A
Q63W73HEM3_BURPS2, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
A1V5U0HEM3_BURMS2, ., 5, ., 1, ., 6, 10.54370.38690.7902yesN/A
B4E8C4HEM3_BURCJ2, ., 5, ., 1, ., 6, 10.50660.43750.8802yesN/A
Q7P207HEM3_CHRVO2, ., 5, ., 1, ., 6, 10.50160.43750.9514yesN/A
Q7WKM1HEM3_BORBR2, ., 5, ., 1, ., 6, 10.52210.43150.9235yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.4.80.737
3rd Layer2.7.4LOW CONFIDENCE prediction!
3rd Layer2.7.70.691
4th Layer2.5.1.61LOW CONFIDENCE prediction!
4th Layer2.7.7.60.737
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query672
PRK00072295 PRK00072, hemC, porphobilinogen deaminase; Reviewe 1e-136
COG0181307 COG0181, HemC, Porphobilinogen deaminase [Coenzyme 1e-122
cd00494292 cd00494, HMBS, Hydroxymethylbilane synthase (HMBS) 1e-118
TIGR00212292 TIGR00212, hemC, porphobilinogen deaminase 1e-107
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 2e-96
pfam01379213 pfam01379, Porphobil_deam, Porphobilinogen deamina 1e-94
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 4e-88
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 2e-82
PLN02691351 PLN02691, PLN02691, porphobilinogen deaminase 1e-69
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 1e-51
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 3e-51
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 9e-50
smart00072174 smart00072, GuKc, Guanylate kinase homologues 3e-49
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 2e-43
TIGR02420110 TIGR02420, dksA, RNA polymerase-binding protein Dk 1e-40
PRK01066231 PRK01066, PRK01066, porphobilinogen deaminase; Pro 9e-35
COG1734120 COG1734, DksA, DnaK suppressor protein [Signal tra 6e-33
PLN02772398 PLN02772, PLN02772, guanylate kinase 8e-32
PRK10778151 PRK10778, dksA, RNA polymerase-binding transcripti 6e-24
PRK0039269 PRK00392, rpoZ, DNA-directed RNA polymerase subuni 2e-17
COG175874 COG1758, RpoZ, DNA-directed RNA polymerase, subuni 3e-12
TIGR0069060 TIGR00690, rpoZ, DNA-directed RNA polymerase, omeg 8e-12
pfam0390072 pfam03900, Porphobil_deamC, Porphobilinogen deamin 3e-11
TIGR02890159 TIGR02890, bacill_yteA, regulatory protein, yteA f 2e-08
pfam0125836 pfam01258, zf-dskA_traR, Prokaryotic dksA/traR C4- 1e-06
pfam0119257 pfam01192, RNA_pol_Rpb6, RNA polymerase Rpb6 6e-05
TIGR02322179 TIGR02322, phosphon_PhnN, phosphonate metabolism p 0.003
>gnl|CDD|234612 PRK00072, hemC, porphobilinogen deaminase; Reviewed Back     alignment and domain information 
 Score =  400 bits (1031), Expect = e-136
 Identities = 147/287 (51%), Positives = 196/287 (68%), Gaps = 5/287 (1%)

Query: 374 RLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPL-KINEKGLFTKELEMAIIK 432
           +LA+WQAE+V+ ++   +P  +VE++ I TKGDKI   VPL KI  KGLF KELE A+++
Sbjct: 13  KLALWQAEWVKDRLKAAHPGLEVELVPIKTKGDKIL-DVPLAKIGGKGLFVKELEEALLE 71

Query: 433 GKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRR 492
           G+ D+AVHSLKD+P  LP G +L AI +REDPRDA +S DY SL  LP+ AVVGT+SLRR
Sbjct: 72  GEIDIAVHSLKDVPTELPEGLVLAAIPEREDPRDALVSRDYKSLDDLPEGAVVGTSSLRR 131

Query: 493 KVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQI 552
           +  + +  P L IK LRGN+DTRL KLD+GEY AIILAAAGLKRL L+ RI     P ++
Sbjct: 132 QAQLLALRPDLEIKPLRGNVDTRLRKLDEGEYDAIILAAAGLKRLGLEDRITEYLDPEEM 191

Query: 553 LPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMV 612
           LPAPGQGA+ IE   + +E++E+L PLNH  +   V AERA  R   G C++ + A+A  
Sbjct: 192 LPAPGQGALGIECRADDEEILELLAPLNHEETRLRVTAERAFLRALEGGCQVPIGAYA-- 249

Query: 613 NNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKK 659
                 E+ LR ++ +P+G +II AE+ GP    E +G+  AE L  
Sbjct: 250 -ELEGDELRLRGLVGSPDGSEIIRAEIEGPAADAEELGIELAEELLA 295

