Psyllid ID: psy11602
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1083 | ||||||
| 328711565 | 232 | PREDICTED: seryl-tRNA synthetase, cytopl | 0.204 | 0.956 | 0.803 | 1e-106 | |
| 328712780 | 489 | PREDICTED: seryl-tRNA synthetase, cytopl | 0.211 | 0.468 | 0.773 | 1e-105 | |
| 91086675 | 499 | PREDICTED: similar to seryl-tRNA synthet | 0.216 | 0.470 | 0.709 | 1e-96 | |
| 270010395 | 529 | hypothetical protein TcasGA2_TC009786 [T | 0.216 | 0.444 | 0.709 | 2e-96 | |
| 195433819 | 502 | GK14956 [Drosophila willistoni] gi|19416 | 0.204 | 0.440 | 0.725 | 9e-95 | |
| 427797879 | 566 | Putative seryl-trna synthetase, partial | 0.214 | 0.409 | 0.706 | 1e-94 | |
| 156552806 | 494 | PREDICTED: seryl-tRNA synthetase, cytopl | 0.216 | 0.475 | 0.705 | 1e-94 | |
| 195386010 | 501 | GJ10873 [Drosophila virilis] gi|19414815 | 0.204 | 0.443 | 0.722 | 1e-94 | |
| 427789377 | 498 | Putative seryl-trna synthetase [Rhipicep | 0.214 | 0.465 | 0.706 | 1e-94 | |
| 58389688 | 503 | AGAP008265-PA [Anopheles gambiae str. PE | 0.205 | 0.443 | 0.722 | 1e-94 |
| >gi|328711565|ref|XP_003244573.1| PREDICTED: seryl-tRNA synthetase, cytoplasmic-like, partial [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 392 bits (1007), Expect = e-106, Method: Compositional matrix adjust.
Identities = 188/234 (80%), Positives = 206/234 (88%), Gaps = 12/234 (5%)
Query: 19 DDKYLIATSEQPICAVHRDSWLPEASLPIRYLGVSTCFRQEVGSHGRDTRGIFRVHQFEK 78
DDKYLIATSEQPI A+HRD WLPEAS PIRYLGVSTCFRQEVGSHGRDTRGIFRVHQFEK
Sbjct: 1 DDKYLIATSEQPIAALHRDQWLPEASFPIRYLGVSTCFRQEVGSHGRDTRGIFRVHQFEK 60
Query: 79 VEQFVLTSPHDDESWKMLDEMIQNSEEFYADLGIAYRVVNIVSGALNHAAAKKLDLEAWF 138
VEQFVLTSP D++SW + DEMI NS +FY DLGIAYRVVNIVSGALNHAAAKKLDLEAWF
Sbjct: 61 VEQFVLTSPFDNQSWILFDEMINNSRQFYDDLGIAYRVVNIVSGALNHAAAKKLDLEAWF 120
Query: 139 PGSGAFRELVSCSNCLDYQSRRLLVRYGQTKQ---------KIYATACATTRVICAILET 189
PGSGAFRELVSCSNCLDYQSRRLLVRYGQTK+ + ATACATTRVICAILET
Sbjct: 121 PGSGAFRELVSCSNCLDYQSRRLLVRYGQTKKMNEKVDYVHMLNATACATTRVICAILET 180
Query: 190 HQTETGVRIPDCLRKFVPAVYLNEAGEIPFVKTAPIDEEETKKQKKQKEGMKKK 243
+QTETG+++P+ L+K++P Y + EIPFVK+APIDEE+TKKQKKQKEGMK K
Sbjct: 181 YQTETGIKVPEILKKYLPTRYQD---EIPFVKSAPIDEEDTKKQKKQKEGMKNK 231
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328712780|ref|XP_001945803.2| PREDICTED: seryl-tRNA synthetase, cytoplasmic-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91086675|ref|XP_968460.1| PREDICTED: similar to seryl-tRNA synthetase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270010395|gb|EFA06843.1| hypothetical protein TcasGA2_TC009786 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195433819|ref|XP_002064904.1| GK14956 [Drosophila willistoni] gi|194160989|gb|EDW75890.1| GK14956 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|427797879|gb|JAA64391.1| Putative seryl-trna synthetase, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|156552806|ref|XP_001599572.1| PREDICTED: seryl-tRNA synthetase, cytoplasmic-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195386010|ref|XP_002051697.1| GJ10873 [Drosophila virilis] gi|194148154|gb|EDW63852.1| GJ10873 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|427789377|gb|JAA60140.1| Putative seryl-trna synthetase [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|58389688|ref|XP_317207.2| AGAP008265-PA [Anopheles gambiae str. PEST] gi|55237426|gb|EAA12316.2| AGAP008265-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1083 | ||||||
| FB|FBgn0031497 | 501 | CG17259 [Drosophila melanogast | 0.202 | 0.437 | 0.710 | 1.1e-85 | |
| UNIPROTKB|Q5T5C7 | 536 | SARS "Serine--tRNA ligase, cyt | 0.153 | 0.309 | 0.729 | 3.9e-83 | |
| FB|FBgn0031606 | 1008 | CG15439 [Drosophila melanogast | 0.066 | 0.071 | 0.708 | 8.1e-81 | |
| RGD|628813 | 512 | Sars "seryl-tRNA synthetase" [ | 0.201 | 0.425 | 0.682 | 1.2e-79 | |
| UNIPROTKB|Q6P799 | 512 | Sars "Serine--tRNA ligase, cyt | 0.201 | 0.425 | 0.682 | 1.2e-79 | |
| MGI|MGI:102809 | 512 | Sars "seryl-aminoacyl-tRNA syn | 0.202 | 0.427 | 0.668 | 2e-79 | |
| UNIPROTKB|F1S5Z3 | 514 | SARS "Uncharacterized protein" | 0.202 | 0.426 | 0.668 | 2.6e-79 | |
| UNIPROTKB|Q9GMB8 | 514 | SARS "Serine--tRNA ligase, cyt | 0.202 | 0.426 | 0.659 | 8.7e-79 | |
| UNIPROTKB|P49591 | 514 | SARS "Serine--tRNA ligase, cyt | 0.202 | 0.426 | 0.659 | 8.7e-79 | |
| UNIPROTKB|E2R4D5 | 513 | SARS "Uncharacterized protein" | 0.202 | 0.426 | 0.659 | 1.1e-78 |
| FB|FBgn0031497 CG17259 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 857 (306.7 bits), Expect = 1.1e-85, P = 1.1e-85
Identities = 167/235 (71%), Positives = 196/235 (83%)
Query: 1 VIGKGEKVGDSAPEKDELDDKYLIATSEQPICAVHRDSWLPEASLPIRYLGVSTCFRQEV 60
V+GKG + E+ +D+KYLIATSEQPI A HRD WLPE+SLPI+Y G+STCFRQEV
Sbjct: 251 VVGKGSEKA----EEVGIDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLSTCFRQEV 306
Query: 61 GSHGRDTRGIFRVHQFEKVEQFVLTSPHDDESWKMLDEMIQNSEEFYADLGIAYRVVNIV 120
GSHGRDTRGIFRVHQFEKVEQFVLTSPHD++SW+M+DEMI N+E+F LGI YRVVNIV
Sbjct: 307 GSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRVVNIV 366
Query: 121 SGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLDYQSRRLLVRYGQTKQK--------- 171
SGALNHAA+KKLDLEAWF GSGA+RELVSCSNCLDYQ+RRLLVR+GQTK+
Sbjct: 367 SGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVDYVHM 426
Query: 172 IYATACATTRVICAILETHQTETGVRIPDCLRKFVPAVYLNEAGEIPFVKTAPID 226
+ AT CA TRVICAILETHQTETG+++P+ L+K++PA + +E IPFVK APID
Sbjct: 427 LNATMCAATRVICAILETHQTETGIKVPEPLKKYMPAKFQDE---IPFVKPAPID 478
|
|
| UNIPROTKB|Q5T5C7 SARS "Serine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031606 CG15439 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|628813 Sars "seryl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P799 Sars "Serine--tRNA ligase, cytoplasmic" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:102809 Sars "seryl-aminoacyl-tRNA synthetase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S5Z3 SARS "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GMB8 SARS "Serine--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49591 SARS "Serine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4D5 SARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1083 | |||
| PLN02678 | 448 | PLN02678, PLN02678, seryl-tRNA synthetase | 1e-113 | |
| cd00770 | 297 | cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) | 1e-106 | |
| PLN02678 | 448 | PLN02678, PLN02678, seryl-tRNA synthetase | 2e-84 | |
| PRK05431 | 425 | PRK05431, PRK05431, seryl-tRNA synthetase; Provisi | 1e-80 | |
| cd00770 | 297 | cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) | 3e-80 | |
| TIGR00414 | 418 | TIGR00414, serS, seryl-tRNA synthetase | 6e-79 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 3e-78 | |
| PRK05431 | 425 | PRK05431, PRK05431, seryl-tRNA synthetase; Provisi | 7e-61 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 4e-60 | |
| TIGR00414 | 418 | TIGR00414, serS, seryl-tRNA synthetase | 3e-58 | |
| PLN02320 | 502 | PLN02320, PLN02320, seryl-tRNA synthetase | 6e-48 | |
| PLN02320 | 502 | PLN02320, PLN02320, seryl-tRNA synthetase | 1e-35 | |
| pfam00587 | 171 | pfam00587, tRNA-synt_2b, tRNA synthetase class II | 3e-32 | |
| pfam00587 | 171 | pfam00587, tRNA-synt_2b, tRNA synthetase class II | 1e-18 | |
| PLN02678 | 448 | PLN02678, PLN02678, seryl-tRNA synthetase | 2e-16 | |
