Psyllid ID: psy11601
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| 195383236 | 221 | GJ20270 [Drosophila virilis] gi|19414512 | 0.987 | 0.366 | 0.716 | 8e-28 | |
| 194755605 | 221 | GF11711 [Drosophila ananassae] gi|190621 | 0.987 | 0.366 | 0.728 | 9e-28 | |
| 195028967 | 221 | GH20024 [Drosophila grimshawi] gi|193903 | 0.987 | 0.366 | 0.716 | 1e-27 | |
| 195121434 | 221 | GI19203 [Drosophila mojavensis] gi|19391 | 0.987 | 0.366 | 0.716 | 1e-27 | |
| 94469030 | 224 | ribulose-5-phosphate-3-epimerase [Aedes | 0.951 | 0.348 | 0.743 | 3e-27 | |
| 157126418 | 224 | ribulose-5-phosphate-3-epimerase [Aedes | 0.951 | 0.348 | 0.743 | 4e-27 | |
| 24586301 | 221 | CG30499, isoform A [Drosophila melanogas | 0.987 | 0.366 | 0.716 | 6e-27 | |
| 195581258 | 221 | GD10239 [Drosophila simulans] gi|1941924 | 0.987 | 0.366 | 0.716 | 6e-27 | |
| 195332161 | 221 | GM20778 [Drosophila sechellia] gi|194124 | 0.987 | 0.366 | 0.716 | 6e-27 | |
| 289741201 | 228 | d-ribulose-5-phosphate 3-epimerase [Glos | 0.975 | 0.350 | 0.712 | 1e-26 |
| >gi|195383236|ref|XP_002050332.1| GJ20270 [Drosophila virilis] gi|194145129|gb|EDW61525.1| GJ20270 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Score = 127 bits (319), Expect = 8e-28, Method: Compositional matrix adjust.
Identities = 58/81 (71%), Positives = 66/81 (81%)
Query: 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAV 60
MTVEPGFGGQ FM DMMPKV+WLR NYP L+IEVDGGVGP TID CAKAGANWIVSGTAV
Sbjct: 140 MTVEPGFGGQSFMADMMPKVEWLRTNYPNLDIEVDGGVGPKTIDCCAKAGANWIVSGTAV 199
Query: 61 INCPDRIQAISTLKSSVQKYL 81
+ D+ Q I ++ V++YL
Sbjct: 200 VGAADQRQVIGDMRDVVKRYL 220
|
Source: Drosophila virilis Species: Drosophila virilis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|194755605|ref|XP_001960074.1| GF11711 [Drosophila ananassae] gi|190621372|gb|EDV36896.1| GF11711 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195028967|ref|XP_001987346.1| GH20024 [Drosophila grimshawi] gi|193903346|gb|EDW02213.1| GH20024 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195121434|ref|XP_002005225.1| GI19203 [Drosophila mojavensis] gi|193910293|gb|EDW09160.1| GI19203 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|94469030|gb|ABF18364.1| ribulose-5-phosphate-3-epimerase [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157126418|ref|XP_001660886.1| ribulose-5-phosphate-3-epimerase [Aedes aegypti] gi|108873289|gb|EAT37514.1| AAEL010505-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|24586301|ref|NP_610298.2| CG30499, isoform A [Drosophila melanogaster] gi|442622788|ref|NP_001260780.1| CG30499, isoform B [Drosophila melanogaster] gi|16768878|gb|AAL28658.1| LD09559p [Drosophila melanogaster] gi|21645589|gb|AAM71098.1| CG30499, isoform A [Drosophila melanogaster] gi|220942676|gb|ACL83881.1| CG30499-PA [synthetic construct] gi|220952920|gb|ACL89003.1| CG30499-PA [synthetic construct] gi|440214174|gb|AGB93313.1| CG30499, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195581258|ref|XP_002080451.1| GD10239 [Drosophila simulans] gi|194192460|gb|EDX06036.1| GD10239 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|195332161|ref|XP_002032767.1| GM20778 [Drosophila sechellia] gi|194124737|gb|EDW46780.1| GM20778 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|289741201|gb|ADD19348.1| d-ribulose-5-phosphate 3-epimerase [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| FB|FBgn0050499 | 221 | CG30499 [Drosophila melanogast | 0.987 | 0.366 | 0.716 | 7.3e-27 | |
| ZFIN|ZDB-GENE-030131-6837 | 228 | rpe "ribulose-5-phosphate-3-ep | 0.963 | 0.346 | 0.645 | 1.1e-23 | |
| MGI|MGI:1913896 | 228 | Rpe "ribulose-5-phosphate-3-ep | 0.914 | 0.328 | 0.653 | 1.8e-23 | |
| UNIPROTKB|D3ZZU9 | 228 | Rpe "Ribulose-phosphate 3-epim | 0.914 | 0.328 | 0.653 | 1.8e-23 | |
| UNIPROTKB|F1NT24 | 243 | RPE "Ribulose-phosphate 3-epim | 0.914 | 0.308 | 0.653 | 2.3e-23 | |
| UNIPROTKB|G5E6S3 | 187 | RPE "Uncharacterized protein" | 0.914 | 0.401 | 0.653 | 3.8e-23 | |
| UNIPROTKB|F6V404 | 228 | RPE "Ribulose-phosphate 3-epim | 0.914 | 0.328 | 0.653 | 3.8e-23 | |
| UNIPROTKB|F1SSS3 | 187 | LOC100737311 "Uncharacterized | 0.914 | 0.401 | 0.653 | 3.8e-23 | |
| UNIPROTKB|F1SSS5 | 190 | LOC100737311 "Uncharacterized | 0.914 | 0.394 | 0.653 | 3.8e-23 | |
| UNIPROTKB|C9J6A7 | 159 | RPE "Ribulose-phosphate 3-epim | 0.914 | 0.471 | 0.64 | 4.8e-23 |
| FB|FBgn0050499 CG30499 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 302 (111.4 bits), Expect = 7.3e-27, P = 7.3e-27
Identities = 58/81 (71%), Positives = 63/81 (77%)
Query: 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAV 60
MTVEPGFGGQ FM DMMPKVKWLRENYP L+IEVDGGVGP TI CA+AGAN IVSGTAV
Sbjct: 140 MTVEPGFGGQSFMADMMPKVKWLRENYPNLDIEVDGGVGPKTIHCCAEAGANMIVSGTAV 199
Query: 61 INCPDRIQAISTLKSSVQKYL 81
+ D+ Q I L+ V YL
Sbjct: 200 VGASDQSQVIKELRDVVHSYL 220
|
|
| ZFIN|ZDB-GENE-030131-6837 rpe "ribulose-5-phosphate-3-epimerase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913896 Rpe "ribulose-5-phosphate-3-epimerase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D3ZZU9 Rpe "Ribulose-phosphate 3-epimerase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NT24 RPE "Ribulose-phosphate 3-epimerase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E6S3 RPE "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6V404 RPE "Ribulose-phosphate 3-epimerase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSS3 LOC100737311 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSS5 LOC100737311 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J6A7 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| PTZ00170 | 228 | PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epime | 2e-43 | |
| PLN02334 | 229 | PLN02334, PLN02334, ribulose-phosphate 3-epimerase | 7e-39 | |
| cd00429 | 211 | cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RP | 9e-36 | |
| PRK05581 | 220 | PRK05581, PRK05581, ribulose-phosphate 3-epimerase | 6e-32 | |
| COG0036 | 220 | COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Car | 1e-30 | |
| pfam00834 | 201 | pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 ep | 6e-24 | |
| TIGR01163 | 210 | TIGR01163, rpe, ribulose-phosphate 3-epimerase | 1e-23 | |
| PRK08745 | 223 | PRK08745, PRK08745, ribulose-phosphate 3-epimerase | 3e-15 | |
| PRK08883 | 220 | PRK08883, PRK08883, ribulose-phosphate 3-epimerase | 1e-14 | |
| PRK09722 | 229 | PRK09722, PRK09722, allulose-6-phosphate 3-epimera | 9e-10 | |
| PRK08005 | 210 | PRK08005, PRK08005, epimerase; Validated | 2e-06 | |
| pfam01729 | 169 | pfam01729, QRPTase_C, Quinolinate phosphoribosyl t | 0.001 |
| >gnl|CDD|240303 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
Score = 139 bits (353), Expect = 2e-43
Identities = 52/82 (63%), Positives = 62/82 (75%)
Query: 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAV 60
MTVEPGFGGQ FM DMMPKV+ LR+ YP LNI+VDGG+ TID A AGAN IV+G+++
Sbjct: 145 MTVEPGFGGQSFMHDMMPKVRELRKRYPHLNIQVDGGINLETIDIAADAGANVIVAGSSI 204
Query: 61 INCPDRIQAISTLKSSVQKYLS 82
DR QAI L+ SVQK+LS
Sbjct: 205 FKAKDRKQAIELLRESVQKHLS 226
|
Length = 228 |
| >gnl|CDD|215192 PLN02334, PLN02334, ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|238244 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >gnl|CDD|235515 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223114 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216142 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family | Back alignment and domain information |
|---|
| >gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|136958 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181575 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236616 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169179 PRK08005, PRK08005, epimerase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|216667 pfam01729, QRPTase_C, Quinolinate phosphoribosyl transferase, C-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| COG0036 | 220 | Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate | 99.93 | |
| PRK08745 | 223 | ribulose-phosphate 3-epimerase; Provisional | 99.92 | |
| PRK08091 | 228 | ribulose-phosphate 3-epimerase; Validated | 99.92 | |
| PRK08005 | 210 | epimerase; Validated | 99.91 | |
| PRK14057 | 254 | epimerase; Provisional | 99.91 | |
| PRK08883 | 220 | ribulose-phosphate 3-epimerase; Provisional | 99.91 | |
| PRK09722 | 229 | allulose-6-phosphate 3-epimerase; Provisional | 99.9 | |
| KOG3111|consensus | 224 | 99.9 | ||
| PTZ00170 | 228 | D-ribulose-5-phosphate 3-epimerase; Provisional | 99.89 | |
| PF00834 | 201 | Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam | 99.86 | |
| PLN02334 | 229 | ribulose-phosphate 3-epimerase | 99.84 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 99.73 | |
| PRK13813 | 215 | orotidine 5'-phosphate decarboxylase; Provisional | 99.7 | |
| PRK05581 | 220 | ribulose-phosphate 3-epimerase; Validated | 99.7 | |
| PRK13306 | 216 | ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; | 99.68 | |
| TIGR01163 | 210 | rpe ribulose-phosphate 3-epimerase. This family co | 99.68 | |
| cd00429 | 211 | RPE Ribulose-5-phosphate 3-epimerase (RPE). This e | 99.64 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 99.57 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 99.56 | |
| PRK13307 | 391 | bifunctional formaldehyde-activating enzyme/3-hexu | 99.54 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 99.52 | |
| cd00564 | 196 | TMP_TenI Thiamine monophosphate synthase (TMP synt | 99.5 | |
| PRK07028 | 430 | bifunctional hexulose-6-phosphate synthase/ribonuc | 99.47 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 99.39 | |
| COG0352 | 211 | ThiE Thiamine monophosphate synthase [Coenzyme met | 99.37 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 99.35 | |
| PRK06512 | 221 | thiamine-phosphate pyrophosphorylase; Provisional | 99.31 | |
| COG0269 | 217 | SgbH 3-hexulose-6-phosphate synthase and related p | 99.29 | |
| PRK07695 | 201 | transcriptional regulator TenI; Provisional | 99.24 | |
| PRK12290 | 437 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 99.24 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 99.2 | |
| PRK03512 | 211 | thiamine-phosphate pyrophosphorylase; Provisional | 99.18 | |
| TIGR00693 | 196 | thiE thiamine-phosphate pyrophosphorylase. This mo | 99.16 | |
| CHL00200 | 263 | trpA tryptophan synthase alpha subunit; Provisiona | 99.15 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 99.12 | |
| PRK04180 | 293 | pyridoxal biosynthesis lyase PdxS; Provisional | 99.12 | |
| PRK02615 | 347 | thiamine-phosphate pyrophosphorylase; Provisional | 99.1 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 99.07 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 99.06 | |
| PLN02898 | 502 | HMP-P kinase/thiamin-monophosphate pyrophosphoryla | 99.01 | |
| TIGR01949 | 258 | AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep | 98.97 | |
| PRK09517 | 755 | multifunctional thiamine-phosphate pyrophosphoryla | 98.95 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.93 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 98.84 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 98.83 | |
| PRK13305 | 218 | sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; | 98.82 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 98.81 | |
| PRK07226 | 267 | fructose-bisphosphate aldolase; Provisional | 98.78 | |
| PF01729 | 169 | QRPTase_C: Quinolinate phosphoribosyl transferase, | 98.73 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.73 | |
| cd01568 | 269 | QPRTase_NadC Quinolinate phosphoribosyl transferas | 98.71 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 98.65 | |
| PRK00230 | 230 | orotidine 5'-phosphate decarboxylase; Reviewed | 98.62 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 98.62 | |
| PRK05742 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.58 | |
| PF02581 | 180 | TMP-TENI: Thiamine monophosphate synthase/TENI; In | 98.56 | |
| cd01572 | 268 | QPRTase Quinolinate phosphoribosyl transferase (QA | 98.56 | |