Length = 295
>gnl|CDD|223259 COG0181, HemC, Porphobilinogen deaminase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238276 cd00494, HMBS, Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12 Back     alignment and domain information
>gnl|CDD|232876 TIGR00212, hemC, porphobilinogen deaminase Back     alignment and domain information
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|216465 pfam01379, Porphobil_deam, Porphobilinogen deaminase, dipyromethane cofactor binding domain Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|215373 PLN02691, PLN02691, porphobilinogen deaminase Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|131473 TIGR02420, dksA, RNA polymerase-binding protein DksA Back     alignment and domain information
>gnl|CDD|167150 PRK01066, PRK01066, porphobilinogen deaminase; Provisional Back     alignment and domain information
>gnl|CDD|224648 COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|182722 PRK10778, dksA, RNA polymerase-binding transcription factor; Provisional Back     alignment and domain information
>gnl|CDD|234744 PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed Back     alignment and domain information
>gnl|CDD|224672 COG1758, RpoZ, DNA-directed RNA polymerase, subunit K/omega [Transcription] Back     alignment and domain information
>gnl|CDD|188073 TIGR00690, rpoZ, DNA-directed RNA polymerase, omega subunit Back     alignment and domain information
>gnl|CDD|202802 pfam03900, Porphobil_deamC, Porphobilinogen deaminase, C-terminal domain Back     alignment and domain information
>gnl|CDD|234050 TIGR02890, bacill_yteA, regulatory protein, yteA family Back     alignment and domain information
>gnl|CDD|201690 pfam01258, zf-dskA_traR, Prokaryotic dksA/traR C4-type zinc finger Back     alignment and domain information
>gnl|CDD|201652 pfam01192, RNA_pol_Rpb6, RNA polymerase Rpb6 Back     alignment and domain information
>gnl|CDD|233821 TIGR02322, phosphon_PhnN, phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 672
COG0181307 HemC Porphobilinogen deaminase [Coenzyme metabolis 100.0
TIGR00212292 hemC porphobilinogen deaminase. Biosynthesis of co 100.0
cd00494292 HMBS Hydroxymethylbilane synthase (HMBS), also kno 100.0
PLN02691351 porphobilinogen deaminase 100.0
PRK00072295 hemC porphobilinogen deaminase; Reviewed 100.0
KOG2892|consensus320 100.0
PF01379215 Porphobil_deam: Porphobilinogen deaminase, dipyrom 100.0
PRK01066231 porphobilinogen deaminase; Provisional 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 100.0
PRK14737186 gmk guanylate kinase; Provisional 100.0
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 100.0
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 100.0
PLN02772398 guanylate kinase 100.0
PRK14738206 gmk guanylate kinase; Provisional 99.97
KOG0609|consensus542 99.97
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.95
PRK00300205 gmk guanylate kinase; Provisional 99.95
KOG0707|consensus231 99.95
PRK10778151 dksA RNA polymerase-binding transcription factor; 99.94
COG1734120 DksA DnaK suppressor protein [Signal transduction 99.92
TIGR02420110 dksA RNA polymerase-binding protein DksA. The mode 99.92
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.9
TIGR02890159 spore_yteA sporulation protein, yteA family. Membe 99.88
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.85
COG3709192 Uncharacterized component of phosphonate metabolis 99.83
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.83
PRK08356195 hypothetical protein; Provisional 99.77
PF0390074 Porphobil_deamC: Porphobilinogen deaminase, C-term 99.71
TIGR0069059 rpoZ DNA-directed RNA polymerase, omega subunit. T 99.66
PHA0008072 DksA-like zinc finger domain containing protein 99.52
PRK0039269 rpoZ DNA-directed RNA polymerase subunit omega; Re 99.45
TIGR0241963 C4_traR_proteo phage/conjugal plasmid C-4 type zin 99.45
KOG0708|consensus359 99.43
PRK1371573 conjugal transfer protein TraR; Provisional 99.43
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.43
PRK1101988 hypothetical protein; Provisional 99.42
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.35
COG175874 RpoZ DNA-directed RNA polymerase, subunit K/omega 99.33
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.32
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.31
PF0119257 RNA_pol_Rpb6: RNA polymerase Rpb6 ; InterPro: IPR0 99.3
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.3
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.3
PRK04040188 adenylate kinase; Provisional 99.25
PTZ00451244 dephospho-CoA kinase; Provisional 99.25
PLN02422232 dephospho-CoA kinase 99.23
KOG3220|consensus225 99.2
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.18
PF0125836 zf-dskA_traR: Prokaryotic dksA/traR C4-type zinc f 99.17
PRK01184184 hypothetical protein; Provisional 99.15
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.15
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.15
PRK00698205 tmk thymidylate kinase; Validated 99.15
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.15
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.12
PRK05480209 uridine/cytidine kinase; Provisional 99.1
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 99.05
PRK06762166 hypothetical protein; Provisional 99.02
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 98.98
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.96
PRK08233182 hypothetical protein; Provisional 98.94
PTZ00301210 uridine kinase; Provisional 98.93
PRK06696223 uridine kinase; Validated 98.87
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 98.86
PRK0109962 rpoK DNA-directed RNA polymerase subunit K; Provis 98.84
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.84
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.81
PRK04182180 cytidylate kinase; Provisional 98.8
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.8
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.79
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.79
PRK14531183 adenylate kinase; Provisional 98.78
KOG3079|consensus195 98.77
PRK14527191 adenylate kinase; Provisional 98.77
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.76
PRK14530215 adenylate kinase; Provisional 98.75
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.74
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.7
PLN02200234 adenylate kinase family protein 98.69
PRK12339197 2-phosphoglycerate kinase; Provisional 98.68
PRK13946184 shikimate kinase; Provisional 98.67
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.67
PRK00131175 aroK shikimate kinase; Reviewed 98.67
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.65
PRK05541176 adenylylsulfate kinase; Provisional 98.65
PRK12338319 hypothetical protein; Provisional 98.64
PRK00279215 adk adenylate kinase; Reviewed 98.63
PRK14526211 adenylate kinase; Provisional 98.63
PRK14532188 adenylate kinase; Provisional 98.61
PRK09270229 nucleoside triphosphate hydrolase domain-containin 98.58
PRK13973213 thymidylate kinase; Provisional 98.58
PRK13808333 adenylate kinase; Provisional 98.58
PRK13947171 shikimate kinase; Provisional 98.57
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 98.55
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.53
PLN02674244 adenylate kinase 98.52
PRK05057172 aroK shikimate kinase I; Reviewed 98.52
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 98.51
PHA02530300 pseT polynucleotide kinase; Provisional 98.5
PRK00889175 adenylylsulfate kinase; Provisional 98.5
PRK13975196 thymidylate kinase; Provisional 98.5
PLN02348395 phosphoribulokinase 98.49
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 98.48
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 98.48
PRK03839180 putative kinase; Provisional 98.48
PRK07429327 phosphoribulokinase; Provisional 98.48
PRK03731171 aroL shikimate kinase II; Reviewed 98.47
PLN02459261 probable adenylate kinase 98.46
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.45
PLN02318656 phosphoribulokinase/uridine kinase 98.44
PRK02496184 adk adenylate kinase; Provisional 98.44
PRK06547172 hypothetical protein; Provisional 98.43
PRK14529223 adenylate kinase; Provisional 98.4
PRK12337475 2-phosphoglycerate kinase; Provisional 98.4
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 98.39
PRK13948182 shikimate kinase; Provisional 98.39
PRK03846198 adenylylsulfate kinase; Provisional 98.39
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 98.38
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.38
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.38
PRK07667193 uridine kinase; Provisional 98.37
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 98.37
PLN02924220 thymidylate kinase 98.35
PRK14528186 adenylate kinase; Provisional 98.35
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 98.34
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.33
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 98.33
PRK06217183 hypothetical protein; Validated 98.3
PRK05439311 pantothenate kinase; Provisional 98.3
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 98.3
PRK13974212 thymidylate kinase; Provisional 98.3
PRK13949169 shikimate kinase; Provisional 98.29
PRK04220301 2-phosphoglycerate kinase; Provisional 98.28
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.28
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.28
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 98.26
COG4088261 Predicted nucleotide kinase [Nucleotide transport 98.25
PRK00625173 shikimate kinase; Provisional 98.24
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.18
PRK13976209 thymidylate kinase; Provisional 98.17
PRK07933213 thymidylate kinase; Validated 98.16
PRK08118167 topology modulation protein; Reviewed 98.15
PRK00023225 cmk cytidylate kinase; Provisional 98.15
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 98.14
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 98.14
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 98.13
PRK15453290 phosphoribulokinase; Provisional 98.12
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.12
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.11
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 98.1
PRK09825176 idnK D-gluconate kinase; Provisional 98.1
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.09
PTZ00088229 adenylate kinase 1; Provisional 98.08
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.07
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 98.04
PRK11545163 gntK gluconate kinase 1; Provisional 98.03
PLN02842505 nucleotide kinase 98.02
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.01
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 98.0
KOG3354|consensus191 97.99
PRK06761282 hypothetical protein; Provisional 97.98
PLN02840421 tRNA dimethylallyltransferase 97.96
PRK07261171 topology modulation protein; Provisional 97.93
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.88
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.88
COG4639168 Predicted kinase [General function prediction only 97.88
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.84
KOG3347|consensus176 97.82
PRK00098298 GTPase RsgA; Reviewed 97.81
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.79
PLN02165334 adenylate isopentenyltransferase 97.79
COG0645170 Predicted kinase [General function prediction only 97.77
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.75
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 97.75
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.75
PLN02199303 shikimate kinase 97.7
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 97.67
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 97.66
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.62
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.62
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 97.59
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 97.49
KOG3877|consensus393 97.49
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.48
COG3911183 Predicted ATPase [General function prediction only 97.46
KOG1384|consensus348 97.39
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 97.36
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 97.28
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.26
PRK08099399 bifunctional DNA-binding transcriptional repressor 97.23
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 97.16
PLN02748468 tRNA dimethylallyltransferase 97.16
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 97.14
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.11
PRK12495226 hypothetical protein; Provisional 97.04
PRK11063271 metQ DL-methionine transporter substrate-binding s 97.01
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.99
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 96.98
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.95
COG4185187 Uncharacterized protein conserved in bacteria [Fun 96.92
PHA00729226 NTP-binding motif containing protein 96.83
COG1660286 Predicted P-loop-containing kinase [General functi 96.8
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 96.77
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 96.75
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.72
COG4619223 ABC-type uncharacterized transport system, ATPase 96.7
TIGR01223182 Pmev_kin_anim phosphomevalonate kinase, animal typ 96.7
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.52
PRK09087226 hypothetical protein; Validated 96.49
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.47
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 96.43
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.38
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.36
TIGR00363258 lipoprotein, YaeC family. This family of putative 96.33
KOG0744|consensus423 96.21
COG1160444 Predicted GTPases [General function prediction onl 96.11
KOG3327|consensus208 96.08
PRK09435332 membrane ATPase/protein kinase; Provisional 96.07
smart00382148 AAA ATPases associated with a variety of cellular 95.99
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.99
PF1355562 AAA_29: P-loop containing region of AAA domain 95.97
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 95.97
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 95.94
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.93
KOG1969|consensus877 95.91
PHA03132580 thymidine kinase; Provisional 95.83
KOG0057|consensus591 95.81
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.79
KOG3308|consensus225 95.77
PRK06851367 hypothetical protein; Provisional 95.76
COG4618580 ArpD ABC-type protease/lipase transport system, AT 95.74
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.73
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.66
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.6
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 95.58
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 95.52
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.52
PF00004132 AAA: ATPase family associated with various cellula 95.49
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.46
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 95.44
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.38
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.36
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.35
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.35
COG0593408 DnaA ATPase involved in DNA replication initiation 95.35
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.32
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.29
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.28
PLN03046460 D-glycerate 3-kinase; Provisional 95.28
KOG0635|consensus207 95.27
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.26
KOG2702|consensus323 95.24
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 95.21
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 95.16
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.14
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 95.13
PRK12422445 chromosomal replication initiation protein; Provis 95.13
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 95.13
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.12
PLN02796347 D-glycerate 3-kinase 95.1
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.08
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 95.07
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.06
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 95.06
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.06
COG1127263 Ttg2A ABC-type transport system involved in resist 95.04
KOG3078|consensus235 95.03
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 95.02
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 95.01
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 95.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.98
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.98
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.98
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.98
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 94.97
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.97
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.96
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 94.96
cd03269210 ABC_putative_ATPase This subfamily is involved in 94.95
KOG0056|consensus790 94.92
COG4175386 ProV ABC-type proline/glycine betaine transport sy 94.91
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.91
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.88
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.87
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.86
PTZ00202550 tuzin; Provisional 94.86
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.86
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 94.85
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.85
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.84
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.83
PF05729166 NACHT: NACHT domain 94.83
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.83
PF1324576 AAA_19: Part of AAA domain 94.83
COG1117253 PstB ABC-type phosphate transport system, ATPase c 94.82
KOG0058|consensus716 94.81
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 94.81
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.8
PRK14086617 dnaA chromosomal replication initiation protein; P 94.79
KOG0734|consensus752 94.78
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.78
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 94.78
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 94.77
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.76
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 94.76
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.75
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 94.74
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 94.74
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 94.73
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.72
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 94.7
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.7
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.67
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.67
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.66
COG3638258 ABC-type phosphate/phosphonate transport system, A 94.65
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.64
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.64
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.6
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 94.6
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.6
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 94.6
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.58
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.57
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.55
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.55
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.55
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.54
PTZ002651466 multidrug resistance protein (mdr1); Provisional 94.54
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 94.54
cd03234226 ABCG_White The White subfamily represents ABC tran 94.53
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.53
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 94.53
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.53
KOG3580|consensus1027 94.52
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 94.52
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.52
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 94.51
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 94.5
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.49
PRK00089292 era GTPase Era; Reviewed 94.49
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 94.48
TIGR00436270 era GTP-binding protein Era. Era is an essential G 94.48
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.47
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.47
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.47
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 94.47
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 94.46
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 94.46
cd03246173 ABCC_Protease_Secretion This family represents the 94.46
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.46
PRK10908222 cell division protein FtsE; Provisional 94.45
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.45
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.45
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 94.44
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 94.44
PRK14242253 phosphate transporter ATP-binding protein; Provisi 94.43
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.43
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 94.42
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 94.42
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.41
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.41
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 94.41
PRK11784345 tRNA 2-selenouridine synthase; Provisional 94.41
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.4
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.37
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 94.37
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 94.37
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 94.36
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 94.35
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.33
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 94.32
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 94.31
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.31
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 94.3
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.29
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 94.29
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.28
PF03180237 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR0048 94.28
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.28
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.26
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 94.26
PF13173128 AAA_14: AAA domain 94.26
PRK06851367 hypothetical protein; Provisional 94.26
COG3842352 PotA ABC-type spermidine/putrescine transport syst 94.26
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 94.24
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 94.24
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 94.23
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 94.23
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.23
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.23
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 94.23
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 94.21
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 94.21
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 94.21
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 94.21
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 94.2
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 94.2
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 94.19
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.19
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 94.19
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 94.19
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 94.18
PRK12289352 GTPase RsgA; Reviewed 94.18
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 94.17
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 94.16
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 94.16
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.15
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 94.15
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 94.14
PRK14241258 phosphate transporter ATP-binding protein; Provisi 94.14
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 94.11
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.11
TIGR03427328 ABC_peri_uca ABC transporter periplasmic binding p 94.09
PRK09183259 transposase/IS protein; Provisional 94.09
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 94.09
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.07
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 94.06
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 94.06
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 94.05
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 94.05
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 94.05
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 94.05
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.03
TIGR00101199 ureG urease accessory protein UreG. This model rep 94.03
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 94.03
PRK14239252 phosphate transporter ATP-binding protein; Provisi 94.03
PRK08084235 DNA replication initiation factor; Provisional 94.01
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 94.01
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 94.01
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 93.99
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 93.98
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 93.98
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.98
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 93.98
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.97
PRK10790592 putative multidrug transporter membrane\ATP-bindin 93.97
PRK14240250 phosphate transporter ATP-binding protein; Provisi 93.97
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 93.97
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 93.96
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 93.96
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.96
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 93.95
PRK12288347 GTPase RsgA; Reviewed 93.95
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.94
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 93.94
PRK14235267 phosphate transporter ATP-binding protein; Provisi 93.94
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 93.93
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 93.92
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 93.91
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 93.9
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.89
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 93.89
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.89
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 93.89
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.88
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 93.87
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 93.86
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 93.85
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 93.85
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.84
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 93.84
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 93.84
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.83
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 93.81
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 93.81
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 93.81
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 93.81
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 93.81
PRK10522547 multidrug transporter membrane component/ATP-bindi 93.8
cd03116159 MobB Molybdenum is an essential trace element in t 93.8
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 93.8
PRK14237267 phosphate transporter ATP-binding protein; Provisi 93.79
cd03112158 CobW_like The function of this protein family is u 93.79
PRK00093435 GTP-binding protein Der; Reviewed 93.79
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 93.78
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 93.77
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 93.77
KOG1970|consensus634 93.77
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 93.77
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 93.76
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 93.76
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 93.76
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 93.75
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 93.75
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 93.73
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 93.71
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 93.7
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 93.7
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.7
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 93.69
PRK14238271 phosphate transporter ATP-binding protein; Provisi 93.68
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 93.68
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 93.66
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 93.63
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 93.63
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 93.61
PRK11153343 metN DL-methionine transporter ATP-binding subunit 93.61
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 93.6
>COG0181 HemC Porphobilinogen deaminase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.3e-104  Score=808.82  Aligned_cols=298  Identities=49%  Similarity=0.762  Sum_probs=292.5