| cd00770 | 297 | cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) | 7e-16 | |
| cd00670 | 235 | cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro | 9e-16 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 2e-15 | |
| PRK05431 | 425 | PRK05431, PRK05431, seryl-tRNA synthetase; Provisi | 1e-10 | |
| TIGR00414 | 418 | TIGR00414, serS, seryl-tRNA synthetase | 3e-10 | |
| pfam13832 | 109 | pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma | 8e-10 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 7e-09 | |
| cd00768 | 211 | cd00768, class_II_aaRS-like_core, Class II tRNA am | 6e-08 | |
| pfam00587 | 171 | pfam00587, tRNA-synt_2b, tRNA synthetase class II | 7e-06 | |
| PLN02320 | 502 | PLN02320, PLN02320, seryl-tRNA synthetase | 1e-05 | |
| cd00670 | 235 | cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro | 2e-05 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 2e-05 | |
| pfam13771 | 89 | pfam13771, zf-HC5HC2H, PHD-like zinc-binding domai | 4e-05 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 5e-05 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 7e-05 | |
| pfam13831 | 33 | pfam13831, PHD_2, PHD-finger | 9e-05 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 1e-04 | |
| pfam13832 | 109 | pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma | 2e-04 | |
| cd00768 | 211 | cd00768, class_II_aaRS-like_core, Class II tRNA am | 0.001 |
| >gnl|CDD|215364 PLN02678, PLN02678, seryl-tRNA synthetase | Back alignment and domain information |
|---|
Score = 359 bits (922), Expect = e-113
Identities = 139/231 (60%), Positives = 167/231 (72%), Gaps = 17/231 (7%)
Query: 17 ELDDKYLIATSEQPICAVHRDSWLPEASLPIRYLGVSTCFRQEVGSHGRDTRGIFRVHQF 76
E DDKYLIATSEQP+CA HR W+ LPIRY G STCFR+E GSHGRDT GIFRVHQF
Sbjct: 226 EGDDKYLIATSEQPLCAYHRGDWIDPKELPIRYAGYSTCFRKEAGSHGRDTLGIFRVHQF 285
Query: 77 EKVEQFVLTSPHDDESWKMLDEMIQNSEEFYADLGIAYRVVNIVSGALNHAAAKKLDLEA 136
EKVEQF +TSP+ +ESW+M +EM++NSE+FY LGI Y+VV+IVSGALN AAAKK DLEA
Sbjct: 286 EKVEQFCITSPNGNESWEMHEEMLKNSEDFYQSLGIPYQVVSIVSGALNDAAAKKYDLEA 345
Query: 137 WFPGSGAFRELVSCSNCLDYQSRRLLVRYGQTKQ----KIY-----ATACATTRVICAIL 187
WFP S +RELVSCSNC DYQSRRL +RYGQ K K Y +T AT R +C IL
Sbjct: 346 WFPASKTYRELVSCSNCTDYQSRRLEIRYGQKKSNEQTKQYVHLLNSTLTATERTLCCIL 405
Query: 188 ETHQTETGVRIPDCLRKFVPAVYLNEAGEIPFVKTAPIDEEETKKQKKQKE 238
E +QTE GVR+P+ L+ F+ + +PF K P + K +KK+K+
Sbjct: 406 ENYQTEDGVRVPEVLQPFMGGIEF-----LPFKKKPP---AKGKGKKKKKK 448
|
Length = 448 |
| >gnl|CDD|238393 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215364 PLN02678, PLN02678, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235461 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238393 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235461 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|177954 PLN02320, PLN02320, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|177954 PLN02320, PLN02320, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) | Back alignment and domain information |
|---|
| >gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) | Back alignment and domain information |
|---|
| >gnl|CDD|215364 PLN02678, PLN02678, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|238393 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238359 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235461 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
| >gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) | Back alignment and domain information |
|---|
| >gnl|CDD|177954 PLN02320, PLN02320, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|238359 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|222368 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|222406 pfam13831, PHD_2, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1083 | |||
| KOG2509|consensus | 455 | 100.0 | ||
| KOG0957|consensus | 707 | 100.0 | ||
| PLN02678 | 448 | seryl-tRNA synthetase | 100.0 | |
| COG0172 | 429 | SerS Seryl-tRNA synthetase [Translation, ribosomal | 100.0 | |
| PLN02320 | 502 | seryl-tRNA synthetase | 100.0 | |
| KOG2509|consensus | 455 | 100.0 | ||
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 100.0 | |
| PLN02678 | 448 | seryl-tRNA synthetase | 100.0 | |
| COG0172 | 429 | SerS Seryl-tRNA synthetase [Translation, ribosomal | 100.0 | |
| PLN02320 | 502 | seryl-tRNA synthetase | 100.0 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 100.0 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 100.0 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 100.0 | |
| cd00770 | 297 | SerRS_core Seryl-tRNA synthetase (SerRS) class II | 100.0 | |
| cd00770 | 297 | SerRS_core Seryl-tRNA synthetase (SerRS) class II | 100.0 | |
| TIGR00409 | 568 | proS_fam_II prolyl-tRNA synthetase, family II. Pro | 100.0 | |
| COG0442 | 500 | ProS Prolyl-tRNA synthetase [Translation, ribosoma | 100.0 | |
| cd00779 | 255 | ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla | 100.0 | |
| PRK09194 | 565 | prolyl-tRNA synthetase; Provisional | 100.0 | |
| PRK00960 | 517 | seryl-tRNA synthetase; Provisional | 100.0 | |
| KOG2324|consensus | 457 | 100.0 | ||
| cd00772 | 264 | ProRS_core Prolyl-tRNA synthetase (ProRS) class II | 100.0 | |
| KOG0954|consensus | 893 | 100.0 | ||
| cd00779 | 255 | ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla | 100.0 | |
| cd00778 | 261 | ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) | 100.0 | |
| cd00772 | 264 | ProRS_core Prolyl-tRNA synthetase (ProRS) class II | 100.0 | |
| PRK08661 | 477 | prolyl-tRNA synthetase; Provisional | 100.0 | |
| KOG0956|consensus | 900 | 99.98 | ||
| PRK00960 | 517 | seryl-tRNA synthetase; Provisional | 99.98 | |
| TIGR00408 | 472 | proS_fam_I prolyl-tRNA synthetase, family I. Proly | 99.97 | |
| cd00778 | 261 | ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) | 99.97 | |
| KOG0955|consensus | 1051 | 99.95 | ||
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 99.95 | |
| PRK12325 | 439 | prolyl-tRNA synthetase; Provisional | 99.95 | |
| TIGR00415 | 520 | serS_MJ seryl-tRNA synthetase, Methanococcus janna | 99.94 | |
| KOG4163|consensus | 551 | 99.94 | ||
| PRK08661 | 477 | prolyl-tRNA synthetase; Provisional | 99.91 | |
| TIGR00415 | 520 | serS_MJ seryl-tRNA synthetase, Methanococcus janna | 99.91 | |
| PRK03991 | 613 | threonyl-tRNA synthetase; Validated | 99.9 | |
| PF00587 | 173 | tRNA-synt_2b: tRNA synthetase class II core domain | 99.89 | |
| TIGR00408 | 472 | proS_fam_I prolyl-tRNA synthetase, family I. Proly | 99.89 | |
| KOG1244|consensus | 336 | 99.88 | ||
| cd00670 | 235 | Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t | 99.87 | |
| cd00771 | 298 | ThrRS_core Threonyl-tRNA synthetase (ThrRS) class | 99.85 | |
| PLN02837 | 614 | threonine-tRNA ligase | 99.85 | |
| PRK03991 | 613 | threonyl-tRNA synthetase; Validated | 99.78 | |
| cd00670 | 235 | Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t | 99.78 | |
| cd00771 | 298 | ThrRS_core Threonyl-tRNA synthetase (ThrRS) class | 99.77 | |
| PRK12444 | 639 | threonyl-tRNA synthetase; Reviewed | 99.75 | |
| PRK04173 | 456 | glycyl-tRNA synthetase; Provisional | 99.75 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 99.69 | |
| TIGR00418 | 563 | thrS threonyl-tRNA synthetase. This model represen | 99.68 | |