| PRK07896 | 289 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.54 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 98.53 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 98.51 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 98.49 | |
| PRK08385 | 278 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.48 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.47 | |
| PRK08072 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.47 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 98.45 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 98.43 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 98.42 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 98.41 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.4 | |
| PRK04302 | 223 | triosephosphate isomerase; Provisional | 98.4 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.36 | |
| TIGR01740 | 213 | pyrF orotidine 5'-phosphate decarboxylase, subfami | 98.34 | |
| PRK06806 | 281 | fructose-bisphosphate aldolase; Provisional | 98.33 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 98.33 | |
| PRK06096 | 284 | molybdenum transport protein ModD; Provisional | 98.33 | |
| cd00405 | 203 | PRAI Phosphoribosylanthranilate isomerase (PRAI) c | 98.33 | |
| TIGR00078 | 265 | nadC nicotinate-nucleotide pyrophosphorylase. Syno | 98.33 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 98.32 | |
| PRK07114 | 222 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.3 | |
| PLN02591 | 250 | tryptophan synthase | 98.24 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 98.23 | |
| PRK06559 | 290 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.22 | |
| PRK06106 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.18 | |
| PRK06978 | 294 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.18 | |
| COG0157 | 280 | NadC Nicotinate-nucleotide pyrophosphorylase [Coen | 98.18 | |
| PRK06543 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.17 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 98.16 | |
| PLN02716 | 308 | nicotinate-nucleotide diphosphorylase (carboxylati | 98.16 | |
| PRK07315 | 293 | fructose-bisphosphate aldolase; Provisional | 98.13 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 98.12 | |
| PRK09016 | 296 | quinolinate phosphoribosyltransferase; Validated | 98.1 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 98.08 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 98.06 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 98.03 | |
| cd01571 | 302 | NAPRTase_B Nicotinate phosphoribosyltransferase (N | 98.01 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 97.99 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 97.92 | |
| cd02812 | 219 | PcrB_like PcrB_like proteins. One member of this f | 97.92 | |
| PRK04169 | 232 | geranylgeranylglyceryl phosphate synthase-like pro | 97.9 | |
| cd04722 | 200 | TIM_phosphate_binding TIM barrel proteins share a | 97.89 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 97.88 | |
| TIGR00259 | 257 | thylakoid_BtpA membrane complex biogenesis protein | 97.86 | |
| PF03437 | 254 | BtpA: BtpA family; InterPro: IPR005137 Photosystem | 97.82 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 97.82 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 97.81 | |
| PF01180 | 295 | DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP | 97.77 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 97.74 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.71 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 97.71 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 97.71 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 97.69 | |
| PRK07188 | 352 | nicotinate phosphoribosyltransferase; Provisional | 97.67 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 97.66 | |
| cd00516 | 281 | PRTase_typeII Phosphoribosyltransferase (PRTase) t | 97.65 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 97.61 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 97.6 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 97.59 | |
| PF01884 | 230 | PcrB: PcrB family; InterPro: IPR008205 This entry | 97.59 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 97.58 | |
| COG0800 | 211 | Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca | 97.58 | |
| TIGR01859 | 282 | fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, | 97.58 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.57 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 97.54 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 97.54 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 97.53 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 97.53 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.51 | |
| COG0214 | 296 | SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta | 97.49 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.49 | |
| PRK08227 | 264 | autoinducer 2 aldolase; Validated | 97.48 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.48 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 97.47 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 97.46 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.44 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.43 | |
| PRK08662 | 343 | nicotinate phosphoribosyltransferase; Reviewed | 97.39 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.39 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 97.38 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 97.37 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 97.36 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.34 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.34 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 97.33 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 97.32 | |
| COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epim | 97.32 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 97.31 | |
| TIGR01768 | 223 | GGGP-family geranylgeranylglyceryl phosphate synth | 97.31 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.28 | |
| PF00290 | 259 | Trp_syntA: Tryptophan synthase alpha chain; InterP | 97.27 | |
| cd04725 | 216 | OMP_decarboxylase_like Orotidine 5'-phosphate deca | 97.27 | |
| COG1830 | 265 | FbaB DhnA-type fructose-1,6-bisphosphate aldolase | 97.25 | |
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 97.25 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.19 | |
| PRK06801 | 286 | hypothetical protein; Provisional | 97.17 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 97.16 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 97.15 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.13 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 97.11 | |
| PF00218 | 254 | IGPS: Indole-3-glycerol phosphate synthase; InterP | 97.09 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 97.09 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 97.07 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 97.07 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 97.06 | |
| KOG1606|consensus | 296 | 97.06 | ||
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 97.05 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 97.05 | |
| PRK14565 | 237 | triosephosphate isomerase; Provisional | 97.04 | |
| PRK06852 | 304 | aldolase; Validated | 97.03 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 97.02 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 96.9 | |
| PF00215 | 226 | OMPdecase: Orotidine 5'-phosphate decarboxylase / | 96.88 | |
| COG2022 | 262 | ThiG Uncharacterized enzyme of thiazole biosynthes | 96.88 | |
| cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN | 96.84 | |
| PF00697 | 197 | PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome | 96.83 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 96.82 | |
| PRK01222 | 210 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 96.82 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 96.8 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 96.8 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 96.78 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 96.78 | |
| TIGR01769 | 205 | GGGP geranylgeranylglyceryl phosphate synthase. Th | 96.76 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 96.76 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 96.73 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 96.73 | |
| COG0134 | 254 | TrpC Indole-3-glycerol phosphate synthase [Amino a | 96.65 | |
| COG1646 | 240 | Predicted phosphate-binding enzymes, TIM-barrel fo | 96.62 | |
| PLN02411 | 391 | 12-oxophytodienoate reductase | 96.6 | |
| COG0135 | 208 | TrpF Phosphoribosylanthranilate isomerase [Amino a | 96.59 | |
| cd04735 | 353 | OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN | 96.58 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.56 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.55 | |
| cd00945 | 201 | Aldolase_Class_I Class I aldolases. The class I al | 96.52 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 96.52 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 96.51 | |
| KOG0538|consensus | 363 | 96.51 | ||
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.5 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 96.5 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 96.44 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 96.42 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 96.41 | |
| PRK10605 | 362 | N-ethylmaleimide reductase; Provisional | 96.38 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 96.37 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 96.28 | |
| COG0434 | 263 | SgcQ Predicted TIM-barrel enzyme [General function | 96.27 | |
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 96.23 | |
| KOG2335|consensus | 358 | 96.19 | ||
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 96.19 | |
| PLN02535 | 364 | glycolate oxidase | 96.17 | |
| COG0159 | 265 | TrpA Tryptophan synthase alpha chain [Amino acid t | 96.16 | |
| cd02929 | 370 | TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) | 96.16 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.15 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.14 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 96.14 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 96.12 | |
| COG0284 | 240 | PyrF Orotidine-5'-phosphate decarboxylase [Nucleot | 96.12 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.11 | |
| PRK14567 | 253 | triosephosphate isomerase; Provisional | 96.09 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 96.06 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 96.06 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 96.05 | |
| PF01207 | 309 | Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 | 96.04 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 96.04 | |
| cd00311 | 242 | TIM Triosephosphate isomerase (TIM) is a glycolyti | 96.03 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 95.99 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 95.94 | |
| TIGR02814 | 444 | pfaD_fam PfaD family protein. The protein PfaD is | 95.92 | |
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 95.82 | |
| KOG3055|consensus | 263 | 95.82 | ||
| cd04747 | 361 | OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN | 95.81 | |
| PF03060 | 330 | NMO: Nitronate monooxygenase; InterPro: IPR004136 | 95.76 | |
| PRK05500 | 477 | bifunctional orotidine 5'-phosphate decarboxylase/ | 95.75 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 95.73 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 95.72 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 95.72 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 95.64 | |
| cd04742 | 418 | NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom | 95.64 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 95.62 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 95.62 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 95.6 | |
| PRK13957 | 247 | indole-3-glycerol-phosphate synthase; Provisional | 95.57 | |