Q ss_pred             ccchHHHHHHHHHHHHHHhhCCCceEEEEeeccCCccccCCcccccCcccccHHHHHHHHHcCCccEEEeeCCCCCCCCC
Q psy11425        371 VEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLP  450 (672)
Q Consensus       371 r~S~LAl~Q~~~v~~~l~~~~p~~~~e~~~i~t~GD~~~~~~l~~~g~kg~F~kele~aLl~~~~D~aVHSlKD~p~~~~  450 (672)
                      |+|+||+|||++|+++|++.||+++|||++|+|+||+++|+||+++||||+||||||+||++|+||+|||||||||+++|
T Consensus         9 R~S~LAl~Qa~~V~~~L~~~~p~~~~ei~~i~T~GD~i~d~pL~~iGgkGlFtkEle~all~g~~DiAVHSlKDvP~~~p   88 (307)
T COG0181           9 RGSKLALAQANEVIERLKAAYPDLEVEIVTIKTKGDRILDKPLSKIGGKGLFTKELEQALLEGEIDIAVHSLKDVPTELP   88 (307)
T ss_pred             CCCHHHHHHHHHHHHHHHHhCCCceEEEEEEecccchhccchHHHcCCcEEEHHHHHHHHHcCCCCEEEeecccCCccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEecCCCCCCceEEecCCCCCcCCCCCCeeecCcHHHHHHHHHhCCCCeEEcccCCHHHHHhhhcCCCCCEeehh
Q psy11425        451 SGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILA  530 (672)
Q Consensus       451 ~gl~i~a~~~R~d~~D~lv~~~~~~~~~lp~~~~iGTsS~RR~~ql~~~~p~~~~~~iRGNv~tRl~kl~~g~~daiilA  530 (672)
                      +||.|+||++|+||||+||+++|.+|++||+||+|||||+||++||+++|||++|++|||||||||+||++|+|||||||
T Consensus        89 ~gL~laai~~R~dprDalVs~~~~~l~~LP~Ga~VGTSSlRR~aql~~~rPdl~i~~lRGNVdTRL~KL~~g~yDAIILA  168 (307)
T COG0181          89 EGLVLAAIPEREDPRDALVSRDGYDLEELPEGAVVGTSSLRRQAQLKALRPDLKIEPLRGNVDTRLRKLDEGEYDAIILA  168 (307)
T ss_pred             CCceEEEecCCCChhheEEECCCCchhhCCCCCccccchHHHHHHHHHhCCCCeEEeccCcHHHHHHHhhcCCccHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhHhhcCCCCceeeecCCCCCCCCCCCceEEEEEecCcHHHHHHhhccCChhhHHhHHHHHHHHHHhcCCCCccceeEE
Q psy11425        531 AAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFA  610 (672)
Q Consensus       531 ~Agl~Rl~~~~~~~~~l~~~~~~pa~gQGalave~r~~d~~~~~~l~~i~~~~t~~~~~aER~~l~~l~ggC~~pig~~a  610 (672)
                      +|||+|||++++++++|+|+.|+|||||||||||||.+|.++.++|+.|||++|+.|+.|||+||+.|+|||++|||+||
T Consensus       169 ~AGL~RLgl~~~~~~~l~p~~~~PA~gQGal~ie~R~~d~~~~~ll~~i~~~~t~~~v~aERa~l~~L~ggC~~PIg~~a  248 (307)
T COG0181         169 AAGLKRLGLENRITEILDPEEFLPAPGQGALAIECRAGDEKVLELLAELNDEDTRICVTAERAFLRELEGGCQVPIGAYA  248 (307)
T ss_pred             HHHHHhcCCcccceeecChhhcCCCCCCceEEEEEecCcHHHHHHHHhccCchHHHHHHHHHHHHHhhCCCCCCceEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeccCCCeEEEEEEEEcCCCcEEEEEEEecCCCcHHHHHHHHHHHHHHhhHHHHHHHHh
Q psy11425        611 MVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYE  670 (672)
Q Consensus       611 ~~~~~~~~~~~l~~~~~~~dg~~~~~~~~~~~~~~~~~lg~~~a~~l~~~g~~~~l~~~~  670 (672)
                      ++.  .+++++|+|.|+++||++.++.+..|+.++++++|.++|++|+++|+.+++..++
T Consensus       249 ~~~--~~~~l~l~~~v~~~DG~~~~~~~~~g~~~~a~~lG~~~a~~l~~~ga~e~l~~~~  306 (307)
T COG0181         249 ELT--GGGELRLRALVGSPDGSQIIKAEIRGDAEDAEELGKELAEELLEKGAKEILEGVR  306 (307)
T ss_pred             EEc--CCCeEEEEEEEECCCCceeEEEEeecchhhHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            993  3349999999999999999999999999999999999999999999999998764