| PF00587 | 173 | tRNA-synt_2b: tRNA synthetase class II core domain | 99.68 | |
| PLN02837 | 614 | threonine-tRNA ligase | 99.68 | |
| PRK12325 | 439 | prolyl-tRNA synthetase; Provisional | 99.63 | |
| PRK14799 | 545 | thrS threonyl-tRNA synthetase; Provisional | 99.62 | |
| PRK12305 | 575 | thrS threonyl-tRNA synthetase; Reviewed | 99.55 | |
| PLN02908 | 686 | threonyl-tRNA synthetase | 99.53 | |
| PRK09194 | 565 | prolyl-tRNA synthetase; Provisional | 99.51 | |
| PRK04173 | 456 | glycyl-tRNA synthetase; Provisional | 99.49 | |
| TIGR00409 | 568 | proS_fam_II prolyl-tRNA synthetase, family II. Pro | 99.47 | |
| cd00774 | 254 | GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik | 99.35 | |
| PRK14799 | 545 | thrS threonyl-tRNA synthetase; Provisional | 99.34 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 99.34 | |
| PRK12444 | 639 | threonyl-tRNA synthetase; Reviewed | 99.26 | |
| KOG1080|consensus | 1005 | 99.22 | ||
| TIGR00418 | 563 | thrS threonyl-tRNA synthetase. This model represen | 99.19 | |
| cd00768 | 211 | class_II_aaRS-like_core Class II tRNA amino-acyl s | 99.19 | |
| KOG2324|consensus | 457 | 99.18 | ||
| PLN02908 | 686 | threonyl-tRNA synthetase | 99.16 | |
| PRK12305 | 575 | thrS threonyl-tRNA synthetase; Reviewed | 99.14 | |
| COG0442 | 500 | ProS Prolyl-tRNA synthetase [Translation, ribosoma | 99.08 | |
| KOG1512|consensus | 381 | 99.06 | ||
| KOG0957|consensus | 707 | 98.96 | ||
| PRK07080 | 317 | hypothetical protein; Validated | 98.94 | |
| PLN02734 | 684 | glycyl-tRNA synthetase | 98.92 | |
| TIGR00389 | 551 | glyS_dimeric glycyl-tRNA synthetase, dimeric type. | 98.89 | |
| PRK14894 | 539 | glycyl-tRNA synthetase; Provisional | 98.85 | |
| KOG1244|consensus | 336 | 98.81 | ||
| COG0423 | 558 | GRS1 Glycyl-tRNA synthetase (class II) [Translatio | 98.79 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 98.78 | |
| COG0441 | 589 | ThrS Threonyl-tRNA synthetase [Translation, riboso | 98.73 | |
| cd00768 | 211 | class_II_aaRS-like_core Class II tRNA amino-acyl s | 98.72 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 98.68 | |
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 98.58 | |
| PRK07080 | 317 | hypothetical protein; Validated | 98.26 | |
| KOG4163|consensus | 551 | 98.12 | ||
| PRK14894 | 539 | glycyl-tRNA synthetase; Provisional | 98.03 | |
| COG0441 | 589 | ThrS Threonyl-tRNA synthetase [Translation, riboso | 97.97 | |
| KOG4443|consensus | 694 | 97.93 | ||
| cd00773 | 261 | HisRS-like_core Class II Histidinyl-tRNA synthetas | 97.93 | |
| PLN02734 | 684 | glycyl-tRNA synthetase | 97.9 | |
| KOG0825|consensus | 1134 | 97.86 | ||
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.84 | |
| TIGR00389 | 551 | glyS_dimeric glycyl-tRNA synthetase, dimeric type. | 97.73 | |
| KOG4443|consensus | 694 | 97.65 | ||
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.65 | |
| TIGR00442 | 397 | hisS histidyl-tRNA synthetase. This model finds a | 97.49 | |
| PRK09537 | 417 | pylS pyrolysyl-tRNA synthetase; Reviewed | 97.44 | |
| cd00774 | 254 | GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik | 97.42 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.41 | |
| KOG4323|consensus | 464 | 97.41 | ||
| PTZ00326 | 494 | phenylalanyl-tRNA synthetase alpha chain; Provisio | 97.4 | |
| KOG1637|consensus | 560 | 97.39 | ||
| KOG4323|consensus | 464 | 97.35 | ||
| PRK00037 | 412 | hisS histidyl-tRNA synthetase; Reviewed | 97.33 | |
| KOG1512|consensus | 381 | 97.33 | ||
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.29 | |
| CHL00201 | 430 | syh histidine-tRNA synthetase; Provisional | 97.21 | |
| COG0423 | 558 | GRS1 Glycyl-tRNA synthetase (class II) [Translatio | 97.19 | |
| PF01409 | 247 | tRNA-synt_2d: tRNA synthetases class II core domai | 97.03 | |
| PLN02853 | 492 | Probable phenylalanyl-tRNA synthetase alpha chain | 96.89 | |
| COG0124 | 429 | HisS Histidyl-tRNA synthetase [Translation, riboso | 96.89 | |
| PRK12420 | 423 | histidyl-tRNA synthetase; Provisional | 96.85 | |
| PLN02530 | 487 | histidine-tRNA ligase | 96.76 | |
| KOG4299|consensus | 613 | 96.63 | ||
| KOG0825|consensus | 1134 | 96.6 | ||
| TIGR02367 | 453 | PylS pyrrolysyl-tRNA synthetase. PylS is the archa | 96.58 | |
| TIGR00470 | 533 | sepS O-phosphoseryl-tRNA(Cys) synthetase. This fam | 96.27 | |
| KOG1637|consensus | 560 | 96.16 | ||
| PRK04172 | 489 | pheS phenylalanyl-tRNA synthetase subunit alpha; P | 96.15 | |
| COG0016 | 335 | PheS Phenylalanyl-tRNA synthetase alpha subunit [T | 95.76 | |
| KOG0955|consensus | 1051 | 95.7 | ||
| KOG1245|consensus | 1404 | 95.59 | ||
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 95.58 | |
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 95.27 | |
| KOG2298|consensus | 599 | 95.21 | ||
| TIGR00443 | 314 | hisZ_biosyn_reg ATP phosphoribosyltransferase, reg | 95.11 | |
| cd00669 | 269 | Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl | 95.09 | |
| PRK12292 | 391 | hisZ ATP phosphoribosyltransferase regulatory subu | 94.41 | |
| PRK00488 | 339 | pheS phenylalanyl-tRNA synthetase subunit alpha; V | 93.88 | |
| PRK09537 | 417 | pylS pyrolysyl-tRNA synthetase; Reviewed | 93.85 | |
| KOG0383|consensus | 696 | 93.66 | ||
| PRK12293 | 281 | hisZ ATP phosphoribosyltransferase regulatory subu | 93.37 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 93.01 | |
| PLN02972 | 763 | Histidyl-tRNA synthetase | 92.52 | |
| PRK12421 | 392 | ATP phosphoribosyltransferase regulatory subunit; | 92.48 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 91.45 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 91.21 | |
| PRK12295 | 373 | hisZ ATP phosphoribosyltransferase regulatory subu | 90.99 | |
| KOG4299|consensus | 613 | 90.41 | ||
| TIGR00468 | 294 | pheS phenylalanyl-tRNA synthetase, alpha subunit. | 89.99 | |
| KOG0954|consensus | 893 | 89.69 | ||
| KOG1973|consensus | 274 | 89.55 | ||
| PF13393 | 311 | tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI | 89.31 | |
| KOG1084|consensus | 375 | 88.82 | ||
| TIGR00459 | 583 | aspS_bact aspartyl-tRNA synthetase, bacterial type | 88.59 | |
| PLN02903 | 652 | aminoacyl-tRNA ligase | 88.49 | |
| PRK09350 | 306 | poxB regulator PoxA; Provisional | 88.48 | |
| KOG0956|consensus | 900 | 87.68 | ||
| COG0173 | 585 | AspS Aspartyl-tRNA synthetase [Translation, riboso | 87.29 | |
| PRK00476 | 588 | aspS aspartyl-tRNA synthetase; Validated | 84.93 | |
| KOG1246|consensus | 904 | 83.44 | ||
| cd00773 | 261 | HisRS-like_core Class II Histidinyl-tRNA synthetas | 83.42 | |
| PRK12820 | 706 | bifunctional aspartyl-tRNA synthetase/aspartyl/glu | 82.52 | |
| KOG1973|consensus | 274 | 81.28 | ||
| PRK00484 | 491 | lysS lysyl-tRNA synthetase; Reviewed | 80.25 |
| >KOG2509|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-71 Score=617.86 Aligned_cols=258 Identities=45% Similarity=0.720 Sum_probs=228.7
Q ss_pred ccCCCeeEecccccccccccccCCCCccccccCcccchHHHHHHhhhhcccchhhhhhhhhccccccccccCceEeeec-
Q psy11602 190 HQTETGVRIPDCLRKFVPAVYLNEAGEIPFVKTAPIDEEETKKQKKQKEGMKKKLTMSLFSQVGSHGRDTRGIFRVHQF- 268 (1083)
Q Consensus 190 ~~~~~Gi~lP~~L~p~~~~~~~~~~G~~pv~~P~~i~~d~~~~~~~k~~~~k~~~~~~~~~e~g~h~~dl~~i~Rv~qf- 268 (1083)
|..++|+.|..||.+|.++.+. .+||+|+.+|.++..|++.+++ +...+.+ .++-+-+.