| PLN02460 | 338 | indole-3-glycerol-phosphate synthase | 95.51 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 95.51 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 95.49 | |
| PF03932 | 201 | CutC: CutC family; InterPro: IPR005627 Copper tran | 95.46 | |
| PRK11572 | 248 | copper homeostasis protein CutC; Provisional | 95.46 | |
| PRK14905 | 355 | triosephosphate isomerase/PTS system glucose/sucro | 95.44 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 95.24 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 95.17 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 95.11 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 95.11 | |
| PLN02979 | 366 | glycolate oxidase | 95.1 | |
| PF00724 | 341 | Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox | 95.08 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 95.08 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 95.07 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 94.93 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 94.91 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 94.84 | |
| COG0149 | 251 | TpiA Triosephosphate isomerase [Carbohydrate trans | 94.77 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 94.76 | |
| PRK00042 | 250 | tpiA triosephosphate isomerase; Provisional | 94.67 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 94.67 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 94.56 | |
| PLN02429 | 315 | triosephosphate isomerase | 94.54 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 94.52 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 94.48 | |
| cd00959 | 203 | DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of | 94.43 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 94.42 | |
| PRK09250 | 348 | fructose-bisphosphate aldolase; Provisional | 94.4 | |
| COG2070 | 336 | Dioxygenases related to 2-nitropropane dioxygenase | 94.39 | |
| KOG1799|consensus | 471 | 94.22 | ||
| COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MT | 94.17 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 94.17 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 94.13 | |
| PF01791 | 236 | DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 | 94.02 | |
| PRK15492 | 260 | triosephosphate isomerase; Provisional | 93.96 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 93.6 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 93.53 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 93.51 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 93.46 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 93.37 | |
| TIGR00126 | 211 | deoC deoxyribose-phosphate aldolase. Deoxyribose-p | 93.23 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 93.21 | |
| PTZ00333 | 255 | triosephosphate isomerase; Provisional | 92.94 | |
| PRK13803 | 610 | bifunctional phosphoribosylanthranilate isomerase/ | 92.93 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 92.82 | |
| PRK00507 | 221 | deoxyribose-phosphate aldolase; Provisional | 92.64 | |
| PF00121 | 244 | TIM: Triosephosphate isomerase; InterPro: IPR00065 | 92.5 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 92.39 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 92.37 | |
| cd08207 | 406 | RLP_NonPhot Ribulose bisphosphate carboxylase like | 92.27 | |
| COG1902 | 363 | NemA NADH:flavin oxidoreductases, Old Yellow Enzym | 91.95 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 91.92 | |
| PLN02363 | 256 | phosphoribosylanthranilate isomerase | 91.9 | |
| KOG2550|consensus | 503 | 91.5 | ||
| PF13277 | 253 | YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. | 91.45 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 91.4 | |
| cd01570 | 327 | NAPRTase_A Nicotinate phosphoribosyltransferase (N | 91.23 | |
| COG3142 | 241 | CutC Uncharacterized protein involved in copper re | 91.22 | |
| TIGR00419 | 205 | tim triosephosphate isomerase. Triosephosphate iso | 91.09 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 91.03 | |
| PF04481 | 242 | DUF561: Protein of unknown function (DUF561); Inte | 90.98 | |
| PRK08185 | 283 | hypothetical protein; Provisional | 90.86 | |
| KOG2550|consensus | 503 | 90.72 | ||
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 90.52 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 90.45 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 90.32 | |
| KOG0538|consensus | 363 | 90.31 | ||
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 90.28 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 90.16 | |
| COG1411 | 229 | Uncharacterized protein related to proFAR isomeras | 89.93 | |
| KOG1436|consensus | 398 | 89.91 | ||
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 89.85 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 89.82 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 89.73 | |
| PLN02979 | 366 | glycolate oxidase | 89.69 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 89.59 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 89.47 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 89.42 | |
| TIGR02127 | 261 | pyrF_sub2 orotidine 5'-phosphate decarboxylase, su | 89.36 | |
| COG1692 | 266 | Calcineurin-like phosphoesterase [General function | 89.3 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 89.25 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 89.24 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 89.14 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 88.79 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 88.11 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 88.08 | |
| cd01715 | 168 | ETF_alpha The electron transfer flavoprotein (ETF) | 87.88 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 87.77 | |
| PLN02535 | 364 | glycolate oxidase | 87.75 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 87.72 | |
| COG0800 | 211 | Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca | 86.79 | |
| PRK12484 | 443 | nicotinate phosphoribosyltransferase; Provisional | 86.69 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 86.18 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 86.01 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 85.95 | |
| COG1908 | 132 | FrhD Coenzyme F420-reducing hydrogenase, delta sub | 85.94 | |
| TIGR01513 | 443 | NAPRTase_put putative nicotinate phosphoribosyltra | 85.9 | |
| cd08209 | 391 | RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent | 85.84 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 85.82 | |
| cd00956 | 211 | Transaldolase_FSA Transaldolase-like fructose-6-ph | 85.8 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 85.66 | |
| PRK09243 | 464 | nicotinate phosphoribosyltransferase; Validated | 85.54 | |
| PF02579 | 94 | Nitro_FeMo-Co: Dinitrogenase iron-molybdenum cofac | 85.47 | |
| KOG4201|consensus | 289 | 85.34 | ||
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 85.34 | |
| TIGR00875 | 213 | fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ | 85.33 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 85.12 | |
| TIGR00282 | 266 | metallophosphoesterase, MG_246/BB_0505 family. A m | 85.01 | |
| PF02662 | 124 | FlpD: Methyl-viologen-reducing hydrogenase, delta | 84.98 | |
| TIGR00433 | 296 | bioB biotin synthetase. Catalyzes the last step of | 84.93 | |
| COG0325 | 228 | Predicted enzyme with a TIM-barrel fold [General f | 84.82 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 84.82 | |
| PRK01362 | 214 | putative translaldolase; Provisional | 84.5 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 84.46 | |
| TIGR02663 | 119 | nifX nitrogen fixation protein NifX. Members of th | 84.28 | |
| cd00377 | 243 | ICL_PEPM Members of the ICL/PEPM enzyme family cat | 84.22 | |
| cd04743 | 320 | NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma | 84.18 | |
| PF07071 | 218 | DUF1341: Protein of unknown function (DUF1341); In | 84.13 | |
| PF13714 | 238 | PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB | 84.11 | |
| PRK09196 | 347 | fructose-1,6-bisphosphate aldolase; Reviewed | 84.08 | |
| PRK12858 | 340 | tagatose 1,6-diphosphate aldolase; Reviewed | 83.8 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 83.53 | |
| TIGR03326 | 412 | rubisco_III ribulose bisphosphate carboxylase, typ | 83.25 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 83.19 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 83.14 | |
| TIGR02317 | 285 | prpB methylisocitrate lyase. Members of this famil | 82.92 | |
| TIGR02319 | 294 | CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos | 82.92 | |
| KOG4175|consensus | 268 | 82.69 | ||
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 82.42 | |
| PRK07998 | 283 | gatY putative fructose-1,6-bisphosphate aldolase; | 82.41 | |
| PLN02885 | 545 | nicotinate phosphoribosyltransferase | 82.22 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 82.16 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 82.14 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 81.07 | |
| TIGR02320 | 285 | PEP_mutase phosphoenolpyruvate phosphomutase. A cl | 81.07 | |
| PTZ00187 | 317 | succinyl-CoA synthetase alpha subunit; Provisional | 80.86 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 80.72 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 80.56 | |
| PRK13399 | 347 | fructose-1,6-bisphosphate aldolase; Provisional | 80.47 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 80.39 | |
| PRK06464 | 795 | phosphoenolpyruvate synthase; Validated | 80.33 | |
| TIGR01521 | 347 | FruBisAldo_II_B fructose-bisphosphate aldolase, cl | 80.31 | |
| PRK12656 | 222 | fructose-6-phosphate aldolase; Reviewed | 80.19 |
| >COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.2e-26 Score=155.10 Aligned_cols=79 Identities=41% Similarity=0.683 Sum_probs=74.0
Q ss_pred CccCCCCCCCCCCcchHHHHHHHHHhCC---CCcEEEEcCCCcccHHHHHHcCCCEEEEeccccCCCCHHHHHHHHHHHH
Q psy11601 1 MTVEPGFGGQKFMQDMMPKVKWLRENYP---TLNIEVDGGVGPNTIDECAKAGANWIVSGTAVINCPDRIQAISTLKSSV 77 (82)
Q Consensus 1 m~v~pG~~gq~~~~~~~~ki~~~~~~~~---~~~i~~dGGI~~~ni~~~~~~Gad~vv~gs~i~~~~d~~~~~~~l~~~~ 77 (82)
|||||||+||+|+|++++||+++|++.. ++.|+|||||+.+|++++.++|||.+|+||++|+.+|+++.+++++..+
T Consensus 138 MsVnPGfgGQ~Fi~~~l~Ki~~lr~~~~~~~~~~IeVDGGI~~~t~~~~~~AGad~~VaGSalF~~~d~~~~i~~~~~~~ 217 (220)
T COG0036 138 MSVNPGFGGQKFIPEVLEKIRELRAMIDERLDILIEVDGGINLETIKQLAAAGADVFVAGSALFGADDYKATIRELRGEL 217 (220)
T ss_pred EeECCCCcccccCHHHHHHHHHHHHHhcccCCeEEEEeCCcCHHHHHHHHHcCCCEEEEEEEEeCCccHHHHHHHHHHHh
Confidence 8999999999999999999999999865 6789999999999999999999999999999999999999999998876
Q ss_pred HH
Q psy11601 78 QK 79 (82)
Q Consensus 78 ~~ 79 (82)
.+
T Consensus 218 ~~ 219 (220)
T COG0036 218 LK 219 (220)
T ss_pred hc
Confidence 53
|
|
| >PRK08745 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK08091 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >PRK08005 epimerase; Validated | Back alignment and domain information |
|---|
| >PRK14057 epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK08883 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK09722 allulose-6-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >KOG3111|consensus | Back alignment and domain information |
|---|
| >PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 | Back alignment and domain information |
|---|
| >PLN02334 ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >PRK13813 orotidine 5'-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05581 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01163 rpe ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >PRK06512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07695 transcriptional regulator TenI; Provisional | Back alignment and domain information |
|---|
| >PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK03512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00693 thiE thiamine-phosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >CHL00200 trpA tryptophan synthase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional | Back alignment and domain information |
|---|
| >PRK02615 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase | Back alignment and domain information |
|---|
| >PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >PRK07226 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 | Back alignment and domain information |
|---|
| >cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK04302 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 | Back alignment and domain information |
|---|
| >PRK06806 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >PRK06096 molybdenum transport protein ModD; Provisional | Back alignment and domain information |
|---|
| >cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) | Back alignment and domain information |
|---|
| >TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) | Back alignment and domain information |
|---|
| >PRK07315 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >PRK09016 quinolinate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >cd02812 PcrB_like PcrB_like proteins | Back alignment and domain information |
|---|
| >PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family | Back alignment and domain information |
|---|
| >PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >PRK07188 nicotinate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK08227 autoinducer 2 aldolase; Validated | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08662 nicotinate phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 | Back alignment and domain information |
|---|
| >cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway | Back alignment and domain information |
|---|
| >COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK06801 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >KOG1606|consensus | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >PRK14565 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06852 aldolase; Validated | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP | Back alignment and domain information |
|---|
| >COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
| >COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >cd00945 Aldolase_Class_I Class I aldolases | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG0538|consensus | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >PRK10605 N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG2335|consensus | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14567 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >TIGR02814 pfaD_fam PfaD family protein | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >KOG3055|consensus | Back alignment and domain information |
|---|
| >cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 | Back alignment and domain information |
|---|
| >PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 | Back alignment and domain information |
|---|
| >PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >PRK13957 indole-3-glycerol-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02460 indole-3-glycerol-phosphate synthase | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF | Back alignment and domain information |
|---|
| >PRK11572 copper homeostasis protein CutC; Provisional | Back alignment and domain information |
|---|
| >PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00042 tpiA triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02429 triosephosphate isomerase | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09250 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1799|consensus | Back alignment and domain information |
|---|
| >COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism | Back alignment and domain information |
|---|
| >PRK15492 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00126 deoC deoxyribose-phosphate aldolase | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00333 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK00507 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria | Back alignment and domain information |
|---|
| >COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02363 phosphoribosylanthranilate isomerase | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >cd01570 NAPRTase_A Nicotinate phosphoribosyltransferase (NAPRTase), subgroup A | Back alignment and domain information |
|---|
| >COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00419 tim triosephosphate isomerase | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae | Back alignment and domain information |
|---|
| >PRK08185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >KOG0538|consensus | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1436|consensus | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 | Back alignment and domain information |
|---|
| >COG1692 Calcineurin-like phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12484 nicotinate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01513 NAPRTase_put putative nicotinate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK09243 nicotinate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PF02579 Nitro_FeMo-Co: Dinitrogenase iron-molybdenum cofactor; InterPro: IPR003731 This entry represents several Nif (B, X and Y) proteins, which are involved in the biosynthesis of the iron-molybdenum cofactor (FeMo-co) found in the dinitrogenase enzyme of the nitrogenase complex in nitrogen-fixing bacteria | Back alignment and domain information |
|---|
| >KOG4201|consensus | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00282 metallophosphoesterase, MG_246/BB_0505 family | Back alignment and domain information |
|---|
| >PF02662 FlpD: Methyl-viologen-reducing hydrogenase, delta subunit; InterPro: IPR003813 Methyl-viologen-reducing hydrogenase (MVH) is one of the enzymes involved in methanogenesis and coded in the mth-flp-mvh-mrt cluster of methane genes in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) [] | Back alignment and domain information |
|---|
| >TIGR00433 bioB biotin synthetase | Back alignment and domain information |
|---|
| >COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >PRK01362 putative translaldolase; Provisional | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >TIGR02663 nifX nitrogen fixation protein NifX | Back alignment and domain information |
|---|
| >cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage | Back alignment and domain information |
|---|
| >cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) | Back alignment and domain information |
|---|
| >PF07071 DUF1341: Protein of unknown function (DUF1341); InterPro: IPR010763 Members of this family of relatively uncommon proteins are found in both Gram-positive (e | Back alignment and domain information |
|---|
| >PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B | Back alignment and domain information |
|---|
| >PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >TIGR02317 prpB methylisocitrate lyase | Back alignment and domain information |
|---|
| >TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase | Back alignment and domain information |
|---|
| >KOG4175|consensus | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PLN02885 nicotinate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase | Back alignment and domain information |
|---|
| >PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK13399 fructose-1,6-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK06464 phosphoenolpyruvate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype | Back alignment and domain information |
|---|
| >PRK12656 fructose-6-phosphate aldolase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 82 | ||||
| 3ovp_A | 228 | Crystal Structure Of Hrpe Length = 228 | 3e-25 | ||
| 1h1y_A | 228 | The Structure Of The Cytosolic D-Ribulose-5-Phospha | 2e-22 | ||
| 3qc3_A | 225 | Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epi | 8e-22 | ||
| 1tqx_A | 227 | Crystal Structure Of Pfal009167 A Putative D-Ribulo | 4e-21 | ||
| 1tqj_A | 230 | Crystal Structure Of D-Ribulose 5-Phosphate 3-Epime | 4e-13 | ||
| 2fli_A | 220 | The Crystal Structure Of D-Ribulose 5-Phosphate 3-E | 8e-13 | ||
| 1rpx_A | 230 | D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tub | 5e-12 | ||
| 3inp_A | 246 | 2.05 Angstrom Resolution Crystal Structure Of D-Rib | 3e-11 | ||
| 3ct7_A | 231 | Crystal Structure Of D-Allulose 6-Phosphate 3-Epime | 3e-05 |
| >pdb|3OVP|A Chain A, Crystal Structure Of Hrpe Length = 228 | Back alignment and structure |
|
| >pdb|1H1Y|A Chain A, The Structure Of The Cytosolic D-Ribulose-5-Phosphate 3- Epimerase From Rice Complexed With Sulfate Length = 228 | Back alignment and structure |
| >pdb|3QC3|A Chain A, Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epimerase (Np_954699) From Homo Sapiens At 2.20 A Resolution Length = 225 | Back alignment and structure |
| >pdb|1TQX|A Chain A, Crystal Structure Of Pfal009167 A Putative D-Ribulose 5-Phosphate 3- Epimerase From P.Falciparum Length = 227 | Back alignment and structure |
| >pdb|1TQJ|A Chain A, Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Synechocystis To 1.6 Angstrom Resolution Length = 230 | Back alignment and structure |
| >pdb|2FLI|A Chain A, The Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Streptococus Pyogenes Complexed With D-Xylitol 5- Phosphate Length = 220 | Back alignment and structure |
| >pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tuberosum Chloroplasts Length = 230 | Back alignment and structure |
| >pdb|3INP|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of D-Ribulose-Phosphate 3- Epimerase From Francisella Tularensis Length = 246 | Back alignment and structure |
| >pdb|3CT7|A Chain A, Crystal Structure Of D-Allulose 6-Phosphate 3-Epimerase From Escherichia Coli K-12 Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| 1tqx_A | 227 | D-ribulose-5-phosphate 3-epimerase, putative; stru | 1e-44 | |
| 3ovp_A | 228 | Ribulose-phosphate 3-epimerase; iron binding, isom | 2e-43 | |
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 7e-43 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 4e-30 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 1e-29 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 1e-29 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 1e-29 | |
| 3ctl_A | 231 | D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p | 5e-27 | |
| 3cu2_A | 237 | Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib | 4e-25 | |
| 3exr_A | 221 | RMPD (hexulose-6-phosphate synthase); beta barrel, | 8e-16 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 1e-14 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 1e-14 | |
| 1q6o_A | 216 | Humps, 3-keto-L-gulonate 6-phosphate decarboxylase | 1e-13 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 5e-12 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 2e-05 |
| >1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Length = 227 | Back alignment and structure |
|---|
Score = 141 bits (359), Expect = 1e-44
Identities = 46/82 (56%), Positives = 57/82 (69%)
Query: 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAV 60
MTVEPGFGGQ FM DMM KV +LR+ Y LNI+VDGG+ T + A GAN IV+GT++
Sbjct: 145 MTVEPGFGGQSFMHDMMGKVSFLRKKYKNLNIQVDGGLNIETTEISASHGANIIVAGTSI 204
Query: 61 INCPDRIQAISTLKSSVQKYLS 82
N D I T++ SVQKYL+
Sbjct: 205 FNAEDPKYVIDTMRVSVQKYLN 226
|
| >3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} PDB: 3ovq_A* 3ovr_A* 3qc3_A Length = 228 | Back alignment and structure |
|---|
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Length = 228 | Back alignment and structure |
|---|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Length = 246 | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Length = 220 | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Length = 230 | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Length = 230 | Back alignment and structure |
|---|
| >3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Length = 231 | Back alignment and structure |
|---|
| >3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Length = 237 | Back alignment and structure |
|---|
| >3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Length = 221 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} Length = 211 | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Length = 207 | Back alignment and structure |
|---|
| >1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Length = 216 | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A* Length = 218 | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Length = 286 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| 3ovp_A | 228 | Ribulose-phosphate 3-epimerase; iron binding, isom | 99.92 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 99.92 | |
| 1tqx_A | 227 | D-ribulose-5-phosphate 3-epimerase, putative; stru | 99.92 | |
| 3ctl_A | 231 | D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p | 99.9 | |
| 3cu2_A | 237 | Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib | 99.87 | |
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 99.86 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 99.86 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 99.77 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 99.77 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 99.72 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 99.71 | |
| 2czd_A | 208 | Orotidine 5'-phosphate decarboxylase; pyrimidine b | 99.7 | |
| 1q6o_A | 216 | Humps, 3-keto-L-gulonate 6-phosphate decarboxylase | 99.65 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 99.61 | |
| 1eix_A | 245 | Orotidine 5'-monophosphate decarboxylase; alpha-be | 99.53 | |
| 3exr_A | 221 | RMPD (hexulose-6-phosphate synthase); beta barrel, | 99.52 | |
| 1dbt_A | 239 | Orotidine 5'-phosphate decarboxylase; UMP, TIM bar | 99.5 | |
| 2yyu_A | 246 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 99.48 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 99.46 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 99.44 | |
| 3o63_A | 243 | Probable thiamine-phosphate pyrophosphorylase; thi | 99.43 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 99.41 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 99.38 | |
| 1rd5_A | 262 | Tryptophan synthase alpha chain, chloroplast; hydr | 99.32 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 99.32 | |
| 1qop_A | 268 | Tryptophan synthase alpha chain; lyase, carbon-oxy | 99.25 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 99.25 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 99.21 | |
| 3nl6_A | 540 | Thiamine biosynthetic bifunctional enzyme; thiamin | 99.16 | |
| 2yw3_A | 207 | 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox | 99.16 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 99.16 | |
| 2zbt_A | 297 | Pyridoxal biosynthesis lyase PDXS; pyridoxine bios | 99.15 | |
| 3m47_A | 228 | Orotidine 5'-phosphate decarboxylase; orotidine 5' | 99.11 | |
| 3ceu_A | 210 | Thiamine phosphate pyrophosphorylase; TIM barrel-l | 99.03 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 99.03 | |
| 3ve9_A | 215 | Orotidine-5'-phosphate decarboxylase; TIM barrel f | 99.0 | |
| 1w8s_A | 263 | FBP aldolase, fructose-bisphosphate aldolase class | 98.95 | |
| 1mxs_A | 225 | KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a | 98.92 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 98.9 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 98.88 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 98.88 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 98.87 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 98.87 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 98.86 | |
| 3o07_A | 291 | Pyridoxine biosynthesis protein SNZ1; (beta/alpha) | 98.85 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 98.85 | |
| 2h6r_A | 219 | Triosephosphate isomerase; beta-alpha barrel; 2.30 | 98.85 | |
| 2qjg_A | 273 | Putative aldolase MJ0400; beta-alpha barrel, lyase | 98.84 | |
| 2yzr_A | 330 | Pyridoxal biosynthesis lyase PDXS; redox protein, | 98.84 | |
| 3ru6_A | 303 | Orotidine 5'-phosphate decarboxylase; structural g | 98.83 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 98.82 | |
| 3tfx_A | 259 | Orotidine 5'-phosphate decarboxylase; PSI-biology, | 98.82 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 98.8 | |
| 4dbe_A | 222 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 98.76 | |
| 1vqt_A | 213 | Orotidine 5'-phosphate decarboxylase; TM0332, stru | 98.65 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 98.65 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 98.64 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 98.62 | |
| 1to3_A | 304 | Putative aldolase YIHT; beta-alpha barrel, structu | 98.62 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 98.61 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 98.58 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 98.58 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 98.57 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 98.57 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 98.55 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 98.54 | |
| 3tr2_A | 239 | Orotidine 5'-phosphate decarboxylase; purines, pyr | 98.53 | |
| 2jbm_A | 299 | Nicotinate-nucleotide pyrophosphorylase; NAD, enzy | 98.52 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 98.48 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 98.48 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 98.46 | |
| 3ldv_A | 255 | Orotidine 5'-phosphate decarboxylase; structural g | 98.44 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 98.44 | |
| 3glc_A | 295 | Aldolase LSRF; TIM barrel, lyase, schiff base; HET | 98.44 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 98.42 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 98.37 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 98.33 | |
| 3c2e_A | 294 | Nicotinate-nucleotide pyrophosphorylase; qprtase, | 98.31 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 98.27 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 98.25 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 98.24 | |
| 3gnn_A | 298 | Nicotinate-nucleotide pyrophosphorylase; decode bi | 98.23 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 98.22 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 98.21 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 98.2 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 98.16 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 98.13 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 98.11 | |
| 1qap_A | 296 | Quinolinic acid phosphoribosyltransferase; glycosy | 98.08 | |
| 3tha_A | 252 | Tryptophan synthase alpha chain; structural genomi | 98.04 | |
| 1ujp_A | 271 | Tryptophan synthase alpha chain; riken structural | 98.03 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 97.99 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.95 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 97.95 | |
| 1i4n_A | 251 | Indole-3-glycerol phosphate synthase; thermostable | 97.94 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 97.88 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 97.88 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 97.88 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 97.88 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 97.8 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 97.77 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 97.74 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 97.72 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.7 | |
| 1viz_A | 240 | PCRB protein homolog; structural genomics, unknown | 97.7 | |
| 1w0m_A | 226 | TIM, triosephosphate isomerase; glycolysis, glucon | 97.69 | |
| 3eww_A | 260 | Ompdecase, orotidine-5'-phosphate decarboxylase; T | 97.67 | |
| 3vzx_A | 228 | Heptaprenylglyceryl phosphate synthase; biosynthes | 97.67 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 97.67 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 97.63 | |
| 1hg3_A | 225 | Triosephosphate isomerase; thermostability, tetram | 97.62 | |
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 97.61 | |
| 3qw3_A | 255 | Orotidine-5-phosphate decarboxylase/orotate phosph | 97.59 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 97.59 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 97.55 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 97.54 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 97.54 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 97.53 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 97.53 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 97.51 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 97.49 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 97.46 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 97.43 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 97.41 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.41 | |
| 3w01_A | 235 | Heptaprenylglyceryl phosphate synthase; biosynthes | 97.41 | |
| 2f6u_A | 234 | GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy | 97.4 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 97.4 | |
| 2ffc_A | 353 | Orotidine 5-monophosphate decarboxylase; PV-PF10_0 | 97.38 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 97.36 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 97.35 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 97.34 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.31 | |
| 2fds_A | 352 | Orotidine-monophosphate-decarboxylase; TIM barrel, | 97.3 | |
| 3iwp_A | 287 | Copper homeostasis protein CUTC homolog; conserved | 97.29 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 97.25 | |
| 3aty_A | 379 | Tcoye, prostaglandin F2A synthase; alpha/beta barr | 97.22 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 97.2 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 97.17 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.17 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.17 | |
| 3qw4_B | 453 | UMP synthase; N-terminal orotidine monophosphate d | 97.17 | |
| 2hsa_B | 402 | 12-oxophytodienoate reductase 3; alpha beta 8 barr | 97.14 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 97.13 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 97.11 | |
| 3g3d_A | 312 | UMP synthase, uridine 5'-monophosphate synthase; C | 97.1 | |
| 2i1o_A | 398 | Nicotinate phosphoribosyltransferase; ZIN ION, zin | 97.09 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 97.09 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 97.04 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 97.04 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.04 | |
| 4ab4_A | 362 | Xenobiotic reductase B; oxidoreductase, OLD yellow | 97.04 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.0 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 96.98 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 96.95 | |
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 96.94 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.88 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 96.86 | |
| 1v5x_A | 203 | PRA isomerase, phosphoribosylanthranilate isomeras | 96.81 | |
| 1nsj_A | 205 | PRAI, phosphoribosyl anthranilate isomerase; therm | 96.81 | |
| 3gdm_A | 267 | Orotidine 5'-phosphate decarboxylase; orotidine 5' | 96.77 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 96.73 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 96.73 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 96.71 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 96.69 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 96.68 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 96.68 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.65 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 96.64 | |
| 3n3m_A | 342 | Orotidine 5'-phosphate decarboxylase; P. falciparu | 96.62 | |
| 4a29_A | 258 | Engineered retro-aldol enzyme RA95.0; de novo prot | 96.62 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 96.58 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 96.57 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 96.56 | |
| 2p10_A | 286 | MLL9387 protein; putative phosphonopyruvate hydrol | 96.56 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 96.53 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 96.48 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 96.43 | |
| 2bdq_A | 224 | Copper homeostasis protein CUTC; alpha beta protei | 96.31 | |
| 4aaj_A | 228 | N-(5'-phosphoribosyl)anthranilate isomerase; alpha | 96.15 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 96.12 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 96.1 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 96.08 | |
| 1yya_A | 250 | Triosephosphate isomerase; riken structural genomi | 95.94 | |
| 2btm_A | 252 | TIM, protein (triosephosphate isomerase); thermoph | 95.75 | |
| 4a3u_A | 358 | NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET | 95.75 | |
| 1twd_A | 256 | Copper homeostasis protein CUTC; TIM-like protein, | 95.72 | |
| 1aw2_A | 256 | Triosephosphate isomerase; psychrophilic, vibrio m | 95.67 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 95.65 | |
| 2i14_A | 395 | Nicotinate-nucleotide pyrophosphorylase; ligand bi | 95.63 | |
| 2j27_A | 250 | Triosephosphate isomerase glycosomal; TIM, 2PG, LO | 95.55 | |
| 1o5x_A | 248 | TIM, triosephosphate isomerase; 2- phosphoglycerat | 95.53 | |
| 3fok_A | 307 | Uncharacterized protein CGL0159; CGL0159 ,brevibac | 95.5 | |
| 2jgq_A | 233 | Triosephosphate isomerase; glycolysis, pentose shu | 95.5 | |
| 2yc6_A | 257 | Triosephosphate isomerase; glycolysis; HET: PGA; 1 | 95.46 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 95.27 | |
| 1tre_A | 255 | Triosephosphate isomerase; intramolecular oxidored | 95.23 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 94.8 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 94.79 | |
| 1ub3_A | 220 | Aldolase protein; schiff base, deoxyribose phospha | 94.72 | |
| 2f7f_A | 494 | Nicotinate phosphoribosyltransferase, putative; st | 94.69 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 94.61 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 94.59 | |
| 3oa3_A | 288 | Aldolase; structural genomics, seattle structural | 94.56 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 94.32 | |
| 1vcv_A | 226 | Probable deoxyribose-phosphate aldolase; DERA, hyp | 94.28 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 94.17 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 94.09 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 94.05 | |
| 3m9y_A | 254 | Triosephosphate isomerase; TIM barrel, glycolysis, | 94.0 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 93.86 | |
| 3kts_A | 192 | Glycerol uptake operon antiterminator regulatory; | 93.82 | |
| 1b9b_A | 255 | TIM, protein (triosephosphate isomerase); thermoph | 93.59 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 93.57 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 93.46 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 93.4 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 93.38 | |
| 3tjl_A | 407 | NADPH dehydrogenase; OLD yellow enzyme, flavin mon | 93.36 | |
| 4gbu_A | 400 | NADPH dehydrogenase 1; alpha/beta barrel, enenone | 93.3 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 93.27 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 93.22 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 92.94 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 92.81 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 92.8 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 92.77 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 92.64 | |
| 3ndo_A | 231 | Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid | 92.54 | |
| 3r12_A | 260 | Deoxyribose-phosphate aldolase; TIM beta/alpha-bar | 92.53 | |
| 1n7k_A | 234 | Deoxyribose-phosphate aldolase; A.pernix, tetramer | 92.52 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 92.46 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 92.42 | |
| 3ngj_A | 239 | Deoxyribose-phosphate aldolase; lyase, structural | 91.53 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 91.45 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 91.31 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 91.14 | |
| 2i9e_A | 259 | Triosephosphate isomerase; 2.00A {Tenebrio molitor | 91.12 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 91.09 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 90.95 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 90.93 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 90.74 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 90.7 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 90.7 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 90.6 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 90.52 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 90.47 | |
| 1mo0_A | 275 | TIM, triosephosphate isomerase; structural genomic | 90.42 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 90.3 | |
| 3krs_A | 271 | Triosephosphate isomerase; ssgcid, SBRI, emerald b | 90.12 | |
| 2oz8_A | 389 | MLL7089 protein; structural genomics, unknown func | 90.02 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 90.0 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 89.87 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 89.86 | |
| 3s6d_A | 310 | Putative triosephosphate isomerase; seattle struct | 89.84 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 89.73 | |
| 1nvm_A | 345 | HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered | 89.64 | |
| 2vxn_A | 251 | Triosephosphate isomerase; fatty acid biosynthesis | 89.41 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 89.27 | |
| 3qst_A | 255 | Triosephosphate isomerase, putative; TIM barrel; 1 | 89.04 | |
| 3iv3_A | 332 | Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p | 88.96 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 88.84 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 88.81 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 88.51 | |
| 3m6y_A | 275 | 4-hydroxy-2-oxoglutarate aldolase; structural geno | 88.38 | |
| 3ih5_A | 217 | Electron transfer flavoprotein alpha-subunit; alph | 88.36 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 88.34 | |
| 1r2r_A | 248 | TIM, triosephosphate isomerase; closed loop confor | 88.33 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 88.25 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 87.98 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 87.93 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 87.91 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 87.86 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 87.85 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 87.7 | |
| 1p1x_A | 260 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 87.69 | |
| 1m6j_A | 261 | TIM, TPI, triosephosphate isomerase; asymmetry, mo | 87.66 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 87.66 | |
| 3ta6_A | 267 | Triosephosphate isomerase; HET: FLC; 1.41A {Mycoba | 87.57 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 87.49 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 87.39 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 87.36 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 87.33 | |
| 1ney_A | 247 | TIM, triosephosphate isomerase; yeast, DHAP, dihyd | 86.88 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 86.84 | |
| 2zad_A | 345 | Muconate cycloisomerase; muconate lactonizing enzy | 86.82 | |
| 4g1k_A | 272 | Triosephosphate isomerase; structural genomics, se | 86.81 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 86.52 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 86.33 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 86.06 | |
| 2ovl_A | 371 | Putative racemase; structural genomics, PSI-2, pro | 85.94 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 85.83 | |
| 3m0z_A | 249 | Putative aldolase; MCSG, PSI-2, structural genomic | 85.54 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 85.38 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 85.35 | |
| 1mxs_A | 225 | KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a | 85.34 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 85.33 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 85.12 | |
| 1mdl_A | 359 | Mandelate racemase; isomerase, mandelate pathway, | 85.1 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 85.0 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 84.68 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 84.41 | |
| 1vkf_A | 188 | Glycerol uptake operon antiterminator-related Pro; | 84.4 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 84.39 | |
| 2qgy_A | 391 | Enolase from the environmental genome shotgun sequ | 84.38 | |
| 2a4a_A | 281 | Deoxyribose-phosphate aldolase; lyase, TIM beta/al | 84.32 | |
| 1rvk_A | 382 | Isomerase/lactonizing enzyme; enolase superfamily, | 84.31 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 84.26 | |
| 3r0j_A | 250 | Possible two component system response transcript | 84.17 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 84.14 | |
| 2p8b_A | 369 | Mandelate racemase/muconate lactonizing enzyme fam | 84.0 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 83.96 | |
| 2og9_A | 393 | Mandelate racemase/muconate lactonizing enzyme; NY | 83.96 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 83.95 | |
| 1nu5_A | 370 | Chloromuconate cycloisomerase; enzyme, dehalogenat | 83.94 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 83.58 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 83.31 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 83.23 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 82.91 | |
| 2v5b_A | 244 | Triosephosphate isomerase; TIM, unfolding, monotct | 82.89 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 82.82 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 82.42 | |
| 3kxq_A | 275 | Triosephosphate isomerase; ssgcid, NIH, niaid, SBR | 82.36 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 82.32 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 82.17 | |
| 2hzg_A | 401 | Mandelate racemase/muconate lactonizing enzyme/EN | 82.1 | |
| 2nql_A | 388 | AGR_PAT_674P, isomerase/lactonizing enzyme; enolas | 82.05 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 81.84 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 81.75 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 81.66 | |
| 2gl5_A | 410 | Putative dehydratase protein; structural genomics, | 81.45 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 81.38 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 81.34 | |
| 1tkk_A | 366 | Similar to chloromuconate cycloisomerase; epimeras | 81.17 | |
| 3e96_A | 316 | Dihydrodipicolinate synthase; structural genomics, | 81.16 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 80.91 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 80.88 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 80.84 | |
| 2qde_A | 397 | Mandelate racemase/muconate lactonizing enzyme FA | 80.72 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 80.72 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 80.37 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 80.31 | |
| 1tzz_A | 392 | Hypothetical protein L1841; structural genomics, m | 80.1 |
| >3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A | Back alignment and structure |
|---|
Probab=99.92 E-value=2.2e-25 Score=150.06 Aligned_cols=81 Identities=59% Similarity=1.068 Sum_probs=77.5
Q ss_pred CccCCCCCCCCCCcchHHHHHHHHHhCCCCcEEEEcCCCcccHHHHHHcCCCEEEEeccccCCCCHHHHHHHHHHHHHHh
Q psy11601 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAVINCPDRIQAISTLKSSVQKY 80 (82)
Q Consensus 1 m~v~pG~~gq~~~~~~~~ki~~~~~~~~~~~i~~dGGI~~~ni~~~~~~Gad~vv~gs~i~~~~d~~~~~~~l~~~~~~~ 80 (82)
|+|+|||+||+|.|+.++||+++++..++++|+|||||+++|++++.++|||++|+||+||+++||++++++|++.+++.