>TIGR00212 hemC porphobilinogen deaminase Back     alignment and domain information
>cd00494 HMBS Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12 Back     alignment and domain information
>PLN02691 porphobilinogen deaminase Back     alignment and domain information
>PRK00072 hemC porphobilinogen deaminase; Reviewed Back     alignment and domain information
>KOG2892|consensus Back     alignment and domain information
>PF01379 Porphobil_deam: Porphobilinogen deaminase, dipyromethane cofactor binding domain; InterPro: IPR022417 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK01066 porphobilinogen deaminase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>PRK10778 dksA RNA polymerase-binding transcription factor; Provisional Back     alignment and domain information
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02420 dksA RNA polymerase-binding protein DksA Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR02890 spore_yteA sporulation protein, yteA family Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF03900 Porphobil_deamC: Porphobilinogen deaminase, C-terminal domain; InterPro: IPR022418 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>TIGR00690 rpoZ DNA-directed RNA polymerase, omega subunit Back     alignment and domain information
>PHA00080 DksA-like zinc finger domain containing protein Back     alignment and domain information
>PRK00392 rpoZ DNA-directed RNA polymerase subunit omega; Reviewed Back     alignment and domain information
>TIGR02419 C4_traR_proteo phage/conjugal plasmid C-4 type zinc finger protein, TraR family Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>PRK13715 conjugal transfer protein TraR; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK11019 hypothetical protein; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1758 RpoZ DNA-directed RNA polymerase, subunit K/omega [Transcription] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01192 RNA_pol_Rpb6: RNA polymerase Rpb6 ; InterPro: IPR006110 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2 Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>KOG3220|consensus Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PF01258 zf-dskA_traR: Prokaryotic dksA/traR C4-type zinc finger; InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01099 rpoK DNA-directed RNA polymerase subunit K; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>KOG3877|consensus Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1384|consensus Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01223 Pmev_kin_anim phosphomevalonate kinase, animal type Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00363 lipoprotein, YaeC family Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG3327|consensus Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3308|consensus Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>KOG0635|consensus Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2702|consensus Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3078|consensus Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF03180 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR004872 This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query672
2ypn_A313 Hydroxymethylbilane Synthase Length = 313 1e-71
1pda_A313 Structure Of Porphobilinogen Deaminase Reveals A Fl 3e-71
1ypn_A313 Reduced Form Hydroxymethylbilane Synthase (K59q Mut 3e-71
1ah5_A313 Reduced Form Selenomethionine-Labelled Hydroxymethy 4e-70
3ecr_A364 Structure Of Human Porphobilinogen Deaminase Length 1e-47
3eq1_A361 The Crystal Structure Of Human Porphobilinogen Deam 3e-47
4htg_A320 Porphobilinogen Deaminase From Arabidopsis Thaliana 4e-47
3tr0_A205 Structure Of Guanylate Kinase (Gmk) From Coxiella B 3e-46
2an9_A207 Crystal Structure Of Oligomeric E.Coli Guanylate Ki 6e-46
1s96_A219 The 2.0 A X-Ray Structure Of Guanylate Kinase From 8e-44
1s4q_A228 Crystal Structure Of Guanylate Kinase From Mycobact 3e-36
1z8f_A228 Guanylate Kinase Double Mutant A58c, T157c From Myc 5e-36
1znw_A207 Crystal Structure Of Unliganded Form Of Mycobacteri 1e-33
2j41_A207 Crystal Structure Of Staphylococcus Aureus Guanylat 2e-33
3lnc_A231 Crystal Structure Of Guanylate Kinase From Anaplasm 4e-33
1gky_A187 Refined Structure Of The Complex Between Guanylate 2e-31
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 2e-31
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 1e-30
3tau_A208 Crystal Structure Of A Putative Guanylate Monophosp 6e-28
1lvg_A198 Crystal Structure Of Mouse Guanylate Kinase In Comp 6e-28
2qor_A204 Crystal Structure Of Plasmodium Vivax Guanylate Kin 2e-22
1z6g_A218 Crystal Structure Of Guanylate Kinase From Plasmodi 2e-20
1tjl_A151 Crystal Structure Of Transcription Factor Dksa From 9e-20
4ijj_A136 Structure Of Transcription Factor Dksa2 From Pseudo 3e-18
3ney_A197 Crystal Structure Of The Kinase Domain Of Mpp1P55 L 5e-12
3lu0_E91 Molecular Model Of Escherichia Coli Core Rna Polyme 6e-10
3iyd_E90 Three-Dimensional Em Structure Of An Intact Activat 3e-09
1kgd_A180 Crystal Structure Of The Guanylate Kinase-Like Doma 5e-09
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 1e-05
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-05
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 1e-05
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 5e-05
3tvt_A292 Structural Basis For Discs Large Interaction With P 8e-05
>pdb|2YPN|A Chain A, Hydroxymethylbilane Synthase Length = 313 Back     alignment and structure 
Iteration: 1