T Consensus 179 yl~g~~a~LeqALi~yal~~l~-~kGy~pl~~P~i~rkeVm~~cg----------------~~~~~d~---~~~y~ld~~ 238 (455)
T KOG2509|consen 179 YLKGAGAFLEQALINYALDFLN-AKGYTPLTTPDILRKEVMQKCG----------------QLPRFDE---EQYYVLDGG 238 (455)
T ss_pred EEcCHHHHHHHHHHHHHHHHHH-HcCCccccCchhhhHHHHHHhc----------------cCcCCCc---ceEEeecCC
Confidence 4556778889999999999985 8999999999999977776665 2222222 12222221
Q ss_pred -c----ceEEEEeeCCCCCcch--hhhh-hhhcccccccc-----cccCcCceeEEEeeeEEEEEEeCCCchhHHHHHHH
Q psy11602 269 -E----KVEQFVLTSPHDDESW--KMLD-EMIQNSEEFYA-----DLDTRGIFRVHQFEKVEQFVLTSPHDDESWKTLDE 335 (1083)
Q Consensus 269 -d----~~~~~~~~~~~~~~s~--~~~~-~~~~~~~~~~~-----~~~trGl~Rvhqf~kvE~f~~~~~~~~~s~~~~e~ 335 (1083)
+ .|++++++++|+|+-. ..|| ++++.|.|||. |+|||||||||||+|||||++|+| ++||++|+|
T Consensus 239 ~~~~LiaTaE~plAa~~~~e~~~~~~lPiK~vg~S~CfR~EaGs~G~d~~GlyRVHqF~KVE~Fvit~P--e~S~~~~eE 316 (455)
T KOG2509|consen 239 DEKYLIATAEQPLAAYHRDEWLEEDQLPIKYVGVSRCFRAEAGSHGKDTKGLYRVHQFEKVEQFVITGP--EDSWEMLEE 316 (455)
T ss_pred ccceeEeeccchhhhhhcccccccccCceeeeehhHHHHHHhhhcccccccceeeeeeeeeEEEEecCc--chhHHHHHH
Confidence 1 7899999999999732 2466 88889999996 999999999999999999999999 569999999
Q ss_pred HHHHHHHHHHHhCCcEEEEeccCCCcchhhhceeeEEEeeCCCCcEEeeecccCcccccccccceEEecccCCCCceeeE
Q psy11602 336 MIQNSEEFYADLGIAYRVVNIVSGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLAYQSRRLLVRYGQTKKMNEKIEFV 415 (1083)
Q Consensus 336 ~~~~~e~~~~~L~lpyRvv~~~~~dl~~~a~~~~DiE~w~P~~~~y~Ev~S~sn~~d~qarrl~iry~~~~~~~~~~~~~ 415 (1083)
|++++|+||++||||||||+|||+|||.+|++||||||||||+++|+||+|||||||||||||+|||+..|.++++.+||
T Consensus 317 mi~~~eef~qsLgip~rvl~m~S~eLg~aAakKyDiEAWmPgrg~ygEl~ScSNCTDyQSRRL~IRy~~~k~~~~~~~yv 396 (455)
T KOG2509|consen 317 MINNQEEFYQSLGLPYRVLNMPSGELGAAAAKKYDIEAWMPGRGAYGELVSCSNCTDYQSRRLGIRYGQKKTNDGEKKYV 396 (455)
T ss_pred HHHHHHHHHHHhCCceeEecCCchhhCcHHHhhcchhhhcCcccccccccccccchhHHHhhhhhhcccccccCCcccee
Confidence 99999999999999999999999999999999999999999999999999999999999999999999887778889999
Q ss_pred EeecccccchhHHHHHHHhhccCCCceecCccccccCCCcccCCCcccCCCCCCCCChh
Q psy11602 416 HMLNATACATTRVICAILETHQTETGVRIPDCLRKFVPAVYVNEAGEIPFVKTAPIDEE 474 (1083)
Q Consensus 416 htln~t~~a~~R~i~ailEn~q~~~Gi~iP~~L~py~~~~~~~~~~~~~~~~~~p~D~e 474 (1083)
||||||+|||+|+|||||||||++|||.||++||||||+ .++|||++++|++.+
T Consensus 397 HtLN~TacA~~R~l~aiLEnyQ~edGi~VPe~Lr~ym~~-----~~~ip~~k~~p~~~~ 450 (455)
T KOG2509|consen 397 HTLNGTACATPRALCAILENYQTEDGIEVPEVLRPYMGG-----QEFIPFVKPAPKNLT 450 (455)
T ss_pred eecchhhHhhhHHHHHhHhhccCCCCccCCHhHHhhcCC-----cccccccccCCcccc
Confidence 999999999999999999999999999999999999997 467999999999976
|
|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02320 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG2509|consensus | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02320 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II | Back alignment and domain information |
|---|
| >COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK09194 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00960 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG2324|consensus | Back alignment and domain information |
|---|
| >cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >KOG0954|consensus | Back alignment and domain information |
|---|
| >cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK08661 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0956|consensus | Back alignment and domain information |
|---|
| >PRK00960 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I | Back alignment and domain information |
|---|
| >cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12325 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family | Back alignment and domain information |
|---|
| >KOG4163|consensus | Back alignment and domain information |
|---|
| >PRK08661 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family | Back alignment and domain information |
|---|
| >PRK03991 threonyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes | Back alignment and domain information |
|---|
| >TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I | Back alignment and domain information |
|---|
| >KOG1244|consensus | Back alignment and domain information |
|---|
| >cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PLN02837 threonine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK03991 threonyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK12444 threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK04173 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >TIGR00418 thrS threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes | Back alignment and domain information |
|---|
| >PLN02837 threonine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK12325 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14799 thrS threonyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12305 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02908 threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK09194 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04173 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II | Back alignment and domain information |
|---|
| >cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK14799 thrS threonyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12444 threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG1080|consensus | Back alignment and domain information |
|---|
| >TIGR00418 thrS threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
| >KOG2324|consensus | Back alignment and domain information |
|---|
| >PLN02908 threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12305 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >PRK07080 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02734 glycyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type | Back alignment and domain information |
|---|
| >PRK14894 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1244|consensus | Back alignment and domain information |
|---|
| >COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >PRK07080 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4163|consensus | Back alignment and domain information |
|---|
| >PRK14894 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4443|consensus | Back alignment and domain information |
|---|
| >cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >PLN02734 glycyl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type | Back alignment and domain information |
|---|
| >KOG4443|consensus | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00442 hisS histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG4323|consensus | Back alignment and domain information |
|---|
| >PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional | Back alignment and domain information |
|---|
| >KOG1637|consensus | Back alignment and domain information |
|---|
| >KOG4323|consensus | Back alignment and domain information |
|---|
| >PRK00037 hisS histidyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >CHL00201 syh histidine-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain | Back alignment and domain information |
|---|
| >COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12420 histidyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02530 histidine-tRNA ligase | Back alignment and domain information |
|---|
| >KOG4299|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >TIGR02367 PylS pyrrolysyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase | Back alignment and domain information |
|---|
| >KOG1637|consensus | Back alignment and domain information |
|---|
| >PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >KOG2298|consensus | Back alignment and domain information |
|---|
| >TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit | Back alignment and domain information |
|---|
| >cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >PLN02972 Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4299|consensus | Back alignment and domain information |
|---|
| >TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >KOG0954|consensus | Back alignment and domain information |
|---|
| >KOG1973|consensus | Back alignment and domain information |
|---|
| >PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A | Back alignment and domain information |
|---|
| >KOG1084|consensus | Back alignment and domain information |
|---|
| >TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type | Back alignment and domain information |
|---|
| >PLN02903 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PRK09350 poxB regulator PoxA; Provisional | Back alignment and domain information |
|---|
| >KOG0956|consensus | Back alignment and domain information |
|---|
| >COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00476 aspS aspartyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >KOG1246|consensus | Back alignment and domain information |
|---|
| >cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional | Back alignment and domain information |
|---|
| >KOG1973|consensus | Back alignment and domain information |
|---|
| >PRK00484 lysS lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1083 | ||||
| 3vbb_A | 522 | Crystal Structure Of Seryl-Trna Synthetase From Hum | 3e-87 | ||
| 3vbb_A | 522 | Crystal Structure Of Seryl-Trna Synthetase From Hum | 9e-69 | ||
| 3vbb_A | 522 | Crystal Structure Of Seryl-Trna Synthetase From Hum | 7e-14 | ||
| 3lsq_A | 484 | Trypanosoma Brucei Seryl-Trna Synthetase Length = 4 | 1e-65 | ||
| 3lsq_A | 484 | Trypanosoma Brucei Seryl-Trna Synthetase Length = 4 | 1e-49 | ||
| 3lsq_A | 484 | Trypanosoma Brucei Seryl-Trna Synthetase Length = 4 | 5e-09 | ||
| 3qne_A | 485 | Candida Albicans Seryl-Trna Synthetase Length = 485 | 1e-62 | ||
| 3qne_A | 485 | Candida Albicans Seryl-Trna Synthetase Length = 485 | 1e-46 | ||
| 3qne_A | 485 | Candida Albicans Seryl-Trna Synthetase Length = 485 | 1e-08 | ||
| 3qo5_A | 485 | Crystal Structure Of The Seryl-Trna Synthetase From | 1e-62 | ||
| 3qo5_A | 485 | Crystal Structure Of The Seryl-Trna Synthetase From | 1e-46 | ||
| 3qo5_A | 485 | Crystal Structure Of The Seryl-Trna Synthetase From | 1e-08 | ||
| 2dq0_A | 455 | Crystal Structure Of Seryl-Trna Synthetase From Pyr | 3e-52 | ||
| 2dq0_A | 455 | Crystal Structure Of Seryl-Trna Synthetase From Pyr | 1e-41 | ||
| 2dq0_A | 455 | Crystal Structure Of Seryl-Trna Synthetase From Pyr | 1e-04 | ||
| 2dq3_A | 425 | Crystal Structure Of Aq_298 Length = 425 | 3e-38 | ||
| 2dq3_A | 425 | Crystal Structure Of Aq_298 Length = 425 | 4e-29 | ||
| 3err_A | 536 | Microtubule Binding Domain From Mouse Cytoplasmic D | 1e-36 | ||
| 3err_A | 536 | Microtubule Binding Domain From Mouse Cytoplasmic D | 1e-25 | ||
| 1sry_A | 421 | Refined Crystal Structure Of The Seryl-Trna Synthet | 2e-36 | ||
| 1sry_A | 421 | Refined Crystal Structure Of The Seryl-Trna Synthet | 1e-25 | ||
| 1wle_A | 501 | Crystal Structure Of Mammalian Mitochondrial Seryl- | 2e-30 | ||
| 1wle_A | 501 | Crystal Structure Of Mammalian Mitochondrial Seryl- | 4e-27 |
| >pdb|3VBB|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Human At 2.9 Angstroms Length = 522 | Back alignment and structure |
|
| >pdb|3VBB|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Human At 2.9 Angstroms Length = 522 | Back alignment and structure |
| >pdb|3VBB|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Human At 2.9 Angstroms Length = 522 | Back alignment and structure |
| >pdb|3LSQ|A Chain A, Trypanosoma Brucei Seryl-Trna Synthetase Length = 484 | Back alignment and structure |
| >pdb|3LSQ|A Chain A, Trypanosoma Brucei Seryl-Trna Synthetase Length = 484 | Back alignment and structure |
| >pdb|3LSQ|A Chain A, Trypanosoma Brucei Seryl-Trna Synthetase Length = 484 | Back alignment and structure |
| >pdb|3QNE|A Chain A, Candida Albicans Seryl-Trna Synthetase Length = 485 | Back alignment and structure |
| >pdb|3QNE|A Chain A, Candida Albicans Seryl-Trna Synthetase Length = 485 | Back alignment and structure |
| >pdb|3QNE|A Chain A, Candida Albicans Seryl-Trna Synthetase Length = 485 | Back alignment and structure |
| >pdb|3QO5|A Chain A, Crystal Structure Of The Seryl-Trna Synthetase From Candida Albicans Length = 485 | Back alignment and structure |
| >pdb|3QO5|A Chain A, Crystal Structure Of The Seryl-Trna Synthetase From Candida Albicans Length = 485 | Back alignment and structure |
| >pdb|3QO5|A Chain A, Crystal Structure Of The Seryl-Trna Synthetase From Candida Albicans Length = 485 | Back alignment and structure |
| >pdb|2DQ0|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Pyrococcus Horikoshii Complexed With A Seryl-Adenylate Analog Length = 455 | Back alignment and structure |
| >pdb|2DQ0|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Pyrococcus Horikoshii Complexed With A Seryl-Adenylate Analog Length = 455 | Back alignment and structure |
| >pdb|2DQ0|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Pyrococcus Horikoshii Complexed With A Seryl-Adenylate Analog Length = 455 | Back alignment and structure |
| >pdb|2DQ3|A Chain A, Crystal Structure Of Aq_298 Length = 425 | Back alignment and structure |
| >pdb|2DQ3|A Chain A, Crystal Structure Of Aq_298 Length = 425 | Back alignment and structure |
| >pdb|3ERR|A Chain A, Microtubule Binding Domain From Mouse Cytoplasmic Dynein As A Fusion With Seryl-Trna Synthetase Length = 536 | Back alignment and structure |
| >pdb|3ERR|A Chain A, Microtubule Binding Domain From Mouse Cytoplasmic Dynein As A Fusion With Seryl-Trna Synthetase Length = 536 | Back alignment and structure |
| >pdb|1SRY|A Chain A, Refined Crystal Structure Of The Seryl-Trna Synthetase From Thermus Thermophilus At 2.5 Angstroms Resolution Length = 421 | Back alignment and structure |
| >pdb|1SRY|A Chain A, Refined Crystal Structure Of The Seryl-Trna Synthetase From Thermus Thermophilus At 2.5 Angstroms Resolution Length = 421 | Back alignment and structure |
| >pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna Synthetase Complexed With Seryl-Adenylate Length = 501 | Back alignment and structure |
| >pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna Synthetase Complexed With Seryl-Adenylate Length = 501 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1083 | |||
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 1e-120 | |
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 7e-95 | |
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 2e-17 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 1e-114 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 3e-91 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 2e-15 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 1e-113 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 5e-86 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 7e-17 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 4e-80 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 9e-59 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 2e-12 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 7e-72 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 7e-57 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 2e-10 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 2e-70 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 1e-53 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 4e-09 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 2e-68 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 2e-51 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 6e-09 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 2e-57 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 1e-42 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 2e-07 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 4e-44 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 6e-34 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 1e-37 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 9e-25 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 2e-05 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 6e-15 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 3e-05 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 1e-11 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 1e-05 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 6e-11 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 5e-05 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 4e-09 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 1e-04 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 3e-04 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 3e-08 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 3e-08 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 3e-08 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 6e-08 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 8e-08 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 2e-07 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 3e-07 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 2e-06 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 1e-05 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 2e-05 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 2e-05 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 3e-05 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 3e-05 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 4e-05 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 8e-05 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 5e-05 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 2e-04 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 3e-04 | |
| 1ati_A | 505 | Glycyl-tRNA synthetase; protein biosynthesis, liga | 3e-04 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 3e-04 |
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
Score = 380 bits (977), Expect = e-120
Identities = 159/251 (63%), Positives = 191/251 (76%), Gaps = 16/251 (6%)
Query: 4 KGEKVGDSAPEKDELDDKYLIATSEQPICAVHRDSWLPEASLPIRYLGVSTCFRQEVGSH 63
K G + + D+KYLIATSEQPI A+HRD WL LPI+Y G+STCFRQEVGSH
Sbjct: 249 KVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSH 308
Query: 64 GRDTRGIFRVHQFEKVEQFVLTSPHDDESWKMLDEMIQNSEEFYADLGIAYRVVNIVSGA 123
GRDTRGIFRVHQFEK+EQFV +SPHD++SW+M +EMI +EEFY LGI Y +VNIVSG+
Sbjct: 309 GRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGS 368
Query: 124 LNHAAAKKLDLEAWFPGSGAFRELVSCSNCLDYQSRRLLVRYGQTKQ----KIY-----A 174
LNHAA+KKLDLEAWFPGSGAFRELVSCSNC DYQ+RRL +RYGQTK+ + A
Sbjct: 369 LNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNA 428
Query: 175 TACATTRVICAILETHQTETGVRIPDCLRKFVPAVYLNEAGE--IPFVKTAPIDEEETKK 232
T CATTR ICAILE +QTE G+ +P+ L++ ++ + IPFVK API++E +KK
Sbjct: 429 TMCATTRTICAILENYQTEKGITVPEKLKE-----FMPPGLQELIPFVKPAPIEQEPSKK 483
Query: 233 QKKQKEGMKKK 243
QKKQ EG KKK
Sbjct: 484 QKKQHEGSKKK 494
|
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Length = 485 | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Length = 485 | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Length = 485 | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Length = 484 | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Length = 484 | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Length = 484 | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Length = 455 | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Length = 455 | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Length = 455 | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Length = 501 | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Length = 501 | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Length = 501 | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Length = 421 | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Length = 421 | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Length = 421 | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Length = 536 | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Length = 536 | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Length = 536 | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Length = 425 | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Length = 425 | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Length = 425 | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Length = 346 | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Length = 346 | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Length = 522 | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Length = 522 | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Length = 522 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Length = 505 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1083 | |||
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 100.0 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 100.0 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 100.0 | |
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 100.0 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 100.0 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 100.0 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 100.0 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 100.0 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 100.0 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 100.0 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 100.0 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 100.0 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 100.0 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 100.0 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 100.0 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 100.0 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 100.0 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 100.0 | |
| 3ial_A | 518 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 100.0 | |
| 1nj1_A | 501 | PROR, proline-tRNA synthetase, proline--tRNA ligas | 99.97 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 99.97 | |
| 4hvc_A | 519 | Bifunctional glutamate/proline--tRNA ligase; ligas | 99.97 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 99.97 | |
| 1nj1_A | 501 | PROR, proline-tRNA synthetase, proline--tRNA ligas | 99.95 | |
| 3ial_A | 518 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 99.95 | |
| 4hvc_A | 519 | Bifunctional glutamate/proline--tRNA ligase; ligas | 99.94 | |
| 1nj8_A | 459 | Proline-tRNA synthetase, proline--tRNA ligase; cla | 99.94 | |
| 2j3l_A | 572 | Prolyl-tRNA synthetase; class II aminoacyl- T synt | 99.93 | |
| 1hc7_A | 477 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 99.92 | |
| 3ikl_A | 459 | DNA polymerase subunit gamma-2, mitochondrial; tra | 99.9 | |
| 2i4l_A | 458 | Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud | 99.89 | |
| 3ikl_A | 459 | DNA polymerase subunit gamma-2, mitochondrial; tra | 99.88 | |
| 1ati_A | 505 | Glycyl-tRNA synthetase; protein biosynthesis, liga | 99.86 | |