T Consensus 141 msv~pGf~Gq~f~~~~l~ki~~lr~~~~~~~I~VdGGI~~~t~~~~~~aGAd~~VvGsaIf~a~dp~~~~~~l~~~~~~~ 220 (228)
T 3ovp_A 141 MTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEA 220 (228)
T ss_dssp ESSCTTTCSCCCCGGGHHHHHHHHHHCTTCEEEEESSCSTTTHHHHHHHTCCEEEESHHHHTCSCHHHHHHHHHHHHHHH
T ss_pred eeecCCCCCcccCHHHHHHHHHHHHhcCCCCEEEeCCcCHHHHHHHHHcCCCEEEEeHHHhCCCCHHHHHHHHHHHHHHH
Confidence 79999999999999999999999998878999999999999999999999999999999999999999999999988776
Q ss_pred h
Q psy11601 81 L 81 (82)
Q Consensus 81 ~ 81 (82)
+
T Consensus 221 ~ 221 (228)
T 3ovp_A 221 A 221 (228)
T ss_dssp H
T ss_pred H
Confidence 4
|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* | Back alignment and structure |
|---|
| >3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} | Back alignment and structure |
|---|
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* | Back alignment and structure |
|---|
| >2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* | Back alignment and structure |
|---|
| >1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A | Back alignment and structure |
|---|
| >3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A | Back alignment and structure |
|---|
| >1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* | Back alignment and structure |
|---|
| >2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* | Back alignment and structure |
|---|
| >3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... | Back alignment and structure |
|---|
| >3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A | Back alignment and structure |
|---|
| >1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A | Back alignment and structure |
|---|
| >1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A | Back alignment and structure |
|---|
| >2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* | Back alignment and structure |
|---|
| >1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >3eww_A Ompdecase, orotidine-5'-phosphate decarboxylase; TIM barrel, unusual catalysis, disease mutati glycosyltransferase, lyase, multifunctional enzyme; HET: U1P; 1.10A {Homo sapiens} PDB: 2qcl_A* 2qcm_A* 3ewu_A* 2qcf_A* 3ex6_A* 3ex4_A* 2qcd_A* 2qcc_A 2qcg_A* 2qch_A* 2qcn_A* 2qce_A* 3ewz_A* 3ex1_A* 3ex2_A* 3ex3_A* 3ex0_A* 3ex5_A* 3l0k_A* 3l0n_A* ... | Back alignment and structure |
|---|
| >3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A | Back alignment and structure |
|---|
| >2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2fds_A Orotidine-monophosphate-decarboxylase; TIM barrel, structural genomics, structural genomics consortium, SGC, unknown function; 1.72A {Plasmodium berghei} SCOP: c.1.2.3 PDB: 2aqw_A | Back alignment and structure |
|---|
| >3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} | Back alignment and structure |
|---|
| >2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >3g3d_A UMP synthase, uridine 5'-monophosphate synthase; C-terminal domain, orotidine 5'-monophosphate decarboxylase, human, 5-fluoro-6-azido-UMP; HET: 5FU; 1.70A {Homo sapiens} PDB: 3bvj_A* 3mw7_A* 4hib_A* 4hkp_A* 2p1f_A 2eaw_A 3bgg_A* 3bgj_A* | Back alignment and structure |
|---|
| >2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A | Back alignment and structure |
|---|
| >3gdm_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, K93R mutant, lyase, phosphoprotein; 1.60A {Saccharomyces cerevisiae} SCOP: c.1.2.3 PDB: 3gdl_A* 3gdk_A* 3gdt_A* 3gdr_A* 1dqw_A 1dqx_A* | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3n3m_A Orotidine 5'-phosphate decarboxylase; P. falciparum, 5'-monophosphate decarboxylase, 6- UMP, lyase; HET: PGE NUP; 1.47A {Plasmodium falciparum} SCOP: c.1.2.3 PDB: 2qaf_A* 3bar_A* 2q8z_A* 3mwa_A* 3n2m_A* 3bpw_A* 3n34_A* 3s9y_A* 2f84_A 2q8l_A 2za1_A* 2za2_A 2za3_A* 2zcg_A 3vi2_A* | Back alignment and structure |
|---|
| >4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A | Back alignment and structure |
|---|
| >4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A | Back alignment and structure |
|---|
| >1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... | Back alignment and structure |
|---|
| >1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* | Back alignment and structure |
|---|
| >3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* | Back alignment and structure |
|---|
| >2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI; 2.00A {Enterococcus faecalis} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* | Back alignment and structure |
|---|
| >4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A | Back alignment and structure |
|---|
| >3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* | Back alignment and structure |
|---|
| >1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 | Back alignment and structure |
|---|
| >2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A | Back alignment and structure |
|---|
| >3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >3m6y_A 4-hydroxy-2-oxoglutarate aldolase; structural genomics, MCSG, lyase, PSI-2, protein structure initiative; HET: MSE; 1.45A {Bacillus cereus} PDB: 3n73_A 3mux_A | Back alignment and structure |
|---|
| >3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A | Back alignment and structure |
|---|
| >1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >3ta6_A Triosephosphate isomerase; HET: FLC; 1.41A {Mycobacterium tuberculosis} SCOP: c.1.1.0 PDB: 3tao_A* 3gvg_A | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A | Back alignment and structure |
|---|
| >4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >3m0z_A Putative aldolase; MCSG, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, lyase; HET: MSE; 1.20A {Klebsiella pneumoniae subsp} PDB: 3nzr_A 3lm7_A | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} | Back alignment and structure |
|---|
| >2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A | Back alignment and structure |
|---|
| >3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 82 | ||||
| d1h1ya_ | 220 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {R | 6e-22 | |
| d1rpxa_ | 230 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P | 3e-21 | |
| d1tqxa_ | 221 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P | 7e-21 | |
| d1tqja_ | 221 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {S | 5e-20 | |
| d2flia1 | 217 | c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimera | 3e-17 | |
| d1q6oa_ | 213 | c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarbo | 8e-17 | |
| d2czda1 | 206 | c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decar | 1e-05 | |
| d1o4ua1 | 170 | c.1.17.1 (A:104-273) Quinolinic acid phosphoribosy | 7e-05 | |
| d1km4a_ | 212 | c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl | 0.002 |
| >d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Length = 220 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Ribulose-phoshate binding barrel family: D-ribulose-5-phosphate 3-epimerase domain: D-ribulose-5-phosphate 3-epimerase species: Rice (Oryza sativa) [TaxId: 4530]
Score = 82.6 bits (203), Expect = 6e-22
Identities = 46/79 (58%), Positives = 61/79 (77%)
Query: 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAV 60
MTVEPGFGGQKFM +MM KV+ LR+ YP+L+IEVDGG+GP+TID A AGAN IV+G+++
Sbjct: 140 MTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSI 199
Query: 61 INCPDRIQAISTLKSSVQK 79
+ + IS L+ SV+
Sbjct: 200 FGAAEPGEVISALRKSVEG 218
|
| >d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 230 | Back information, alignment and structure |
|---|
| >d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Length = 221 | Back information, alignment and structure |
|---|
| >d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 221 | Back information, alignment and structure |
|---|
| >d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Length = 217 | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Length = 206 | Back information, alignment and structure |
|---|
| >d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 170 | Back information, alignment and structure |
|---|
| >d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 212 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| d1tqxa_ | 221 | D-ribulose-5-phosphate 3-epimerase {Plasmodium fal | 99.94 | |
| d1h1ya_ | 220 | D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa | 99.94 | |
| d2flia1 | 217 | D-ribulose-5-phosphate 3-epimerase {Streptococcus | 99.91 | |
| d1rpxa_ | 230 | D-ribulose-5-phosphate 3-epimerase {Potato (Solanu | 99.91 | |
| d1tqja_ | 221 | D-ribulose-5-phosphate 3-epimerase {Synechocystis | 99.9 | |
| d1q6oa_ | 213 | 3-keto-L-gulonate 6-phosphate decarboxylase {Esche | 99.63 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 99.53 | |
| d2tpsa_ | 226 | Thiamin phosphate synthase {Bacillus subtilis [Tax | 99.36 | |
| d2czda1 | 206 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.91 | |
| d1qpoa1 | 169 | Quinolinic acid phosphoribosyltransferase (Nicotin | 98.8 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 98.78 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.78 | |
| d1o4ua1 | 170 | Quinolinic acid phosphoribosyltransferase (Nicotin | 98.75 | |
| d1km4a_ | 212 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.7 | |
| d1w0ma_ | 226 | Triosephosphate isomerase {Thermoproteus tenax [Ta | 98.59 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.49 | |
| d1eixa_ | 231 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.48 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 98.45 | |
| d1qapa1 | 167 | Quinolinic acid phosphoribosyltransferase (Nicotin | 98.44 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 98.44 | |
| d1dbta_ | 237 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.43 | |
| d1hg3a_ | 224 | Triosephosphate isomerase {Archaeon Pyrococcus woe | 98.32 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 98.28 | |
| d1rd5a_ | 261 | Trp synthase alpha-subunit {Maize (Zea mays) [TaxI | 98.18 | |
| d1znna1 | 254 | Pyridoxal biosynthesis lyase PdxS {Bacillus stearo | 98.17 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 98.13 | |
| d1geqa_ | 248 | Trp synthase alpha-subunit {Archaeon Pyrococcus fu | 98.02 | |
| d1qopa_ | 267 | Trp synthase alpha-subunit {Salmonella typhimurium | 97.93 | |
| d1wv2a_ | 243 | Thiazole biosynthesis protein ThiG {Pseudomonas ae | 97.89 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 97.81 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 97.63 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 97.6 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 97.58 | |
| d1viza_ | 229 | PcrB protein homolog YerE {Bacillus subtilis [TaxI | 97.51 | |
| d1dqwa_ | 267 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 97.5 | |
| d1ojxa_ | 251 | Archaeal fructose 1,6-bisphosphate aldolase {Archa | 97.49 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.33 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 97.32 | |
| d1tv5a1 | 409 | Dihydroorotate dehydrogenase {Plasmodium falciparu | 97.31 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.25 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.24 | |
| d2f6ua1 | 231 | (S)-3-O-geranylgeranylglyceryl phosphate synthase | 97.24 | |
| d1vqta1 | 198 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 97.17 | |
| d1f76a_ | 336 | Dihydroorotate dehydrogenase {Escherichia coli [Ta | 97.13 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.1 | |
| d2ffca1 | 332 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 97.09 | |
| d1ujpa_ | 271 | Trp synthase alpha-subunit {Thermus thermophilus [ | 97.09 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.07 | |
| d1i4na_ | 251 | Indole-3-glycerophosphate synthase, IPGS {Thermoto | 97.01 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 97.0 | |
| d1vc4a_ | 254 | Indole-3-glycerophosphate synthase, IPGS {Thermus | 96.93 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.88 | |
| d1piia1 | 198 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {E | 96.84 | |
| d1piia2 | 254 | Indole-3-glycerophosphate synthase, IPGS {Escheric | 96.8 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.75 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.73 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.73 | |
| d1djqa1 | 340 | Trimethylamine dehydrogenase, N-terminal domain {M | 96.69 | |
| d2q8za1 | 323 | Protozoan orotidine monophosphate decarboxylase {P | 96.63 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 96.61 | |
| d1q45a_ | 380 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 96.61 | |
| d1gwja_ | 374 | Morphinone reductase {Pseudomonas putida [TaxId: 3 | 96.6 | |
| d1vhna_ | 305 | Putative flavin oxidoreducatase TM0096 {Thermotoga | 96.55 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 96.54 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 96.54 | |
| d1icpa_ | 364 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 96.5 | |
| d1twda_ | 247 | Copper homeostasis protein CutC {Shigella flexneri | 96.4 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.38 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.32 | |
| d1nsja_ | 205 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {T | 96.14 | |
| d1vyra_ | 363 | Pentaerythritol tetranirate reductase {Enterobacte | 95.99 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 95.98 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 95.95 | |
| d2fdsa1 | 324 | Protozoan orotidine monophosphate decarboxylase {P | 95.94 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 95.81 | |
| d1to3a_ | 291 | Putative aldolase YihT {Salmonella typhimurium [Ta | 95.62 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 95.44 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 95.3 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 95.23 | |
| d2cu0a1 | 368 | Inosine monophosphate dehydrogenase (IMPDH) {Pyroc | 95.22 | |
| d1v5xa_ | 200 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {T | 95.2 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 95.16 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 94.96 | |
| d1ytda1 | 270 | Nicotinate phosphoribosyltransferase Ta1145 {Therm | 94.85 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 94.74 | |
| d2i14a1 | 279 | Nicotinate-nucleotide pyrophosphorylase PF1904 {Py | 94.61 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 94.17 | |
| d1oyaa_ | 399 | Old yellow enzyme (OYE) {Lager yeast (Saccharomyce | 93.92 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 93.85 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 93.79 | |
| d1n7ka_ | 234 | Deoxyribose-phosphate aldolase DeoC {Archaeon Aero | 93.65 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 93.63 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 93.45 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 93.32 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 93.29 | |
| d1mzha_ | 225 | Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli | 93.14 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 93.03 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 92.9 | |
| d2f7fa1 | 345 | Putative nicotinate phosphoribosyltransferase EF26 | 92.52 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 91.95 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 91.95 | |
| d1dxea_ | 253 | 2-dehydro-3-deoxy-galactarate aldolase {Escherichi | 91.92 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 91.81 | |
| d1izca_ | 299 | Macrophomate synthase {Macrophoma commelinae [TaxI | 91.77 | |
| d1o0ya_ | 251 | Deoxyribose-phosphate aldolase DeoC {Thermotoga ma | 91.59 | |
| d7reqb2 | 163 | Methylmalonyl-CoA mutase beta subunit, C-terminal | 91.39 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 90.97 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 90.93 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 90.92 | |
| d1ub3a_ | 211 | Deoxyribose-phosphate aldolase DeoC {Thermus therm | 90.88 | |
| d2z06a1 | 252 | Hypothetical protein TTHA0625 {Thermus thermophilu | 90.8 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 90.74 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 90.72 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 90.36 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 90.25 | |
| d5ruba1 | 320 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {R | 90.15 | |
| d1t70a_ | 255 | Putative phosphatase DR1281 {Deinococcus radiodura | 90.01 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 89.69 | |
| d1trea_ | 255 | Triosephosphate isomerase {Escherichia coli [TaxId | 89.54 | |
| d1m6ja_ | 260 | Triosephosphate isomerase {Entamoeba histolytica [ | 89.21 | |
| d2btma_ | 251 | Triosephosphate isomerase {Bacillus stearothermoph | 89.09 | |
| d1ykwa1 | 283 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {C | 88.51 | |
| d1vpxa_ | 218 | Decameric fructose-6-phosphate aldolase/transaldol | 88.46 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 87.02 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 87.0 | |
| d1o5xa_ | 246 | Triosephosphate isomerase {Plasmodium falciparum [ | 86.65 | |
| d1n55a_ | 249 | Triosephosphate isomerase {Leishmania mexicana [Ta | 86.49 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 86.39 | |
| d1t71a_ | 281 | Hypothetical protein MPN349 {Mycoplasma pneumoniae | 86.37 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 86.27 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 86.06 | |
| d1l6wa_ | 220 | Decameric fructose-6-phosphate aldolase/transaldol | 86.03 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 86.0 | |
| d1kv5a_ | 249 | Triosephosphate isomerase {Trypanosoma brucei [Tax | 85.81 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 85.7 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 85.51 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 84.74 | |
| d2a4aa1 | 256 | Fructose-1,6-bisphosphate aldolase {Plasmodium yoe | 84.5 | |
| d1aw1a_ | 255 | Triosephosphate isomerase {Vibrio marinus [TaxId: | 84.05 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 83.45 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 83.34 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 82.97 | |
| d1mqsa_ | 653 | Sly1P protein {Baker's yeast (Saccharomyces cerevi | 81.49 | |
| d1mo0a_ | 257 | Triosephosphate isomerase {Nematode (Caenorhabditi | 81.17 | |
| d1rvga_ | 305 | Fructose-bisphosphate aldolase (FBP aldolase) {The | 81.02 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 80.07 |
| >d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Ribulose-phoshate binding barrel family: D-ribulose-5-phosphate 3-epimerase domain: D-ribulose-5-phosphate 3-epimerase species: Plasmodium falciparum [TaxId: 5833]
Probab=99.94 E-value=1.8e-27 Score=158.06 Aligned_cols=80 Identities=56% Similarity=0.880 Sum_probs=78.0
Q ss_pred CccCCCCCCCCCCcchHHHHHHHHHhCCCCcEEEEcCCCcccHHHHHHcCCCEEEEeccccCCCCHHHHHHHHHHHHHHh
Q psy11601 1 MTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKAGANWIVSGTAVINCPDRIQAISTLKSSVQKY 80 (82)
Q Consensus 1 m~v~pG~~gq~~~~~~~~ki~~~~~~~~~~~i~~dGGI~~~ni~~~~~~Gad~vv~gs~i~~~~d~~~~~~~l~~~~~~~ 80 (82)
|+|+|||+||+|.++.++||+++|+.++++.|+||||||.+|++.+.++|||.+|+||+||+++|+++++++||+.++++
T Consensus 142 m~V~pG~~GQ~f~~~~l~KI~~lr~~~~~~~I~VDGGIn~~~i~~l~~aGad~iV~GS~if~~~d~~~~i~~Lr~~i~k~ 221 (221)
T d1tqxa_ 142 MTVEPGFGGQSFMHDMMGKVSFLRKKYKNLNIQVDGGLNIETTEISASHGANIIVAGTSIFNAEDPKYVIDTMRVSVQKY 221 (221)
T ss_dssp ESSCTTCSSCCCCGGGHHHHHHHHHHCTTCEEEEESSCCHHHHHHHHHHTCCEEEESHHHHTCSSHHHHHHHHHHHHHHC
T ss_pred EeecccccccccCcchhHHHHHHHHhcCCcceEEEcccCHHhHHHHHHcCCCEEEEChHHHCCCCHHHHHHHHHHHHhhC
Confidence 89999999999999999999999999989999999999999999999999999999999999999999999999999875
|
| >d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2q8za1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]} | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} | Back information, alignment and structure |
|---|
| >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d5ruba1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1mqsa_ e.25.1.1 (A:) Sly1P protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|