 Score =  267 bits (683), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 188/292 (64%), Gaps = 3/292 (1%)
Query: 375 LAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGK 434
           LA+WQA YV+ K++  +P   VE++ + T+GD I +    K+  KGLF KELE+A+++ +
Sbjct: 15  LALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILDTPLAKVGGKGLFVKELEVALLENR 74
Query: 435 ADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKV 494
           AD+AVHS+KD+P+  P G  L  I +REDPRDAF+SN+Y SL  LP  ++VGT+SLRR+ 
Sbjct: 75  ADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGSIVGTSSLRRQC 134
Query: 495 LIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQILP 554
            +    P LII+SLRGN+ TRL+KLD GEY AIILA AGLKRL L+ RIR    P   LP
Sbjct: 135 QLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRIRAALPPEISLP 194
Query: 555 APGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMVNN 614
           A GQGA+ IE   +     E+L  LNH+ +   V AERA++    G C++ + ++A    
Sbjct: 195 AVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQVPIGSYA---E 251
Query: 615 FNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEII 666
             + EI LRA++  P+G +II  E  G     E +G+  AE L   GA EI+
Sbjct: 252 LIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNGAREIL 303
>pdb|1PDA|A Chain A, Structure Of Porphobilinogen Deaminase Reveals A Flexible Multidomain Polymerase With A Single Catalytic Site Length = 313 Back     alignment and structure
>pdb|1YPN|A Chain A, Reduced Form Hydroxymethylbilane Synthase (K59q Mutant) Crystal Structure After 2 Hours In A Flow Cell Determined By Time-Resolved Laue Diffraction Length = 313 Back     alignment and structure
>pdb|1AH5|A Chain A, Reduced Form Selenomethionine-Labelled Hydroxymethylbilane Synthase Determined By Mad Length = 313 Back     alignment and structure
>pdb|3ECR|A Chain A, Structure Of Human Porphobilinogen Deaminase Length = 364 Back     alignment and structure
>pdb|3EQ1|A Chain A, The Crystal Structure Of Human Porphobilinogen Deaminase At 2.8a Resolution Length = 361 Back     alignment and structure
>pdb|4HTG|A Chain A, Porphobilinogen Deaminase From Arabidopsis Thaliana Length = 320 Back     alignment and structure
>pdb|3TR0|A Chain A, Structure Of Guanylate Kinase (Gmk) From Coxiella Burnetii Length = 205 Back     alignment and structure
>pdb|2AN9|A Chain A, Crystal Structure Of Oligomeric E.Coli Guanylate Kinase In Complex With Gdp Length = 207 Back     alignment and structure
>pdb|1S96|A Chain A, The 2.0 A X-Ray Structure Of Guanylate Kinase From E.Coli Length = 219 Back     alignment and structure
>pdb|1S4Q|A Chain A, Crystal Structure Of Guanylate Kinase From Mycobacterium Tuberculosis (Rv1389) Length = 228 Back     alignment and structure
>pdb|1Z8F|A Chain A, Guanylate Kinase Double Mutant A58c, T157c From Mycobacterium Tuberculosis (Rv1389) Length = 228 Back     alignment and structure
>pdb|1ZNW|A Chain A, Crystal Structure Of Unliganded Form Of Mycobacterium Tuberculosis Guanylate Kinase Length = 207 Back     alignment and structure
>pdb|2J41|A Chain A, Crystal Structure Of Staphylococcus Aureus Guanylate Monophosphate Kinase Length = 207 Back     alignment and structure
>pdb|3LNC|A Chain A, Crystal Structure Of Guanylate Kinase From Anaplasma Phagocytophilum Length = 231 Back     alignment and structure
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure
>pdb|3TAU|A Chain A, Crystal Structure Of A Putative Guanylate Monophosphaste Kinase From Listeria Monocytogenes Egd-E Length = 208 Back     alignment and structure
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure
>pdb|2QOR|A Chain A, Crystal Structure Of Plasmodium Vivax Guanylate Kinase Length = 204 Back     alignment and structure
>pdb|1Z6G|A Chain A, Crystal Structure Of Guanylate Kinase From Plasmodium Falciparum Length = 218 Back     alignment and structure
>pdb|1TJL|A Chain A, Crystal Structure Of Transcription Factor Dksa From E. Coli Length = 151 Back     alignment and structure
>pdb|4IJJ|A Chain A, Structure Of Transcription Factor Dksa2 From Pseudomonas Aeruginosa Length = 136 Back     alignment and structure
>pdb|3NEY|A Chain A, Crystal Structure Of The Kinase Domain Of Mpp1P55 Length = 197 Back     alignment and structure
>pdb|3LU0|E Chain E, Molecular Model Of Escherichia Coli Core Rna Polymerase Length = 91 Back     alignment and structure
>pdb|3IYD|E Chain E, Three-Dimensional Em Structure Of An Intact Activator-Dependent Transcription Initiation Complex Length = 90 Back     alignment and structure
>pdb|1KGD|A Chain A, Crystal Structure Of The Guanylate Kinase-Like Domain Of Human Cask Length = 180 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query672
1gtk_A313 Porphobilinogen deaminase; lyase, biosynthesis of 1e-139
3ecr_A364 Porphobilinogen deaminase; heme biosynthesis, porp 1e-126
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 5e-94
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 1e-92
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 2e-92
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 3e-92
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 6e-92
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 2e-91
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 2e-89
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 6e-85
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 7e-85
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 4e-84
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 2e-74
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 1e-71
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 9e-59
1kjw_A295 Postsynaptic density protein 95; protein-protein i 1e-56
1tjl_A151 DNAK suppressor protein; DKSA, transcription facto 3e-35
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-30
2kq9_A112 DNAK suppressor protein; zinc binding protein, str 5e-29
3lu0_E91 DNA-directed RNA polymerase subunit omega; E. coli 4e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-18
4dey_A337 Voltage-dependent L-type calcium channel subunit; 6e-18
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-08
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-08
3kfv_A308 Tight junction protein ZO-3; structural genomics c 7e-08
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-04
2kgo_A108 Uncharacterized protein YBII; Zn finger, partially 1e-04
>1gtk_A Porphobilinogen deaminase; lyase, biosynthesis of linear tetrapyrrole, all alpha/beta; HET: DPM; 1.66A {Escherichia coli} SCOP: c.94.1.1 d.50.2.1 PDB: 1ah5_A* 2ypn_A* 1ypn_A* 1pda_A* Length = 313 Back     alignment and structure
 Score =  408 bits (1051), Expect = e-139
 Identities = 138/295 (46%), Positives = 191/295 (64%), Gaps = 5/295 (1%)

Query: 374 RLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPL-KINEKGLFTKELEMAIIK 432
            LA+WQA YV+ K++  +P   VE++ + T+GD I +  PL K+  KGLF KELE+A+++
Sbjct: 14  PLALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILD-TPLAKVGGKGLFVKELEVALLE 72

Query: 433 GKADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRR 492
            +AD+AVHS+KD+P+  P G  L  I +REDPRDAF+SN+Y SL  LP  ++VGT+SLRR
Sbjct: 73  NRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGSIVGTSSLRR 132

Query: 493 KVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQI 552
           +  +    P LII+SLRGN+ TRL+KLD GEY AIILA AGLKRL L+ RIR    P   
Sbjct: 133 QCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRIRAALPPEIS 192

Query: 553 LPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFAMV 612
           LPA GQGA+ IE   +     E+L  LNH+ +   V AERA++    G C++ + ++A +
Sbjct: 193 LPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQVPIGSYAEL 252