| 3uh0_A | 460 | Threonyl-tRNA synthetase, mitochondrial; threonine | 99.83 | |
| 1qf6_A | 642 | THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m | 99.82 | |
| 1evl_A | 401 | Threonyl-tRNA synthetase; amino acid recognition, | 99.81 | |
| 1nj8_A | 459 | Proline-tRNA synthetase, proline--tRNA ligase; cla | 99.8 | |
| 1g5h_A | 454 | Mitochondrial DNA polymerase accessory subunit; in | 99.78 | |
| 1ati_A | 505 | Glycyl-tRNA synthetase; protein biosynthesis, liga | 99.76 | |
| 1hc7_A | 477 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 99.76 | |
| 1nyr_A | 645 | Threonyl-tRNA synthetase 1; ATP, threonine, ligase | 99.71 | |
| 1qf6_A | 642 | THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m | 99.67 | |
| 3a32_A | 471 | Probable threonyl-tRNA synthetase 1; aeropyrum per | 99.63 | |
| 1evl_A | 401 | Threonyl-tRNA synthetase; amino acid recognition, | 99.55 | |
| 1g5h_A | 454 | Mitochondrial DNA polymerase accessory subunit; in | 99.55 | |
| 3uh0_A | 460 | Threonyl-tRNA synthetase, mitochondrial; threonine | 99.51 | |
| 2i4l_A | 458 | Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud | 99.42 | |
| 2zt5_A | 693 | Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP | 99.35 | |
| 1nyr_A | 645 | Threonyl-tRNA synthetase 1; ATP, threonine, ligase | 99.33 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.32 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.25 | |
| 1qe0_A | 420 | Histidyl-tRNA synthetase; class II tRNA synthetase | 99.04 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.97 | |
| 2j3l_A | 572 | Prolyl-tRNA synthetase; class II aminoacyl- T synt | 98.93 | |
| 3a32_A | 471 | Probable threonyl-tRNA synthetase 1; aeropyrum per | 98.86 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.84 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.84 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.83 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.83 | |
| 1h4v_B | 421 | Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA | 98.81 | |
| 1wu7_A | 434 | Histidyl-tRNA synthetase; ligase, structural genom | 98.79 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.78 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.75 | |
| 1htt_A | 423 | Histidyl-tRNA synthetase; complex (tRNA synthetase | 98.73 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.67 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.66 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.62 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.61 | |
| 3dsq_A | 288 | Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t | 98.58 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.56 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.54 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.54 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.54 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.53 | |
| 4e51_A | 467 | Histidine--tRNA ligase; seattle structural genomic | 98.52 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.51 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.51 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.51 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.47 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.46 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.45 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.37 | |
| 1z7m_A | 344 | ATP phosphoribosyltransferase regulatory subunit; | 98.29 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.2 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.16 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.15 | |
| 2zt5_A | 693 | Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP | 98.1 | |
| 3rac_A | 373 | Histidine-tRNA ligase; structural genomics, PSI-bi | 98.09 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.06 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.04 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.03 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 98.02 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.02 | |
| 3od1_A | 400 | ATP phosphoribosyltransferase regulatory subunit; | 97.96 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 97.93 | |
| 3lc0_A | 456 | Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t | 97.92 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 97.91 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 97.89 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 97.87 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 97.86 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.85 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 97.84 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 97.83 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 97.82 | |
| 4g84_A | 464 | Histidine--tRNA ligase, cytoplasmic; synthetase; 2 | 97.8 | |
| 3qtc_A | 290 | Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet | 97.68 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.56 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 97.54 | |
| 4g85_A | 517 | Histidine-tRNA ligase, cytoplasmic; synthetase; 3. | 97.51 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 97.46 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.37 | |
| 3net_A | 465 | Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas | 97.36 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 97.33 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.21 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.16 | |
| 1qe0_A | 420 | Histidyl-tRNA synthetase; class II tRNA synthetase | 97.14 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 97.13 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.12 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.1 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 97.1 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.04 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.02 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 96.94 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 96.91 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 96.9 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 96.85 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.78 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 96.77 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 96.75 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 96.73 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.57 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 96.49 | |
| 1usy_A | 275 | ATP phosphoribosyltransferase regulatory subunit; | 96.45 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.37 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.32 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.28 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.19 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.08 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 96.08 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 96.02 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 95.99 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 95.97 | |
| 3l4g_A | 508 | Phenylalanyl-tRNA synthetase alpha chain; aminoacy | 95.9 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 95.85 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 95.63 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 95.59 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 95.48 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 95.27 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 95.25 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 95.11 | |
| 3dsq_A | 288 | Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t | 94.96 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 94.91 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 94.82 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 94.63 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 94.56 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 94.47 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 94.16 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 94.08 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 94.01 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 93.97 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 93.96 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 93.86 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 93.75 | |
| 1b7y_A | 350 | Phers, protein (phenylalanyl-tRNA synthetase); enz | 93.64 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 93.58 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 93.11 | |
| 2du3_A | 534 | O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l | 92.54 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 91.56 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 91.45 | |
| 1nnh_A | 294 | Asparaginyl-tRNA synthetase-related peptide; struc | 91.23 | |
| 2rhq_A | 294 | Phenylalanyl-tRNA synthetase alpha chain; heterote | 90.64 | |
| 1wyd_A | 429 | Hypothetical aspartyl-tRNA synthetase; archaea, LI | 90.37 | |
| 1h4v_B | 421 | Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA | 89.78 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 88.98 | |
| 3a74_A | 493 | Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, | 88.57 | |
| 1x54_A | 434 | Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe | 88.48 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 88.42 | |
| 3a5y_A | 345 | GENX, putative lysyl-tRNA synthetase; aminoacyl-tR | 87.9 | |
| 1eov_A | 487 | ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy | 87.66 | |
| 3pco_A | 327 | Phenylalanyl-tRNA synthetase, alpha subunit; amino | 87.53 | |
| 1e1o_A | 504 | Lysyl-tRNA synthetase, heat inducible; ligase, ami | 87.41 | |
| 4e51_A | 467 | Histidine--tRNA ligase; seattle structural genomic | 87.21 | |
| 1wu7_A | 434 | Histidyl-tRNA synthetase; ligase, structural genom | 86.99 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 86.32 | |
| 2xgt_A | 435 | Asparaginyl-tRNA synthetase, cytoplasmic; ligase, | 85.3 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 84.53 | |
| 1n9w_A | 422 | Aspartyl-tRNA synthetase 2; biosynthetic protein; | 84.0 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 83.84 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 83.54 | |
| 3bju_A | 521 | Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 83.21 | |
| 4ah6_A | 617 | Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo | 83.11 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 82.81 | |
| 1c0a_A | 585 | Aspartyl tRNA synthetase; protein-RNA complex, lig | 82.33 | |
| 1l0w_A | 580 | Aspartyl-tRNA synthetase; space-grown crystal, dim | 82.24 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 82.21 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 80.33 | |
| 3nem_A | 438 | Aspartyl-tRNA synthetase; rossmann fold, OB fold, | 80.17 |
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=7e-61 Score=562.54 Aligned_cols=285 Identities=52% Similarity=0.811 Sum_probs=221.3
Q ss_pred CCeeEecccccccccccccCCCCccccccCcccchHHHHHHhhhhcccchhhhhhhhhccccccccccCceEeeec----
Q psy11602 193 ETGVRIPDCLRKFVPAVYLNEAGEIPFVKTAPIDEEETKKQKKQKEGMKKKLTMSLFSQVGSHGRDTRGIFRVHQF---- 268 (1083)
Q Consensus 193 ~~Gi~lP~~L~p~~~~~~~~~~G~~pv~~P~~i~~d~~~~~~~k~~~~k~~~~~~~~~e~g~h~~dl~~i~Rv~qf---- 268 (1083)
+.|++|..+|..|+.+.+. .+||++|.+|++++.+. +.+.++.+.+.+ .+|++...
T Consensus 198 p~GarL~raL~~f~~d~~~-~~Gy~EV~~P~lv~~el----------------~~~sG~l~~f~e---emy~v~~~g~~~ 257 (522)
T 3vbb_A 198 GVLVFLEQALIQYALRTLG-SRGYIPIYTPFFMRKEV----------------MQEVAQLSQFDE---ELYKVIGKGSEK 257 (522)
T ss_dssp THHHHHHHHHHHHHHHHHH-HTTCEEEECCSEEEHHH----------------HHHHSCCC-CCS---CCCEEC------
T ss_pred CHHHHHHHHHHHHHHHHHH-HcCCEEEECCcccchHH----------------HhhcCCcccCcc---cceEeecCCccc
Confidence 4577888899999999885 89999999999999444 455556677766 46665421
Q ss_pred -------c----ceEEEEeeCCCCCc--chhhhh-hhhcccccccc-----cccCcCceeEEEeeeEEEEEEeCCCchhH
Q psy11602 269 -------E----KVEQFVLTSPHDDE--SWKMLD-EMIQNSEEFYA-----DLDTRGIFRVHQFEKVEQFVLTSPHDDES 329 (1083)
Q Consensus 269 -------d----~~~~~~~~~~~~~~--s~~~~~-~~~~~~~~~~~-----~~~trGl~Rvhqf~kvE~f~~~~~~~~~s 329 (1083)
+ ++..++++..+.++ ||++|| ++++.+.|||+ |++++||||||||+|||+|.||+|++++|
T Consensus 258 ~~~~~~~~l~L~PTaE~~l~~l~~~ei~s~~dLPlr~~~~s~cFR~Eags~GrdtrGL~RvhQF~kvE~~~f~~pe~e~s 337 (522)
T 3vbb_A 258 SDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKS 337 (522)
T ss_dssp ------CCEEECSSTHHHHHTTSTTCEECTTTCCEEEEEEEEEECSCCCC----CCCSSSCSEEEEEEEEEEECSSTTHH
T ss_pred cccccCcceeEcccCcHHHHHHHhhhecccccCCeeEEEecccccCCCCcCCccCCCcceeeeeEEEEEEEEeCCChHHH
Confidence 1 55566666766665 889999 99999999996 57999999999999999999999976669
Q ss_pred HHHHHHHHHHHHHHHHHhCCcEEEEeccCCCcchhhhceeeEEEeeCCCCcEEeeecccCcccccccccceEEecccCCC
Q psy11602 330 WKTLDEMIQNSEEFYADLGIAYRVVNIVSGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLAYQSRRLLVRYGQTKKMN 409 (1083)
Q Consensus 330 ~~~~e~~~~~~e~~~~~L~lpyRvv~~~~~dl~~~a~~~~DiE~w~P~~~~y~Ev~S~sn~~d~qarrl~iry~~~~~~~ 409 (1083)
+++|++|+.++++||+.||||||||.+|+||||++|+++||||||||++++|+||+|||||+||||||++|||++.+..+
T Consensus 338 ~~e~e~ml~~~e~il~~LGLpyrvv~l~tgdlg~~asktyDiE~w~P~~~~y~EIsScSnc~DyqArr~~iry~~~~~~~ 417 (522)
T 3vbb_A 338 WEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMM 417 (522)
T ss_dssp HHHHHHHHHHHHHHHHHTTCCEEEEECCGGGCCTTCSEEEEEEEEETTTTEEEEEEEEEECTTHHHHHHTCEESCC---C
T ss_pred HHHHHHHHHHHHHHHHHcCCceEEEEcCCccCCCchhheeceeEecCCCCceeEEEEecCCCCCccceeeeEEccccccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999753335
Q ss_pred CceeeEEeecccccchhHHHHHHHhhccCCCceecCccccccCCCcccCCCcccCCCCCCCCChhhHHHHHhhhhccccc
Q psy11602 410 EKIEFVHMLNATACATTRVICAILETHQTETGVRIPDCLRKFVPAVYVNEAGEIPFVKTAPIDEEETKKQKKQKEGMKKK 489 (1083)
Q Consensus 410 ~~~~~~htln~t~~a~~R~i~ailEn~q~~~Gi~iP~~L~py~~~~~~~~~~~~~~~~~~p~D~e~~~~~kk~k~~~kk~ 489 (1083)
++.+|||||||||+|++|+|+|||||||++|||+||++|+|||++.+ .++|||++++|+|.+.+++++|+++++||+
T Consensus 418 ~k~~~vhtlNgs~lav~R~l~AiLEn~q~~dGi~iP~~L~Py~~~~~---~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~ 494 (522)
T 3vbb_A 418 DKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGL---QELIPFVKPAPIEQEPSKKQKKQHEGSKKK 494 (522)
T ss_dssp CCCCBCEEEEEEEEEHHHHHHHHHHHHBCSSEEECCHHHHTTSCTTS---SSEEECCSCCCC------------------
T ss_pred CCeeeceEEeccchHHHHHHHHHHHhCCCCCCeecChHhcCeeCCCc---ceEeecCCCCCcchhHHHHhhhhhcccccc
Confidence 67899999999999999999999999999999999999999999765 256999999999999999888888888777
Q ss_pred cchhhHhhhhh
Q psy11602 490 VLIDEAMIQNE 500 (1083)
Q Consensus 490 ~~~~~~~~~~~ 500 (1083)
...+...+++.
T Consensus 495 ~~~~~~~~~~~ 505 (522)
T 3vbb_A 495 AAARDVTLENR 505 (522)
T ss_dssp -----------
T ss_pred ccccchhhhHH
Confidence 76665444443
|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* | Back alignment and structure |
|---|
| >3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A | Back alignment and structure |
|---|
| >4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A | Back alignment and structure |
|---|
| >1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* | Back alignment and structure |
|---|
| >3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 | Back alignment and structure |
|---|
| >2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* | Back alignment and structure |
|---|
| >1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A | Back alignment and structure |
|---|
| >3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* | Back alignment and structure |
|---|
| >3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* | Back alignment and structure |
|---|
| >3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* | Back alignment and structure |
|---|
| >1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* | Back alignment and structure |
|---|
| >1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 | Back alignment and structure |
|---|
| >1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* | Back alignment and structure |
|---|
| >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* | Back alignment and structure |
|---|
| >1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A | Back alignment and structure |
|---|
| >1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* | Back alignment and structure |
|---|
| >1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A | Back alignment and structure |
|---|
| >1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* | Back alignment and structure |
|---|
| >1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* | Back alignment and structure |
|---|
| >3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* | Back alignment and structure |
|---|
| >2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* | Back alignment and structure |
|---|
| >2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A | Back alignment and structure |
|---|
| >1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* | Back alignment and structure |
|---|
| >3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A | Back alignment and structure |
|---|
| >3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* | Back alignment and structure |
|---|
| >2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* | Back alignment and structure |
|---|
| >1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* | Back alignment and structure |
|---|
| >1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* | Back alignment and structure |
|---|
| >1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* | Back alignment and structure |
|---|
| >3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} | Back alignment and structure |
|---|
| >1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* | Back alignment and structure |
|---|
| >1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1083 | ||||
| d1seta2 | 311 | d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS | 8e-38 | |
| d1seta2 | 311 | d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS | 2e-32 | |
| d1g5ha2 | 290 | d.104.1.1 (A:41-330) The aaRS-like accessory subun | 2e-16 | |
| d1g5ha2 | 290 | d.104.1.1 (A:41-330) The aaRS-like accessory subun | 1e-13 | |
| d1nj1a3 | 265 | d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS | 3e-15 | |
| d1nj1a3 | 265 | d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS | 1e-11 | |
| d1nj8a3 | 268 | d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) | 2e-12 | |
| d1nj8a3 | 268 | d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) | 3e-10 | |
| d1hc7a2 | 272 | d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) | 7e-12 | |
| d1hc7a2 | 272 | d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) | 3e-10 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 5e-08 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 6e-04 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 2e-07 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 4e-05 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 0.002 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 2e-07 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 0.003 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 3e-06 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 0.003 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 7e-06 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 1e-05 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 7e-06 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 1e-04 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 0.002 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 3e-04 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 4e-04 |
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Seryl-tRNA synthetase (SerRS) species: Thermus thermophilus, strain hb27 [TaxId: 274]
Score = 142 bits (358), Expect = 8e-38
Identities = 77/214 (35%), Positives = 116/214 (54%), Gaps = 7/214 (3%)
Query: 9 GDSAPEKDELDDKYLIATSEQPICAVHRDSWLPEASLPIRYLGVSTCFRQEVGSHGRDTR 68
D YL T+E + A+H LP +LP+RY G + FR E GS G+D R
Sbjct: 98 YRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVR 157
Query: 69 GIFRVHQFEKVEQFVLTSPHDDESWKMLDEMIQNSEEFYADLGIAYRVVNIVSGALNHAA 128
G+ RVHQF KVEQ+VLT + S + E+++N+EE L + YR+V + +G +
Sbjct: 158 GLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGK 217
Query: 129 AKKLDLEAWFPGSGAFRELVSCSNCLDYQSRRLLVRYGQTKQK------IYATACATTRV 182
+++D+E + P G +RE SCS LD+Q+RR +RY + + + TA AT R+
Sbjct: 218 WRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRI 277
Query: 183 ICAILETHQTETG-VRIPDCLRKFVPAVYLNEAG 215
+ +LE HQ + G VR+P L ++ L G
Sbjct: 278 LAMLLENHQLQDGRVRVPQALIPYMGKEVLEPCG 311
|
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Length = 311 | Back information, alignment and structure |
|---|
| >d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 290 | Back information, alignment and structure |
|---|
| >d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 290 | Back information, alignment and structure |
|---|
| >d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Length = 265 | Back information, alignment and structure |
|---|
| >d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Length = 265 | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Length = 268 | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Length = 268 | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Length = 272 | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Length = 272 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1083 | |||
| d1seta2 | 311 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 100.0 | |
| d1seta2 | 311 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 100.0 | |
| d1nj8a3 | 268 | Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc | 99.96 | |
| d1nj1a3 | 265 | Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth | 99.96 | |
| d1hc7a2 | 272 | Prolyl-tRNA synthetase (ProRS) {Thermus thermophil | 99.92 | |
| d1nyra4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a | 99.91 | |
| d1qf6a4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Escherichia coli | 99.9 | |
| d1nyra4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a | 99.9 | |
| d1nj1a3 | 265 | Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth | 99.89 | |
| d1nj8a3 | 268 | Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc | 99.88 | |
| d1hc7a2 | 272 | Prolyl-tRNA synthetase (ProRS) {Thermus thermophil | 99.83 | |
| d1g5ha2 | 290 | The aaRS-like accessory subunit of mitochondrial p | 99.73 | |
| d1g5ha2 | 290 | The aaRS-like accessory subunit of mitochondrial p | 99.7 | |
| d1qf6a4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Escherichia coli | 99.65 | |
| d1b76a2 | 331 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 99.41 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.76 | |
| d1atia2 | 394 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 98.66 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.45 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.13 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.11 | |
| d1atia2 | 394 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 97.98 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.97 | |
| d1b76a2 | 331 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 97.9 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.7 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 97.68 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.58 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 97.5 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.39 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.26 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.17 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.87 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.8 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 96.77 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.61 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.53 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.41 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 96.4 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.16 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 96.15 | |
| d1z7ma1 | 318 | ATP phosphoribosyltransferase regulatory subunit H | 95.06 | |
| d1h4vb2 | 324 | Histidyl-tRNA synthetase (HisRS) {Thermus thermoph | 93.69 | |
| d1qe0a2 | 325 | Histidyl-tRNA synthetase (HisRS) {Staphylococcus a | 93.6 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 93.58 | |
| d1wu7a2 | 327 | Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop | 93.52 | |
| d1jjca_ | 266 | Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS | 92.99 | |
| d1kmma2 | 322 | Histidyl-tRNA synthetase (HisRS) {Escherichia coli | 91.61 | |
| d1usya_ | 275 | ATP phosphoribosyltransferase regulatory subunit H | 91.55 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 82.92 | |
| d1nnha_ | 293 | Hypothetical protein PF1951 {Archaeon Pyrococcus f | 82.73 | |
| d1b8aa2 | 335 | Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ | 81.48 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 80.13 |
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Seryl-tRNA synthetase (SerRS) species: Thermus thermophilus, strain hb27 [TaxId: 274]
Probab=100.00 E-value=1.1e-58 Score=515.18 Aligned_cols=243 Identities=28% Similarity=0.471 Sum_probs=218.1
Q ss_pred cCCCeeEecccccccccccccCCCCccccccCcccchHHHHHHhhhhcccchhhhhhhhhccccccccccCceEeeecc-
Q psy11602 191 QTETGVRIPDCLRKFVPAVYLNEAGEIPFVKTAPIDEEETKKQKKQKEGMKKKLTMSLFSQVGSHGRDTRGIFRVHQFE- 269 (1083)
Q Consensus 191 ~~~~Gi~lP~~L~p~~~~~~~~~~G~~pv~~P~~i~~d~~~~~~~k~~~~k~~~~~~~~~e~g~h~~dl~~i~Rv~qfd- 269 (1083)
..++|++|..||.+||.+.+. .+||+||.+|.+|+.+ ++.+.++.+.+.++ +|.+...+
T Consensus 51 l~g~~a~Le~AL~~~~ld~~~-~~gy~~v~~P~lv~~~----------------~~~~~G~~p~f~~~---~y~~~~~~~ 110 (311)
T d1seta2 51 LKGDLALYELALLRFAMDFMA-RRGFLPMTLPSYAREK----------------AFLGTGHFPAYRDQ---VWAIAETDL 110 (311)
T ss_dssp EEHHHHHHHHHHHHHHHHHHH-HTTCEEEECCSEEEHH----------------HHHHHTCTTTTGGG---SCBBTTSSE
T ss_pred EECHHHHHHHHHHHHHHHhhh-cccceEEeechhhccc----------------hhhhcccccccccc---cccccccce
Confidence 445678899999999999985 8999999999999944 44555566666663 44443323
Q ss_pred ---ceEEEEeeCCCCCcc--hhhhh-hhhcccccccc-----cccCcCceeEEEeeeEEEEEEeCCCchhHHHHHHHHHH
Q psy11602 270 ---KVEQFVLTSPHDDES--WKMLD-EMIQNSEEFYA-----DLDTRGIFRVHQFEKVEQFVLTSPHDDESWKTLDEMIQ 338 (1083)
Q Consensus 270 ---~~~~~~~~~~~~~~s--~~~~~-~~~~~~~~~~~-----~~~trGl~Rvhqf~kvE~f~~~~~~~~~s~~~~e~~~~ 338 (1083)
+++++++++.|.++- +++|| ++.+.+.|||+ |++||||||||||+|||||++|.+..++|+++|++|++
T Consensus 111 ~LipTsE~~l~~~~~~~i~~~~~LPlr~~~~s~cfR~Eag~~g~~trGL~RvhQF~kvE~~~~~~~~~e~s~~~~~~~~~ 190 (311)
T d1seta2 111 YLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLE 190 (311)
T ss_dssp EECSSTHHHHHHTTTTCEEEGGGCSEEEEEEEEEECCCCSCTTSSCSTTSSCSEEEEEEEEEEECSCHHHHHHHHHHHHH
T ss_pred eecccccchhhhhhhhhhhhhhhccceEEeecccchhhhccccccchhhhhhcccchhhhheeeccccccchhHHHHHHH
Confidence 788888898888875 88999 88999999995 78999999999999999999999888999999999999
Q ss_pred HHHHHHHHhCCcEEEEeccCCCcchhhhceeeEEEeeCCCCcEEeeecccCcccccccccceEEecccCCCCceeeEEee
Q psy11602 339 NSEEFYADLGIAYRVVNIVSGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLAYQSRRLLVRYGQTKKMNEKIEFVHML 418 (1083)
Q Consensus 339 ~~e~~~~~L~lpyRvv~~~~~dl~~~a~~~~DiE~w~P~~~~y~Ev~S~sn~~d~qarrl~iry~~~~~~~~~~~~~htl 418 (1083)
+++++|++|+||||||++|+||||++|+++||||||||++++|+||+|||||+|||||||+|||++. +++.+|||||
T Consensus 191 ~~~~~~~~L~lpyrvv~~~~~dl~~~a~~~~diE~w~P~~~~y~Ev~S~sn~~d~qsrRl~i~y~~~---dg~~~~~htl 267 (311)
T d1seta2 191 NAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDP---EGRVRYAYTL 267 (311)
T ss_dssp HHHHHHHHTTCCEEEEECCTTTSCTTCSEEEEEEEEEGGGTEEEEEEEEEECTTHHHHHHTCEEECT---TSCEEECEEE
T ss_pred HHHHHHHhhCCcchhccccCCCCchHHHhhhHHHHhHhhcCCcccccCceecchHHHhhcccEEECC---CCCEEeEEEe
Confidence 9999999999999999999999999999999999999999999999999999999999999999975 5678999999
Q ss_pred cccccchhHHHHHHHhhccCCCc-eecCccccccCCCcc
Q psy11602 419 NATACATTRVICAILETHQTETG-VRIPDCLRKFVPAVY 456 (1083)
Q Consensus 419 n~t~~a~~R~i~ailEn~q~~~G-i~iP~~L~py~~~~~ 456 (1083)
|||++|++|+|+|||||||++|| |.||++|+||||..+
T Consensus 268 ngT~~ai~R~l~allEn~q~~dG~v~iP~~L~py~~~~~ 306 (311)
T d1seta2 268 NNTALATPRILAMLLENHQLQDGRVRVPQALIPYMGKEV 306 (311)
T ss_dssp EEEEEEETHHHHHHHHHHBCTTSCEECCGGGHHHHSSSE
T ss_pred cCchhHHHHHHHHHHHhccCCCCcEeCChhhhhhcCCce
Confidence 99999999999999999999999 889999999998654
|
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|