Query: 613 NNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIK 667
            +    EI LRA++  P+G +II  E  G     E +G+  AE L   GA EI+ 
Sbjct: 253 ID---GEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNGAREILA 304
>3ecr_A Porphobilinogen deaminase; heme biosynthesis, porphobilinogen hinge, alternative splicing, cytoplasm, disease mutation, porphyrin biosynthesis; HET: DPM; 2.18A {Homo sapiens} PDB: 3eq1_A* Length = 364 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>1tjl_A DNAK suppressor protein; DKSA, transcription factor, RNA polymerase, stringent response, PPGPP, riken structural genomics/proteomics initiative; 2.00A {Escherichia coli} SCOP: a.2.14.1 g.39.1.13 PDB: 3h3p_S Length = 151 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2kq9_A DNAK suppressor protein; zinc binding protein, structural genomics, PSI-2, protein ST initiative; NMR {Agrobacterium tumefaciens str} Length = 112 Back     alignment and structure
>3lu0_E DNA-directed RNA polymerase subunit omega; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_E* Length = 91 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2kgo_A Uncharacterized protein YBII; Zn finger, partially disordered, structural proteomics, META binding, zinc-finger, structural genomics; NMR {Escherichia coli} Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query672
1gtk_A313 Porphobilinogen deaminase; lyase, biosynthesis of 100.0
3ecr_A364 Porphobilinogen deaminase; heme biosynthesis, porp 100.0
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 100.0
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 99.98
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.97
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.97
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.96
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.96
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.96
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.95
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.94
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.92
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.92
1tjl_A151 DNAK suppressor protein; DKSA, transcription facto 99.92
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.92
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.88
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.88
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.88
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.84
2kq9_A112 DNAK suppressor protein; zinc binding protein, str 99.83
3kfv_A308 Tight junction protein ZO-3; structural genomics c 99.8
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.69
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.63
2kgo_A108 Uncharacterized protein YBII; Zn finger, partially 99.61
3lu0_E91 DNA-directed RNA polymerase subunit omega; E. coli 99.6
2a6h_E99 RNA polymerase omega chain; RNA polymerase holoenz 99.58
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.4
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.34
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.25
3tlx_A243 Adenylate kinase 2; structural genomics, structura 99.23
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.21
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 99.2
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.2
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.19
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 99.18
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.18
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.14
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.13
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 99.13
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.12
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.11
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.11
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.1
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 99.09
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.06
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.04
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 99.03
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 99.03
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 99.01
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 99.01
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 99.0
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.0
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 99.0
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 98.98
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.98
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.98
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.97
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.97
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.97
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.96
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.92
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.91
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 98.9
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 98.89
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.89
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.89
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.87
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.86
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 98.85
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.85
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 98.84
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 98.81
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 98.8
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 98.8
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.8
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.79
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 98.78
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.77
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 98.77
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.76
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.74
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.74
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.73
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.72
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 98.69
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 98.68
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.66
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 98.65
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.65
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.63
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.62
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 98.6
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.59
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 98.59
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 98.58
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 98.58
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.57
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.57
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 98.57
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.56
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.56
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.54
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.5
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 98.5
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.5
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.48
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.43
1via_A175 Shikimate kinase; structural genomics, transferase 98.39
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.37
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.37
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.37
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.37
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 98.37
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 98.35
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.31
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 98.3
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.28
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.27
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.26
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.25
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.25
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.2
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 98.18
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.17
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.16
3r20_A233 Cytidylate kinase; structural genomics, seattle st 98.16
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 98.15
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 98.14
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 98.14
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.14
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 98.1
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 98.09
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.0
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.9
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.87
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.86
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.81
3h0g_F142 DNA-directed RNA polymerases I, II, and III subuni 97.75
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.75
1qkl_A127 RPB6, DNA-directed RNA polymerase II 14.4 KD polyp 97.73
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.6
1twf_F155 ABC23, DNA-directed RNA polymerases I, II, and III 97.59
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.12
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.07
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.61
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.56
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.37
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.89
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.8
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 95.65
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.61
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.6
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.46
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.42
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.36
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 95.33
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.32
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.29
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.25
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 95.19
1b0u_A262 Histidine permease; ABC transporter, transport pro 95.18
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 95.16
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.16
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 95.16
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 95.15
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.1
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.08
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 95.08
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 95.04
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.02
1g6h_A257 High-affinity branched-chain amino acid transport 95.02
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.01
2ghi_A260 Transport protein; multidrug resistance protein, M 94.99
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.99
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.97
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.97
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.96
3kzg_A237 Arginine 3RD transport system periplasmic binding 94.95
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.95
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.9
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.88
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.81
3czq_A304 Putative polyphosphate kinase 2; structural genomi 94.81
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 94.8
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.77
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 94.76
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.74
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.71
3del_B242 Arginine binding protein; alpha and beta protein ( 94.56
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 94.56
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.55
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.55
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.53
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.45
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 94.45
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.44
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 94.44
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.4
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.37
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 94.33
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.32
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 94.31
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.28
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.27
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 94.26
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.21
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 94.2
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 94.19
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 94.17
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 94.16
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.11
3bos_A242 Putative DNA replication factor; P-loop containing 94.1
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.04
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 94.02
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.98
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.92
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.9
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 93.89
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 93.87
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.86
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 93.86
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; peripl 93.85
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 93.85
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 93.8
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.8
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 93.77
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.74
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.72
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 93.72
2og2_A359 Putative signal recognition particle receptor; nuc 93.7
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 93.68
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 93.65
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 93.61
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 93.57
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 93.56
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.54
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.54
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 93.53
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.48
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 93.48
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.47
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.43
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 93.41
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.4
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.36
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 93.35
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.35
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 93.35
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 93.34
3kta_A182 Chromosome segregation protein SMC; structural mai 93.31
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 93.31
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.3
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 93.29
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.28
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.26
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.26
2ged_A193 SR-beta, signal recognition particle receptor beta 93.25
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 93.23
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.22
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 93.22
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 93.21
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 93.2
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 93.19
3qax_A268 Probable ABC transporter arginine-binding protein; 93.16
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 93.15
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 93.14
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 93.09
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.04
1p99_A295 Hypothetical protein PG110; structural genomics, P 93.02
1p9r_A418 General secretion pathway protein E; bacterial typ 93.0
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.0
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.98
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 92.97
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 92.95
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.94
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 92.87
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 92.8
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.8
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.71
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 92.68
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.67
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.61
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 92.6
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 92.6
4ef1_A246 Pheromone COB1/lipoprotein, YAEC family; periplasm 92.58
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.58
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.57
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 92.52
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.52
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.49
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 92.45
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 92.42
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 92.41
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.4
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.38
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 92.37
2yln_A283 Putative ABC transporter, periplasmic binding Pro 92.35
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.33
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.3
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 92.27
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.16
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 92.16
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.14
3tql_A227 Arginine-binding protein; transport and binding pr 92.13
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 92.1
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 92.09
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 92.09
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.09
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 92.08
3k4u_A245 Binding component of ABC transporter; structural g 92.06
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 92.06
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.05
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 92.04
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 92.01
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.99
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.93
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 91.93
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 91.93
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 91.91
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 91.9
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 91.9
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.89
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 91.88
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.82
3lxx_A239 GTPase IMAP family member 4; structural genomics c 91.73
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 91.73
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 91.67
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.66
1jal_A363 YCHF protein; nucleotide-binding fold, structural 91.61
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 91.59
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 91.59
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 91.57
1nrj_B218 SR-beta, signal recognition particle receptor beta 91.55
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 91.55
2r62_A268 Cell division protease FTSH homolog; ATPase domain 91.54
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 91.51
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 91.5
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.46
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.44
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.42
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 91.41
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 91.39
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 91.39
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 91.38
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 91.37
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 91.34
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 91.33
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.33
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 91.32
1tue_A212 Replication protein E1; helicase, replication, E1E 91.32
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 91.31
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 91.28
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 91.28
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.27
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.22
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 91.21
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 91.15
1u94_A356 RECA protein, recombinase A; homologous recombinat 91.11
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 91.1
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 91.07
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 91.05
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 91.04
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L 91.03
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 91.03
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 91.01
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 90.98
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 90.97
2v1u_A387 Cell division control protein 6 homolog; DNA repli 90.96
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 90.96
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.95
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 90.93
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 90.89
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 90.88
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 90.86
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 90.86
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 90.84
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 90.81
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 90.8
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 90.8
3co5_A143 Putative two-component system transcriptional RES 90.78
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 90.77
4ayb_K95 DNA-directed RNA polymerase; transferase, multi-su 90.77
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.76
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 90.74
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 90.73
3t1o_A198 Gliding protein MGLA; G domain containing protein, 90.73
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 90.72
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 90.71
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 90.7
3lxw_A247 GTPase IMAP family member 1; immunity, structural 90.7
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 90.66
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 90.66
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 90.62
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 90.61
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 90.56
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 90.56
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 90.56
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 90.53
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.5
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 90.5
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 90.49
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 90.49
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 90.48
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 90.48
3cnl_A262 YLQF, putative uncharacterized protein; circular p 90.45
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 90.44
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 90.44
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 90.41
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 90.41
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 90.4
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.38
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 90.35
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.32
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 90.32
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 90.31
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 90.29
2qgz_A308 Helicase loader, putative primosome component; str 90.25
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 90.19
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 90.18
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 90.18
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 90.13
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 90.11
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 90.11
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 90.09
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 90.07
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 90.06
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 90.05
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 90.04
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 90.03
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 90.01
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 89.98
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 89.93
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 89.89
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 89.88
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 89.87
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 89.86
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 89.81
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.81
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 89.81
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 89.8
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.8
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 89.79
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 89.78
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 89.77
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 89.74
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 89.74
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 89.7
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 89.69
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 89.68
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 89.68
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 89.65
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 89.64
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 89.61
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 89.6
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 89.59
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.57
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 89.56
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 89.54
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 89.53
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 89.52
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 89.5
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 89.49
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 89.48
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 89.48
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 89.47
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 89.45
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 89.43
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 89.43
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 89.42
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 89.42
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.4
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 89.4
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 89.39
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 89.37
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 89.35
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 89.33
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 89.32
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 89.3
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 89.3
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 89.27
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 89.25
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 89.2
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 89.18
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 89.17
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 89.14
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 89.13
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 89.12
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 89.11
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 89.11
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 89.1
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 89.03
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 89.01
3pvs_A447 Replication-associated recombination protein A; ma 89.0
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 88.99
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 88.97
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 88.95
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 88.91
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 88.91
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 88.88
>1gtk_A Porphobilinogen deaminase; lyase, biosynthesis of linear tetrapyrrole, all alpha/beta; HET: DPM; 1.66A {Escherichia coli} SCOP: c.94.1.1 d.50.2.1 PDB: 1ah5_A* 2ypn_A* 1ypn_A* 1pda_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-104  Score=822.14  Aligned_cols=297  Identities=46%  Similarity=0.731  Sum_probs=276.4

Q ss_pred             ccchHHHHHHHHHHHHHHhhCCCceEEEEeeccCCccccCCcccccCcccccHHHHHHHHHcCCccEEEeeCCCCCCCCC
Q psy11425        371 VEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLP  450 (672)
Q Consensus       371 r~S~LAl~Q~~~v~~~l~~~~p~~~~e~~~i~t~GD~~~~~~l~~~g~kg~F~kele~aLl~~~~D~aVHSlKD~p~~~~  450 (672)
                      |+|+||+|||++|+++|++.||+++|||++|+|+||+++++||++|||||+||||||+||++|+||||||||||||+++|
T Consensus        11 R~S~LAl~Qa~~V~~~L~~~~p~~~~ei~~i~T~GD~i~d~pL~~iGgkGlFtkELe~aLl~g~iDiAVHSlKDvPt~lp   90 (313)
T 1gtk_A           11 RQSPLALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILDTPLAKVGGKGLFVKELEVALLENRADIAVHSMKDVPVEFP   90 (313)
T ss_dssp             CCSHHHHHHHHHHHHHHHHHCTTCEEEEEECC-----------------CTTHHHHHHHHHTTSCSEEEEEGGGSCSCCC
T ss_pred             CCCHHHHHHHHHHHHHHHHhCCCCcEEEEeeecCCcccccccHHHcCCccchHHHHHHHHHcCCCcEEEecCCCCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEecCCCCCCceEEecCCCCCcCCCCCCeeecCcHHHHHHHHHhCCCCeEEcccCCHHHHHhhhcCCCCCEeehh
Q psy11425        451 SGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILA  530 (672)
Q Consensus       451 ~gl~i~a~~~R~d~~D~lv~~~~~~~~~lp~~~~iGTsS~RR~~ql~~~~p~~~~~~iRGNv~tRl~kl~~g~~daiilA  530 (672)
                      +||.|+||++|+|||||||++++.++.+||+|++|||||+||++||+++|||++|++|||||+|||+||++|+|||||||
T Consensus        91 ~gl~l~av~~RedprDalV~~~~~~l~~LP~Ga~VGTSSlRR~aQL~~~rPdl~i~~lRGNV~TRL~KL~~g~~DaiiLA  170 (313)
T 1gtk_A           91 QGLGLVTICEREDPRDAFVSNNYDSLDALPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILA  170 (313)
T ss_dssp             TTEEEEEECCCCCCCEEEECSSCSSGGGCCTTCEEECCCHHHHHHHHHHCTTSEEECCCSCHHHHHHHHHTTSCSEEEEE
T ss_pred             CCcEEEEEecCCCcceEEEECCCCChhhCCCCCEEecCCHHHHHHHHHHCCCCEEEeCCCCHHHHHHHhhCCCCCEEEHh
Confidence            99999999999999999999998899999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhHhhcCCCCceeeecCCCCCCCCCCCceEEEEEecCcHHHHHHhhccCChhhHHhHHHHHHHHHHhcCCCCccceeEE
Q psy11425        531 AAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPLNHYFSEQTVKAERAVSRNFNGSCKISLAAFA  610 (672)
Q Consensus       531 ~Agl~Rl~~~~~~~~~l~~~~~~pa~gQGalave~r~~d~~~~~~l~~i~~~~t~~~~~aER~~l~~l~ggC~~pig~~a  610 (672)
                      +|||+|||+.++++++|+++.|+|||||||||||||++|.++.++|+.|||++|+.++.|||+||+.|+|||++|||+||
T Consensus       171 ~AGL~RLgl~~~i~~~l~~~~~lPA~gQGalaIe~r~~d~~~~~ll~~l~d~~t~~~~~aERa~l~~L~GgC~~Piga~a  250 (313)
T 1gtk_A          171 VAGLKRLGLESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQVPIGSYA  250 (313)
T ss_dssp             HHHHHHTTCGGGCSEECCTTTSCCCTTTTCEEEEEETTCHHHHHHHGGGCCHHHHHHHHHHHHHHHHHTCCTTSCEEEEE
T ss_pred             hhHHHHcCCccccceeeChhhcCCCcCCceEEEEEccCcHHHHHHHHHCCCHHHHHHHHHHHHHHHHhCCCCcCcceeeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeccCCCeEEEEEEEEcCCCcEEEEEEEecCCCcHHHHHHHHHHHHHHhhHHHHHHHHh
Q psy11425        611 MVNNFNESEINLRAIITNPNGLKIITAEVNGPIDTPETVGLYAAELLKKKGAIEIIKSYE  670 (672)
Q Consensus       611 ~~~~~~~~~~~l~~~~~~~dg~~~~~~~~~~~~~~~~~lg~~~a~~l~~~g~~~~l~~~~  670 (672)
                      ++   +|++++|+|.|+++||++.++.+..|+.++|+++|..+|++|+++|+++||.+++
T Consensus       251 ~~---~~~~l~l~g~v~s~dG~~~~~~~~~g~~~~a~~lG~~la~~ll~~ga~~il~~~~  307 (313)
T 1gtk_A          251 EL---IDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNGAREILAEVY  307 (313)
T ss_dssp             EE---ETTEEEEEEEEECTTSSCEEEEEEEECGGGHHHHHHHHHHHHHHTTHHHHHHTTT
T ss_pred             EE---ECCEEEEEEEEEcCCCCEEEEEEEEcCHHHHHHHHHHHHHHHHHcCHHHHHHHHH
Confidence            99   7899999999999999999999999999999999999999999999999998864
>3ecr_A Porphobilinogen deaminase; heme biosynthesis, porphobilinogen hinge, alternative splicing, cytoplasm, disease mutation, porphyrin biosynthesis; HET: DPM; 2.18A {Homo sapiens} PDB: 3eq1_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1tjl_A DNAK suppressor protein; DKSA, transcription factor, RNA polymerase, stringent response, PPGPP, riken structural genomics/proteomics initiative; 2.00A {Escherichia coli} SCOP: a.2.14.1 g.39.1.13 PDB: 3h3p_S Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2kq9_A DNAK suppressor protein; zinc binding protein, structural genomics, PSI-2, protein ST initiative; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2kgo_A Uncharacterized protein YBII; Zn finger, partially disordered, structural proteomics, META binding, zinc-finger, structural genomics; NMR {Escherichia coli} Back     alignment and structure
>3lu0_E DNA-directed RNA polymerase subunit omega; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_E* Back     alignment and structure
>2a6h_E RNA polymerase omega chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.143.1.1 PDB: 1smy_E* 1zyr_E* 1iw7_E* 2a69_E* 2a6e_E 2a68_E* 2be5_E* 2cw0_E 3dxj_E* 2o5i_E 2o5j_E* 2ppb_E* 3aoh_E* 3aoi_E* 3eql_E* 1ynj_K* 1i6v_E* 1l9u_E 1l9z_E 1hqm_E* ... Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3h0g_F DNA-directed RNA polymerases I, II, and III subunit rpabc2; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qkl_A RPB6, DNA-directed RNA polymerase II 14.4 KD polypeptide; transcription; NMR {Homo sapiens} SCOP: a.143.1.2 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1twf_F ABC23, DNA-directed RNA polymerases I, II, and III 23 KD polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: a.143.1.2 PDB: 1i3q_F 1i6h_F 1k83_F* 1nik_F 1nt9_F 1pqv_F 1r5u_F 1r9s_F* 1r9t_F* 1sfo_F* 1twa_F* 1twc_F* 1i50_F* 1twg_F* 1twh_F* 1wcm_F 1y1v_F 1y1w_F 1y1y_F 1y77_F* ... Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} SCOP: c.94.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>4ef1_A Pheromone COB1/lipoprotein, YAEC family; periplasmic methionine binding protein, NLPA lipoprotein, ST genomics; 1.90A {Enterococcus faecalis} PDB: 4ef2_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>4ayb_K DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_I 4b1o_K 4b1p_I 2waq_K 2wb1_I 2pmz_K 3hkz_K Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 672
d1pdaa1217 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydr 5e-55
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 1e-42
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 3e-34
d1znwa1182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 8e-34
d1gkya_186 c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Sac 4e-33
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 2e-31
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 8e-29
d1tjla1104 a.2.14.1 (A:7-110) DnaK suppressor protein DksA, a 6e-20
d1pdaa288 d.50.2.1 (A:220-307) Porphobilinogen deaminase (hy 4e-17
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 2e-12
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 1e-11
d1tjla241 g.39.1.13 (A:111-151) DnaK suppressor protein DksA 2e-11
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 6e-09
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 4e-07
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 4e-04
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 6e-04
>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score =  184 bits (469), Expect = 5e-55
 Identities = 106/206 (51%), Positives = 141/206 (68%)

Query: 374 RLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKG 433
            LA+WQA YV+ K++  +P   VE++ + T+GD I +    K+  KGLF KELE+A+++ 
Sbjct: 12  PLALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILDTPLAKVGGKGLFVKELEVALLEN 71

Query: 434 KADLAVHSLKDIPMNLPSGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRK 493
           +AD+AVHS+KD+P+  P G  L  I +REDPRDAF+SN+Y SL  LP  ++VGT+SLRR+
Sbjct: 72  RADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGSIVGTSSLRRQ 131

Query: 494 VLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILAAAGLKRLNLQKRIRMLFSPNQIL 553
             +    P LII+SLRGN+ TRL+KLD GEY AIILA AGLKRL L+ RIR    P   L
Sbjct: 132 CQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRIRAALPPEISL 191

Query: 554 PAPGQGAIAIEILDNRKELMEMLIPL 579
           PA GQGA+ IE   +     E+L  L
Sbjct: 192 PAVGQGAVGIECRLDDSRTRELLAAL 217
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 186 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure
>d1tjla1 a.2.14.1 (A:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli [TaxId: 562]} Length = 104 Back     information, alignment and structure
>d1pdaa2 d.50.2.1 (A:220-307) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1tjla2 g.39.1.13 (A:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli [TaxId: 562]} Length = 41 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query672
d1pdaa1217 Porphobilinogen deaminase (hydroxymethylbilane syn 100.0
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 100.0
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 100.0
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 100.0
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 100.0
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 100.0
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.97
d1pdaa288 Porphobilinogen deaminase (hydroxymethylbilane syn 99.87
d1tjla241 DnaK suppressor protein DksA, zinc finger domain { 99.4
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.35
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.34
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.34
d1tjla1104 DnaK suppressor protein DksA, alpha-hairpin domain 99.32
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.27
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.26
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.14
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.06
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.05
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 99.0
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.93
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.93
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 98.93
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.85
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.81
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.78
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.76
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.72
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.7
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.7
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.7
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.68
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.66
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.65
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.65
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.62
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.59
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.57
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.53
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.53
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.51
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.5
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 98.48
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.41
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.38
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.32
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.3
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 98.19
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 98.07
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.05
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.98
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.97
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.89
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.85
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.85
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.83
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.64
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.57
d1smye_95 RNA polymerase omega subunit {Thermus thermophilus 97.2
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.18
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.13
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.95
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 96.77
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.55
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.49
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.44
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.39
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.33
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.17
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.08
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 96.04
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.02
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 95.98
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.95
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.86
d1p99a_255 Putative lipoprotein (NlpA family) {Staphylococcus 95.72
d1vmaa2213 GTPase domain of the signal recognition particle r 95.7
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.7
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.58
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.58
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.58
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.56
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.38
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.37
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.29
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.28
d1xs5a_240 Putative lipoprotein (NlpA family) {Treponema pall 95.23
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.2
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.17
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.14
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.08
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.04
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.94
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.93
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.89
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.88
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.84
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.8
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.76
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.72
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.69
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.66
d2qy9a2211 GTPase domain of the signal recognition particle r 94.63
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.62
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.61
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.57
d1okkd2207 GTPase domain of the signal recognition particle r 94.56
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.54
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.5
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.35
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.3
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.27
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.22
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.21
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.19
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.18
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.17
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.17
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.14
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.13
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.09
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.02
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.96
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.9
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.86
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.82
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.82
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.8
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.72
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.69
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.67
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.56
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.48
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.47
d1twff_84 RPB6 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.47
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.33
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.32
d1t0hb_219 Guanylate kinase-like domain of the L-type calcium 93.31
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.23
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.1
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.04
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.91
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.85
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 92.68
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.48
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.48
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.46
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.4
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.29
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 92.08
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.03
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.94
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.9
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.81
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.81
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 91.76
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.69
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.64
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.59
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.27
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.27
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.21
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.13
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.12
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.03
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.88
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.85
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.83
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.82
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.75
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.72
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 90.65
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.65
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.62
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.62
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.58
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.56
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.55
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.53
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.52
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.52
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.45
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.39
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.24
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.19
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.19
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.1
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.06
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.84
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.79
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.78
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.7
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.69
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.68
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 89.6
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.58
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.45
d1qkla_127 RPB6 {Human (Homo sapiens) [TaxId: 9606]} 89.35
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.31
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.31
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.29
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.27
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.15
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 88.98
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.63
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.62
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 88.48
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.29
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 88.25
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 88.22
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 88.19
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.18
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.08
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.04
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 87.98
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 87.94
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.77
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 87.55
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.47
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.46
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.26
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 86.95
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 86.89
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.73
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.65
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 86.48
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 86.41
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 86.3
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.93
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.38
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 85.26
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.25
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 84.64
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 84.3
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 84.1
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 83.63
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 83.6
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 83.58
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 82.47
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.7
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 81.46
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 81.28
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 81.28
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 80.97
d2czla1270 Hypothetical protein TTHA1568 {Thermus thermophilu 80.84
>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.9e-78  Score=598.80  Aligned_cols=209  Identities=51%  Similarity=0.810  Sum_probs=198.0

Q ss_pred             ccchHHHHHHHHHHHHHHhhCCCceEEEEeeccCCccccCCcccccCcccccHHHHHHHHHcCCccEEEeeCCCCCCCCC
Q psy11425        371 VEIRLAIWQAEYVRKKIIELYPWCKVEILGITTKGDKIFEKVPLKINEKGLFTKELEMAIIKGKADLAVHSLKDIPMNLP  450 (672)
Q Consensus       371 r~S~LAl~Q~~~v~~~l~~~~p~~~~e~~~i~t~GD~~~~~~l~~~g~kg~F~kele~aLl~~~~D~aVHSlKD~p~~~~  450 (672)
                      |+|+||+|||++|++.|++.||+++||+++|+|+||++++.||+++||||+||||||++|++|+||+||||+||||+++|
T Consensus         9 R~S~LAl~Qa~~v~~~L~~~~p~~~~ei~~i~T~GD~~~~~~l~~~ggkg~Ftkele~~Ll~~~iDiAVHS~KDlP~~~~   88 (217)
T d1pdaa1           9 RQSPLALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILDTPLAKVGGKGLFVKELEVALLENRADIAVHSMKDVPVEFP   88 (217)
T ss_dssp             CCSHHHHHHHHHHHHHHHHHCTTCEEEEEECCCHHHHC---------CCCTTTHHHHHHHHTTSCSEEEEEGGGSCSCCC
T ss_pred             CCcHHHHHHHHHHHHHHHHhCCCCcEEEEEEeccCCccccccccccchhHHHHHHHHHHHHcCccceehhhhcccccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEecCCCCCCceEEecCCCCCcCCCCCCeeecCcHHHHHHHHHhCCCCeEEcccCCHHHHHhhhcCCCCCEeehh
Q psy11425        451 SGFILCAILKREDPRDAFISNDYISLSTLPKNAVVGTNSLRRKVLIKSFFPSLIIKSLRGNIDTRLNKLDKGEYAAIILA  530 (672)
Q Consensus       451 ~gl~i~a~~~R~d~~D~lv~~~~~~~~~lp~~~~iGTsS~RR~~ql~~~~p~~~~~~iRGNv~tRl~kl~~g~~daiilA  530 (672)
                      +||.|+|+++|+||||+||++++.++++||+|++|||||+||++||+++|||++|++|||||+|||+||.+|+|||||||
T Consensus        89 ~~l~i~a~~~R~d~rD~li~~~~~~l~~l~~~~~IGTsS~RR~aql~~~~p~l~~~~iRGNv~TRl~Kl~~g~~DaiILA  168 (217)
T d1pdaa1          89 QGLGLVTICEREDPRDAFVSNNYDSLDALPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILA  168 (217)
T ss_dssp             TTEEEEEECCCCCCCEEEECSSCSSTTTSCTTCEEECCCHHHHHHHHHHCTTSEEECCCSCHHHHHHHHHTTSCSEEEEE
T ss_pred             CccccccccccCCcchhccccCcCCHhhCCCCCEecccchhHHHHHHHhCCCCceeecccchhhHHHHhhccCcCEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhHhhcCCCCceeeecCCCCCCCCCCCceEEEEEecCcHHHHHHhhcc
Q psy11425        531 AAGLKRLNLQKRIRMLFSPNQILPAPGQGAIAIEILDNRKELMEMLIPL  579 (672)
Q Consensus       531 ~Agl~Rl~~~~~~~~~l~~~~~~pa~gQGalave~r~~d~~~~~~l~~i  579 (672)
                      +|||+|||+.++++++|+++.|+||||||+||||||++|.++.++|++|
T Consensus       169 ~AGL~RL~l~~~i~~~l~~~~~~PA~gQGaiaIe~r~~d~~~~~il~~i  217 (217)
T d1pdaa1         169 VAGLKRLGLESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAAL  217 (217)
T ss_dssp             HHHHHHTTCGGGCSEECCTTTSCCCTTTTCEEEEEETTCHHHHHHHGGG
T ss_pred             hhHHhhcCcchheeEEcChhhcCChHhhhheEEEEcCCCHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999999999875
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pdaa2 d.50.2.1 (A:220-307) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjla2 g.39.1.13 (A:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tjla1 a.2.14.1 (A:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1smye_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p99a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1twff_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2czla1 c.94.1.1 (A:3-272) Hypothetical protein TTHA1568 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure