Psyllid ID: psy11648


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580----
MTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYNQDKIRPGRESNPRPI
cEEEcccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccccEEEEccccccccccccHHcccccHHHHcccccccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccccccccHHHHHccccccEEEccccccccEEcccccccccccccEEccccccccccccccHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHHHHHccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEccccccccccccccccccc
ccEEcccccccccccccccHHHcccccccEEEcccccccccccccccEEEcccccccccccHHHccccccEEEEEEEccccccccccHHHccccccEEEEEEcccccccccccHHHHHHHHHHHccccccccHHHcccccccEEEcccccccccccHHHHcHHHHHHEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccccHHHcccccccEEEEccccccccccccHHHHccccccEEEEcccccccccccHHHcccccccEEEccccccccccccHccHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEccccccccccccccHHHccccccEEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHccccEEEEEEEEcccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHccccc
mtldlshnkLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEItgkdlkfidpsafdnidaCYDLTLKITNTQIeelpsglfdkiENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKknnnnnedqvSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSlfnsnefpyYILNKNLNTLEWLAMDNnniknirnysLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNyleliesdtfynlKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNqikyiypnafvnlpnlvkldlqdnklkdfnLNVFSnitskqtpmnlnlsnNYITNLyendkkqapIYIKSLdlsnnriqevpvNFLQTFADSLRKLYLDFNeikhldatafgnLDVLELLSLEHNNIAVVVKRtfigmpnlqiidLSFNEISMLTGEQFYFSFKLRILNISHNrlrslprdvfsnTIIEKLDisynqdkirpgresnprpi
MTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVkakknnnnnedqvsdREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSnitskqtpmnlNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNrlrslprdvfsntiiekldisynqdkirpgresnprpi
MTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKllsnletlllRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKllsnletlllRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYNQDKIRPGRESNPRPI
*********LSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQK**********************LSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISY****************
MTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYNQDKIRPGRESNPRP*
MTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYNQDKIR**********
*TLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYNQDKIRPGRESNPRPI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQGIFNSKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYNQDKIRPGRESNPRPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query584 2.2.26 [Sep-21-2011]
P82963 782 Chaoptin (Fragment) OS=Tr no N/A 0.570 0.425 0.348 1e-38
P12024 1315 Chaoptin OS=Drosophila me no N/A 0.643 0.285 0.298 4e-34
P70389 603 Insulin-like growth facto yes N/A 0.477 0.462 0.300 7e-26
P35859 603 Insulin-like growth facto yes N/A 0.489 0.474 0.315 1e-23
P35858 605 Insulin-like growth facto yes N/A 0.510 0.492 0.271 1e-23
O02833 605 Insulin-like growth facto N/A N/A 0.488 0.471 0.288 6e-23
Q80X72 579 Leucine-rich repeat-conta no N/A 0.5 0.504 0.294 3e-20
Q8TF66 581 Leucine-rich repeat-conta no N/A 0.558 0.561 0.281 6e-20
Q8R5M3578 Leucine-rich repeat-conta no N/A 0.623 0.629 0.273 8e-20
Q496Z2 811 TLR4 interactor with leuc no N/A 0.501 0.361 0.275 1e-19
>sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 Back     alignment and function desciption
 Score =  161 bits (407), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 188/344 (54%), Gaps = 11/344 (3%)

Query: 235 DVFEKLQLLEISFSLFNSNE-FPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNY 293
           D+ + L  L+++ +L +S + FP   + K LN LE L + NN ++N+ + S + L SL  
Sbjct: 12  DIGDSLLTLKLTHALSSSVQNFPSDAI-KILNRLEELDLSNNRLRNVPDNSFHFLRSLKK 70

Query: 294 INLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKS 353
           ++L+ N I  IH   F  +IH+ L E+  S N +  ++  TF +L +L  I L  N ++S
Sbjct: 71  VHLQDNTIEMIHRGTFQGDIHRDLTEVYFSFNSVRNVQQHTFADLIQLEQIHLDDNRIES 130

Query: 354 IKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSK 413
           ++  +F NL ++  + L  N+I  I    F NLP L  LDL  N +   + N+F  + S 
Sbjct: 131 LERRAFMNLKSLKRLNLKGNKIATIAYETFQNLPELEDLDLAYNSISSLDFNIFDQVGSL 190

Query: 414 QTPMNLNLSNNYITNL-------YENDKKQAPIY-IKSLDLSNNRIQEVPVNFLQTFADS 465
               ++N+S+N + NL       +E D     +  IK LDLS N I  V   F +    S
Sbjct: 191 GM-FHVNMSHNKLINLVVAPSVPFEQDTGLGGLQNIKVLDLSFNNITSVAKQFFRPVELS 249

Query: 466 LRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEIS 525
           L +LYL  N++ +     FGN+  L++L L HN++  +   TF     LQ +D S N IS
Sbjct: 250 LMQLYLGHNKLLNATKDLFGNMPHLQVLDLSHNSLYELDFDTFRNTKKLQWLDTSHNRIS 309

Query: 526 MLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYN 569
            +  + F F   LRI++ SHNRLRSLP ++F  T +E+LD+S+N
Sbjct: 310 EIPNDLFRFLGNLRIVDFSHNRLRSLPDNLFRETGLERLDVSHN 353




Required for photoreceptor cell morphogenesis. Mediates homophilic cellular adhesion.
Tribolium castaneum (taxid: 7070)
>sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=2 Back     alignment and function description
>sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query584
328723113 1138 PREDICTED: chaoptin-like [Acyrthosiphon 0.863 0.442 0.371 8e-70
242012034 1248 chaoptin, putative [Pediculus humanus co 0.957 0.447 0.353 5e-68
91079120 1219 PREDICTED: similar to putative GPCR clas 0.885 0.424 0.360 4e-67
194760825 1333 GF15558 [Drosophila ananassae] gi|190616 0.654 0.286 0.418 4e-64
195115565 1336 GI17327 [Drosophila mojavensis] gi|19391 0.654 0.285 0.418 1e-63
195385595 1335 GJ15952 [Drosophila virilis] gi|19414794 0.654 0.286 0.415 3e-63
198476363 1445 GA18003 [Drosophila pseudoobscura pseudo 0.652 0.263 0.417 4e-63
195437135 1357 GK18063 [Drosophila willistoni] gi|19416 0.652 0.280 0.422 4e-63
195155943 1337 GL25723 [Drosophila persimilis] gi|19411 0.654 0.285 0.413 1e-62
195030254 1339 GH10816 [Drosophila grimshawi] gi|193903 0.808 0.352 0.380 2e-62
>gi|328723113|ref|XP_001943629.2| PREDICTED: chaoptin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  271 bits (692), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 203/547 (37%), Positives = 316/547 (57%), Gaps = 43/547 (7%)

Query: 44  SKLRELEITGKDLKFIDPSAFDNIDACYDLTLKITNTQIEELPSGLFDKIENIEQMTLDL 103
           S++R L +    L+ +D +AFD + +   + + ++  +++ L    F+ +E I +  LDL
Sbjct: 269 SEVRNLHLDMNRLESLDANAFDGLRS---VRMYLSYNKLKNLNHKTFEGLERILEY-LDL 324

Query: 104 SHNKLSVL--------NMATLYSNVTKLQHL------GTTILKDREKLLSNLET-----L 144
            HN L ++        N+  LY +   L  L      G +       L  NL T      
Sbjct: 325 EHNNLGIIPTAIRTLKNLKFLYLSSNDLNKLDSADFTGVSSSLRSLSLSGNLLTEIPSHA 384

Query: 145 LLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLN 204
           L+ C K++ LN      L  + ++  K N+  E           +L+TLLL  NK+ +L 
Sbjct: 385 LMNCTKLSHLN------LGYNFIREIKENDFGE--------WARHLDTLLLMNNKLKELI 430

Query: 205 GNLFRHLYNLQELSLSFNKLQIIELNSNVF-DVFEKLQLLEISFSLFNSNEFPYYILNKN 263
           G  F++  +L+ELSLSFN +  ++  ++VF D+   L+ LEISF ++  N FP  IL ++
Sbjct: 431 GRPFKNTNSLRELSLSFNNIHYVD--ADVFLDLATSLESLEISFGVYYDN-FPVKIL-RH 486

Query: 264 LNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLS 323
           L +L WL +DNN+I ++   SL++L SL Y+NLE N+IS +    F       L+E+RL+
Sbjct: 487 LKSLLWLVLDNNDISSVPFDSLHSLDSLQYLNLESNRISVLAPRTFSSPNQTDLREVRLN 546

Query: 324 NNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAF 383
            NYL  +E +TF NL++L TIT+S N +  + + SFK L  +LNI LS+NQI+YI P+AF
Sbjct: 547 QNYLMSLEPNTFSNLQQLQTITISRNKIIEVMSHSFKELPRLLNIDLSYNQIEYIQPSAF 606

Query: 384 VNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKS 443
            +LPN  +LDLQ N+LK+  +  F N T+ +TP++LN+SNN I     +D    P++IK 
Sbjct: 607 DSLPNFKRLDLQGNQLKELRMTSFVNCTNSKTPLSLNVSNNCIERTPIDD-SLTPVHIKI 665

Query: 444 LDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVV 503
           LDLS+N +Q++P   L   + SLR LYLD N I  +  + F NL  LE+LS+  N +  +
Sbjct: 666 LDLSHNSLQDLPFKLLYFISSSLRNLYLDHNRITKIYNSEFINLTNLEVLSITENGMTSI 725

Query: 504 VKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEK 563
             + F  + +LQI+ LS N+I  L+ EQF    KLR+L+++ NRL +L  DV S T +E 
Sbjct: 726 ASKAFSNLTSLQILYLSGNKIQQLSSEQFATLPKLRVLSLARNRLSTLSWDVLSGTPLEY 785

Query: 564 LDISYNQ 570
           +D+S N+
Sbjct: 786 IDLSNNE 792




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242012034|ref|XP_002426747.1| chaoptin, putative [Pediculus humanus corporis] gi|212510923|gb|EEB14009.1| chaoptin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91079120|ref|XP_975409.1| PREDICTED: similar to putative GPCR class b orphan receptor 1 (AGAP009007-PA) [Tribolium castaneum] gi|270004885|gb|EFA01333.1| chaoptic-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194760825|ref|XP_001962633.1| GF15558 [Drosophila ananassae] gi|190616330|gb|EDV31854.1| GF15558 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195115565|ref|XP_002002327.1| GI17327 [Drosophila mojavensis] gi|193912902|gb|EDW11769.1| GI17327 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195385595|ref|XP_002051490.1| GJ15952 [Drosophila virilis] gi|194147947|gb|EDW63645.1| GJ15952 [Drosophila virilis] Back     alignment and taxonomy information
>gi|198476363|ref|XP_001357346.2| GA18003 [Drosophila pseudoobscura pseudoobscura] gi|198137660|gb|EAL34415.2| GA18003 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195437135|ref|XP_002066500.1| GK18063 [Drosophila willistoni] gi|194162585|gb|EDW77486.1| GK18063 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195155943|ref|XP_002018860.1| GL25723 [Drosophila persimilis] gi|194115013|gb|EDW37056.1| GL25723 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195030254|ref|XP_001987983.1| GH10816 [Drosophila grimshawi] gi|193903983|gb|EDW02850.1| GH10816 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query584
FB|FBgn0028888 1443 CG4168 [Drosophila melanogaste 0.815 0.329 0.348 6.9e-65
FB|FBgn0000313 1315 chp "chaoptic" [Drosophila mel 0.626 0.278 0.301 2.7e-41
FB|FBgn0261269 1092 conv "convoluted" [Drosophila 0.869 0.465 0.262 4.4e-32
WB|WBGene00002282 773 let-4 [Caenorhabditis elegans 0.604 0.456 0.279 3.2e-27
RGD|68429 603 Igfals "insulin-like growth fa 0.503 0.487 0.310 2.1e-26
MGI|MGI:1921738 579 Lrrc15 "leucine rich repeat co 0.568 0.573 0.289 6.6e-26
UNIPROTKB|F1LRE2 602 Igfals "Insulin-like growth fa 0.503 0.488 0.306 7.7e-26
FB|FBgn0259677 1639 CG42346 [Drosophila melanogast 0.914 0.325 0.254 2.6e-25
MGI|MGI:107973 603 Igfals "insulin-like growth fa 0.489 0.474 0.306 6.3e-25
UNIPROTKB|Q8TF66 581 LRRC15 "Leucine-rich repeat-co 0.568 0.571 0.301 7.1e-25
FB|FBgn0028888 CG4168 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 655 (235.6 bits), Expect = 6.9e-65, Sum P(2) = 6.9e-65
 Identities = 176/505 (34%), Positives = 274/505 (54%)

Query:    86 PSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKXXXXXXXXX 145
             PS      E +E   LDL  N+L+ + +A     ++ L HL    L   +          
Sbjct:   517 PSAFEGLTETLEY--LDLERNRLTTVPVA-----LSSLHHLKYLYLTSNQISQLNNLPSF 569

Query:   146 XRCNKITDLNGNLF---------RHLQKSIVKAKKNNNNN-EDQVSDREKXXXXXXXXXX 195
                 ++  L+GN F          + Q S +    N+  +  + +   +           
Sbjct:   570 TENLRVLSLSGNNFSMIPVLGLKNYTQLSYLNMGYNSITDIPEGIFAVDSWGSNLQTILL 629

Query:   196 RCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFD-VFEKLQLLEISFSLFNSNE 254
             R NKIT L+   F  L  +QE+SLSFN + I   +  VF+ V   L++LE+SF++F +  
Sbjct:   630 RNNKITHLHLGSFAGLEQIQEISLSFNDITIH--HPLVFENVSRTLKILELSFAVFPARS 687

Query:   255 F----PYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFH 310
                  P   L   L+ L WL +DNNN+K + N S   +  L+YINL +N++  +   LF 
Sbjct:   688 LESLDPLDALLP-LSQLIWLGLDNNNLKQVSNESFAQMRELSYINLSFNQLKTLPRGLFQ 746

Query:   311 FNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVL 370
              + H  L EI LS N LE +E+ TF++L +L T+ L  N L++I   +F NL  +  + L
Sbjct:   747 SDAHSHLVEIDLSYNGLERLEAQTFHSLGDLQTLNLQSNRLRTIARHAFHNLEFLRYLDL 806

Query:   371 SFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLY 430
             S+N++  I   AF  LPNL  LDL  N+L   +L  F  +++  TP+ LN+S+N+I + Y
Sbjct:   807 SYNRLVNISHGAFTVLPNLAALDLMHNQLCSLSLKSFLYVSNTTTPLRLNVSHNHIASFY 866

Query:   431 ENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVL 490
               D+  + +YI  LD+S+N + +   +F    A++LR L L  N++  L + AFG+L+ L
Sbjct:   867 --DELSSYMYIYQLDISHNHVTKSD-SFTN-LANTLRFLNLAHNQLGSLQSHAFGDLEFL 922

Query:   491 ELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRS 550
             E+L++ HNN+  + +R+F G+ +LQ +DLS N++  L  EQF    KLRIL I+ NRLR+
Sbjct:   923 EILNVAHNNLTSLRRRSFQGLNSLQELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRA 982

Query:   551 LPRDVFSNTIIEKLDISYNQDKIRP 575
             LPR+VF NT +E LDI+ NQ  + P
Sbjct:   983 LPREVFMNTRLEFLDIAENQLSVWP 1007


GO:0004930 "G-protein coupled receptor activity" evidence=ISS
FB|FBgn0000313 chp "chaoptic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0261269 conv "convoluted" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00002282 let-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|68429 Igfals "insulin-like growth factor binding protein, acid labile subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1921738 Lrrc15 "leucine rich repeat containing 15" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRE2 Igfals "Insulin-like growth factor-binding protein complex acid labile subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0259677 CG42346 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:107973 Igfals "insulin-like growth factor binding protein, acid labile subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TF66 LRRC15 "Leucine-rich repeat-containing protein 15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query584
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-08
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 65.6 bits (160), Expect = 4e-11
 Identities = 127/469 (27%), Positives = 201/469 (42%), Gaps = 40/469 (8%)

Query: 100 TLDLSHNKLS--VLNMATLYSNVTKLQHLGTTILKDREKL----LSNLETLLLRCNKITD 153
           TLDLS+N LS  + N    +S++ K+  LG  +L  +       L++LE L L  N++  
Sbjct: 144 TLDLSNNMLSGEIPNDIGSFSSL-KVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV- 201

Query: 154 LNGNLFRHL--QKSIVKAKKNNNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHL 211
             G + R L   KS+       NN   ++      L++L  L L  N +T    +   +L
Sbjct: 202 --GQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL 259

Query: 212 YNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFS-LFNSNEFPYYILNKNLNTLEWL 270
            NLQ L L  NKL      S    +F   +L+ +  S    S E P  ++   L  LE L
Sbjct: 260 KNLQYLFLYQNKLSGPIPPS----IFSLQKLISLDLSDNSLSGEIPELVIQ--LQNLEIL 313

Query: 271 AMDNNNIKNIRNYSLYNLTSLNYINLEYNKIS-KIHNNLFHFNIHKRLKEIRLSNNYLEL 329
            + +NN       +L +L  L  + L  NK S +I  NL     H  L  + LS N L  
Sbjct: 314 HLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL---GKHNNLTVLDLSTNNLTG 370

Query: 330 IESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNL 389
              +   +   L  + L  N L+     S     ++  + L  N      P+ F  LP +
Sbjct: 371 EIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLV 430

Query: 390 VKLDLQDNKLKDFNLNVFSNITSKQTPMN----LNLS-NNYITNLYENDKKQAPIYIKSL 444
             LD+ +N L+         I S++  M     L+L+ N +   L ++   +    +++L
Sbjct: 431 YFLDISNNNLQ-------GRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKR---LENL 480

Query: 445 DLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVV 504
           DLS N+        L + ++ L +L L  N++         +   L  L L HN ++  +
Sbjct: 481 DLSRNQFSGAVPRKLGSLSE-LMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQI 539

Query: 505 KRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLR-SLP 552
             +F  MP L  +DLS N++S    +       L  +NISHN L  SLP
Sbjct: 540 PASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP 588


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 584
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus 873 100.0
KOG4194|consensus 873 100.0
KOG0472|consensus565 100.0
KOG0472|consensus565 100.0
KOG0618|consensus 1081 99.97
KOG0618|consensus 1081 99.96
KOG0444|consensus 1255 99.96
KOG0444|consensus 1255 99.94
KOG4237|consensus498 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG4237|consensus498 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0617|consensus264 99.51
KOG0617|consensus264 99.45
KOG1909|consensus382 99.3
KOG1909|consensus382 99.3
KOG3207|consensus 505 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG1259|consensus490 99.11
KOG3207|consensus 505 99.09
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
KOG1259|consensus490 98.94
KOG0532|consensus 722 98.91
KOG0532|consensus 722 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
PLN03150623 hypothetical protein; Provisional 98.83
KOG4658|consensus889 98.8
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.79
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
KOG4658|consensus889 98.76
KOG2120|consensus419 98.75
KOG2120|consensus419 98.72
KOG0531|consensus414 98.61
PLN03150623 hypothetical protein; Provisional 98.6
KOG0531|consensus 414 98.6
KOG4341|consensus483 98.54
KOG4341|consensus483 98.49
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.41
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.36
KOG1859|consensus 1096 98.26
KOG1859|consensus 1096 98.25
KOG2982|consensus418 98.21
KOG4579|consensus177 98.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.16
KOG4579|consensus177 98.16
KOG2982|consensus418 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.06
KOG1644|consensus233 98.03
KOG1644|consensus233 97.97
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.86
PRK15386 426 type III secretion protein GogB; Provisional 97.75
KOG3665|consensus 699 97.68
KOG3665|consensus 699 97.6
PRK15386 426 type III secretion protein GogB; Provisional 97.55
KOG2123|consensus 388 97.19
KOG1947|consensus482 96.85
KOG2123|consensus388 96.84
KOG2739|consensus260 96.59
KOG4308|consensus478 96.59
KOG2739|consensus260 96.54
KOG1947|consensus482 96.34
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.94
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.77
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.61
smart0037026 LRR Leucine-rich repeats, outliers. 95.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.36
KOG4308|consensus478 95.18
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.66
smart0037026 LRR Leucine-rich repeats, outliers. 94.66
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.04
KOG3864|consensus221 90.77
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.83
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.9
KOG0473|consensus326 82.94
KOG3864|consensus221 82.74
KOG0473|consensus 326 82.06
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.4e-50  Score=453.82  Aligned_cols=503  Identities=25%  Similarity=0.235  Sum_probs=261.1

Q ss_pred             ccccCCCccceeccccccccchhhhccccccccccccc-cccc------ccceeeeecCCceeecCCccccccccceeeE
Q psy11648          2 TLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKGDQLQ-GIFN------SKLRELEITGKDLKFIDPSAFDNIDACYDLT   74 (584)
Q Consensus         2 ~l~ls~~~~~~~~~~~~~~~l~~l~~Lr~L~l~~~~l~-~l~~------~~L~~L~ls~n~~~~~~~~~~~~~~~~L~~~   74 (584)
                      .|||++|.+++..+.+    +..+++||+|++++|+++ .+|.      ++|++|++++|.+.+..+.  ..+ ++|+ +
T Consensus        73 ~L~L~~~~i~~~~~~~----~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l-~~L~-~  144 (968)
T PLN00113         73 SIDLSGKNISGKISSA----IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSI-PNLE-T  144 (968)
T ss_pred             EEEecCCCccccCChH----HhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--ccc-CCCC-E
Confidence            4666666666655543    456666666677777665 3543      6677777777766554332  223 5666 7


Q ss_pred             EEecCcccc-cccccccccccccceeeeecCCCceeeechhhhccchhcccccCceeccchhhcCCccceeecccccccc
Q psy11648         75 LKITNTQIE-ELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLGTTILKDREKLLSNLETLLLRCNKITD  153 (584)
Q Consensus        75 L~ls~n~i~-~l~~~~~~~~~~L~~~~L~ls~~~l~~~~~~~~~~~~~l~~~n~l~~l~~~l~~~~~L~~L~l~~n~i~~  153 (584)
                      |++++|.+. .+|..+.. ..+|+  +|++++|.+.+.                   +|..+.++++|++|++++|.+.+
T Consensus       145 L~Ls~n~~~~~~p~~~~~-l~~L~--~L~L~~n~l~~~-------------------~p~~~~~l~~L~~L~L~~n~l~~  202 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGS-FSSLK--VLDLGGNVLVGK-------------------IPNSLTNLTSLEFLTLASNQLVG  202 (968)
T ss_pred             EECcCCcccccCChHHhc-CCCCC--EEECccCccccc-------------------CChhhhhCcCCCeeeccCCCCcC
Confidence            777777665 44444333 33377  777777666543                   33445555667777777766655


Q ss_pred             ccccccchhhHHHHHhhcC-CCCCCcccchhHhhccCCcEEEcCCCcccccchhhhcCCCCCCEEEcCCCccceeecCCc
Q psy11648        154 LNGNLFRHLQKSIVKAKKN-NNNNEDQVSDREKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSN  232 (584)
Q Consensus       154 ~~~~~~~~~~~~L~~L~l~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~  232 (584)
                      ..+..+.. .++|+.|+++ +......+..+. .+++|++|++++|.+.+..+..++++++|++|++++|.+.+.  .+.
T Consensus       203 ~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~--~p~  278 (968)
T PLN00113        203 QIPRELGQ-MKSLKWIYLGYNNLSGEIPYEIG-GLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGP--IPP  278 (968)
T ss_pred             cCChHHcC-cCCccEEECcCCccCCcCChhHh-cCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeecc--Cch
Confidence            43332221 2334444444 222223333443 455555555555555554455555555555555555555443  444


Q ss_pred             cccccccceEEeecccccCCCCchhhHhhhcCCCCCEEEccCccccccccccccCCCCCcEEEcccCCCccccccccccc
Q psy11648        233 VFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFN  312 (584)
Q Consensus       233 ~~~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~~i~~~~~~~~  312 (584)
                      .+..+++|++|++++|.+. +.+|..+  ..+++|++|++++|.+++..+..+..+++|+.|++++|.+....+..+.. 
T Consensus       279 ~l~~l~~L~~L~Ls~n~l~-~~~p~~~--~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~-  354 (968)
T PLN00113        279 SIFSLQKLISLDLSDNSLS-GEIPELV--IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK-  354 (968)
T ss_pred             hHhhccCcCEEECcCCeec-cCCChhH--cCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhC-
Confidence            5555555555555555554 4444443  45555555555555555444445555555555555555554222222222 


Q ss_pred             ccCCccEEEcCCCcccccccccccCCCCCcEEEccCCcCCCcChhhhccCcCCCEEeccCCCCCccCCccCCCCCCCcEE
Q psy11648        313 IHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKL  392 (584)
Q Consensus       313 ~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L  392 (584)
                       +++|+.|++++|.+.+..+..+..++.++.+++++|.+.+..+..+..+++|+.+++++|.+++..|..+..++.|+.+
T Consensus       355 -~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  433 (968)
T PLN00113        355 -HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL  433 (968)
T ss_pred             -CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEE
Confidence             4555555555555555444445555555555555555555555555555555555555555555445555555555555


Q ss_pred             ecCCCCCCCCChhhhcccccCCCCceEECCCCccccccccccccccCcccEEEccCCCCCCCChhhHHHhhCCCcEEEcc
Q psy11648        393 DLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLD  472 (584)
Q Consensus       393 ~l~~~~l~~~~~~~~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~  472 (584)
                      ++++|.+.+..+..+.   ..+.|+.+++++|.+....+...  ..++|+.|++++|++....+..+..+ ++|+.|+++
T Consensus       434 ~Ls~N~l~~~~~~~~~---~l~~L~~L~L~~n~~~~~~p~~~--~~~~L~~L~ls~n~l~~~~~~~~~~l-~~L~~L~Ls  507 (968)
T PLN00113        434 DISNNNLQGRINSRKW---DMPSLQMLSLARNKFFGGLPDSF--GSKRLENLDLSRNQFSGAVPRKLGSL-SELMQLKLS  507 (968)
T ss_pred             ECcCCcccCccChhhc---cCCCCcEEECcCceeeeecCccc--ccccceEEECcCCccCCccChhhhhh-hccCEEECc
Confidence            5555555543332221   22344555555554443222211  12445555555555443333344444 455555555


Q ss_pred             CCcccccCccccCCCcccCeeeccCcccccccccccCCCCCccEEECCCCCCCCcCcccccCCCCccEEEcCCCcCC
Q psy11648        473 FNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLR  549 (584)
Q Consensus       473 ~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~ls~n~i~~~~~~~~~~~~~L~~L~L~~n~l~  549 (584)
                      +|++.+..+..+..+++|++|++++|.+++.+|..|..+++|+.|++++|++.+..|..+..+++|++|++++|++.
T Consensus       508 ~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~  584 (968)
T PLN00113        508 ENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLH  584 (968)
T ss_pred             CCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcce
Confidence            55554444444445555555555555555555555555555555555555555444444444555555555555444



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query584
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-15
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-14
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 5e-13
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-12
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 5e-12
3o6n_A 390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 8e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-12
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-07
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-11
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-10
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-04
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 3e-10
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 1e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 5e-10
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-08
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 5e-10
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 6e-10
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-08
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 7e-10
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-05
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 7e-10
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-09
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-09
3m19_A 251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-09
3m18_A 251 Crystal Structure Of Variable Lymphocyte Receptor V 7e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 7e-09
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 7e-09
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 7e-09
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-08
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-05
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 8e-08
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 1e-07
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-07
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 5e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-07
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-05
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 3e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-06
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-05
2xot_A 361 Crystal Structure Of Neuronal Leucine Rich Repeat P 7e-05
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 9e-05
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 1e-04
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-04
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 6e-04
4eco_A 636 Crystal Structure Of A Hypothetical Protein (Bacegg 8e-04
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure

Iteration: 1

Score = 79.0 bits (193), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 70/231 (30%), Positives = 116/231 (50%), Gaps = 10/231 (4%) Query: 293 YINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLK 352 Y+NL+ N I I + F H L+ ++LS N + IE F L LNT+ L N L Sbjct: 39 YLNLQENSIQVIRTDTFKHLRH--LEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLT 96 Query: 353 SIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQD-NKLKDFNLNVFSNIT 411 ++ T +F+ L+ + + L N I+ I AF +P+L +LDL + +L+ + F + Sbjct: 97 TVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGL- 155 Query: 412 SKQTPMNLNLSNNYITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYL 471 +NL N + NL + A + ++ L+LS NR+ + Q SLRKL+L Sbjct: 156 -----VNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLT-SLRKLWL 209 Query: 472 DFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFN 522 ++ ++ AF +L LE L+L HNN+ + F + L+ + L+ N Sbjct: 210 MHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHN 260
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query584
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-60
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-60
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-48
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-20
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-59
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-53
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-53
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-46
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-53
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-50
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-49
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-48
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-39
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-38
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-47
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-37
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-47
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-44
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-41
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-40
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-39
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-39
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-40
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-36
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-37
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-35
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-38
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-37
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-36
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-38
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-38
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-33
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-32
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-30
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-30
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-33
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-34
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-31
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-29
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-32
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-28
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-32
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-28
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-23
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-30
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-30
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-21
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-25
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-24
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-24
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-23
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-16
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 4e-07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 7e-04
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
 Score =  213 bits (544), Expect = 1e-61
 Identities = 100/514 (19%), Positives = 196/514 (38%), Gaps = 27/514 (5%)

Query: 70  CYDLTLKITNTQIEELPSGLFDKIENIEQMTLDLSHNKLSVLNMATLYSNVTKLQHLG-- 127
             + T    N  + E+P  L +  E      L+ S N L  +   T  S +  L  L   
Sbjct: 12  EVNKTYNCENLGLNEIPGTLPNSTE-----CLEFSFNVLPTIQNTTF-SRLINLTFLDLT 65

Query: 128 ----TTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKNNNNNEDQVSDR 183
                 I +D  +    L+TL+L  N +  +         K++                 
Sbjct: 66  RCQIYWIHEDTFQSQHRLDTLVLTANPLIFMAETALSGP-KALKHLFFIQTGISSIDFIP 124

Query: 184 EKLLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLL 243
                 LE+L L  N I+ +          L+ L    N +    L+       ++   L
Sbjct: 125 LHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIH--YLSKEDMSSLQQATNL 182

Query: 244 EISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISK 303
            ++ +  +         +  +          N +   +      + SL     E      
Sbjct: 183 SLNLNGNDIAGIEPGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDED 242

Query: 304 IHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLN 363
           I   +F       ++ I L  +Y   I S+TF+    L  + L+   L  +  +    L+
Sbjct: 243 ISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCFSGLQELDLTATHLSELP-SGLVGLS 301

Query: 364 NMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLK-DFNLNVFSNITSKQTPMNLNLS 422
            +  +VLS N+ + +   +  N P+L  L ++ N  + +       N+ + +    L+LS
Sbjct: 302 TLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLENLENLRE---LDLS 358

Query: 423 NNYITNLYENDKK-QAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDA 481
           ++ I      + + +   +++SL+LS N    +     +     L  L L F  +K  DA
Sbjct: 359 HDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFK-ECPQLELLDLAFTRLKVKDA 417

Query: 482 -TAFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQ---FYFSFK 537
            + F NL +L++L+L H+ + +  ++ F G+P LQ ++L  N       ++        +
Sbjct: 418 QSPFQNLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGR 477

Query: 538 LRILNISHNRLRSLPRDVFSNTI-IEKLDISYNQ 570
           L IL +S   L S+ +  F++   +  +D+S+N+
Sbjct: 478 LEILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNR 511


>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query584
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.6
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.54
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.51
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.92
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.58
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-56  Score=485.01  Aligned_cols=555  Identities=23%  Similarity=0.184  Sum_probs=377.1

Q ss_pred             ccccCCCcccee---ccccccccchhhhccccccccccccccccc-----ccceeeeecCCceeecCCc--cccccccce
Q psy11648          2 TLDLSHNKLSVL---NMATLYSNVTKLQHLGTTILKGDQLQGIFN-----SKLRELEITGKDLKFIDPS--AFDNIDACY   71 (584)
Q Consensus         2 ~l~ls~~~~~~~---~~~~~~~~l~~l~~Lr~L~l~~~~l~~l~~-----~~L~~L~ls~n~~~~~~~~--~~~~~~~~L   71 (584)
                      .|||+++.+++.   .+.+    +..+++|+.++++.+.+..+|.     ++|++|++++|.+.+..+.  .+.++ ++|
T Consensus        54 ~L~L~~~~l~g~~~~l~~~----l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l-~~L  128 (768)
T 3rgz_A           54 SIDLSSKPLNVGFSAVSSS----LLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSC-SGL  128 (768)
T ss_dssp             EEECTTSCCCEEHHHHHHH----TTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGC-TTC
T ss_pred             EEECCCCCcCCccCccChh----HhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCC-CCC
Confidence            578888888764   3332    4455556555555555544333     5666666666666554444  55555 556


Q ss_pred             eeEEEecCcccc-cccccccccccccceeeeecCCCceeeechhh---hccchhccc-----------------------
Q psy11648         72 DLTLKITNTQIE-ELPSGLFDKIENIEQMTLDLSHNKLSVLNMAT---LYSNVTKLQ-----------------------  124 (584)
Q Consensus        72 ~~~L~ls~n~i~-~l~~~~~~~~~~L~~~~L~ls~~~l~~~~~~~---~~~~~~l~~-----------------------  124 (584)
                      + +|++++|.+. .+|..++....+|+  +||+++|.+++..+..   +..+..+..                       
T Consensus       129 ~-~L~Ls~n~l~~~~~~~~~~~l~~L~--~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L  205 (768)
T 3rgz_A          129 K-FLNVSSNTLDFPGKVSGGLKLNSLE--VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFL  205 (768)
T ss_dssp             C-EEECCSSEEECCSSCCSCCCCTTCS--EEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEE
T ss_pred             C-EEECcCCccCCcCCHHHhccCCCCC--EEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEE
Confidence            6 6666666554 33444433444466  6666666665555443   222222211                       


Q ss_pred             ---ccCceeccchhhcCCccceeeccccccccccccccchhhHHHHHhhcC-CCCCCcccchhHhhccCCcEEEcCCCcc
Q psy11648        125 ---HLGTTILKDREKLLSNLETLLLRCNKITDLNGNLFRHLQKSIVKAKKN-NNNNEDQVSDREKLLSNLETLLLRCNKI  200 (584)
Q Consensus       125 ---~n~l~~l~~~l~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~l~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~  200 (584)
                         .|.+++.++.+.++++|++|++++|.+++..+..+. .+++|++|+++ +......+..   .+++|++|++++|.+
T Consensus       206 ~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~-~l~~L~~L~Ls~n~l~~~~~~~---~l~~L~~L~L~~n~l  281 (768)
T 3rgz_A          206 DVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAIS-TCTELKLLNISSNQFVGPIPPL---PLKSLQYLSLAENKF  281 (768)
T ss_dssp             ECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTT-TCSSCCEEECCSSCCEESCCCC---CCTTCCEEECCSSEE
T ss_pred             ECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHh-cCCCCCEEECCCCcccCccCcc---ccCCCCEEECcCCcc
Confidence               344443222255555555555555555443333322 22345555555 2222222211   345555555555555


Q ss_pred             cccchhhhcC-CCCCCEEEcCCCccceeecCCccccccccceEEeecccccCCCCchhhHhhhcCCCCCEEEccCccccc
Q psy11648        201 TDLNGNLFRH-LYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLNTLEWLAMDNNNIKN  279 (584)
Q Consensus       201 ~~~~~~~~~~-~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~~L~~L~l~~~~l~~  279 (584)
                      ++..+..+.. +++|++|++++|.+.+.  .+..+..+++|++|++++|.+. +.+|...+ ..+++|++|++++|.+++
T Consensus       282 ~~~ip~~~~~~~~~L~~L~Ls~n~l~~~--~p~~~~~l~~L~~L~L~~n~l~-~~ip~~~l-~~l~~L~~L~Ls~n~l~~  357 (768)
T 3rgz_A          282 TGEIPDFLSGACDTLTGLDLSGNHFYGA--VPPFFGSCSLLESLALSSNNFS-GELPMDTL-LKMRGLKVLDLSFNEFSG  357 (768)
T ss_dssp             EESCCCCSCTTCTTCSEEECCSSEEEEC--CCGGGGGCTTCCEEECCSSEEE-EECCHHHH-TTCTTCCEEECCSSEEEE
T ss_pred             CCccCHHHHhhcCcCCEEECcCCcCCCc--cchHHhcCCCccEEECCCCccc-CcCCHHHH-hcCCCCCEEeCcCCccCc
Confidence            5444444443 36777777777766655  5666777777777777777665 56666544 677777777777777765


Q ss_pred             cccccccCCC-CCcEEEcccCCCcccccccccccccCCccEEEcCCCcccccccccccCCCCCcEEEccCCcCCCcChhh
Q psy11648        280 IRNYSLYNLT-SLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTS  358 (584)
Q Consensus       280 ~~~~~l~~l~-~L~~L~l~~~~l~~i~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~  358 (584)
                      ..+..+..++ +|++|++++|.+.......+....+++|+.|++++|.+++..+..+..+++|+.|++++|.+.+..+..
T Consensus       358 ~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~  437 (768)
T 3rgz_A          358 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS  437 (768)
T ss_dssp             CCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGG
T ss_pred             cccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHH
Confidence            5555666665 677777777766532222222112567888888888888777778888889999999999888888888


Q ss_pred             hccCcCCCEEeccCCCCCccCCccCCCCCCCcEEecCCCCCCCCChhhhcccccCCCCceEECCCCcccccccccccccc
Q psy11648        359 FKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYENDKKQAP  438 (584)
Q Consensus       359 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~~~  438 (584)
                      +..+++|+.|++++|.+.+..|..+..+++|++|++++|.+++..+..+..   ++.|+.|++++|++++..+.. +..+
T Consensus       438 l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~---l~~L~~L~L~~N~l~~~~p~~-~~~l  513 (768)
T 3rgz_A          438 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN---CTNLNWISLSNNRLTGEIPKW-IGRL  513 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG---CTTCCEEECCSSCCCSCCCGG-GGGC
T ss_pred             HhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhc---CCCCCEEEccCCccCCcCChH-HhcC
Confidence            888899999999999888887888888899999999999888776665543   468889999999888554433 3347


Q ss_pred             CcccEEEccCCCCCCCChhhHHHhhCCCcEEEccCCcccccCcc------------------------------------
Q psy11648        439 IYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDAT------------------------------------  482 (584)
Q Consensus       439 ~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~------------------------------------  482 (584)
                      ++|++|++++|.+....+..+..+ ++|+.|++++|++.+..|.                                    
T Consensus       514 ~~L~~L~L~~N~l~~~~p~~l~~l-~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  592 (768)
T 3rgz_A          514 ENLAILKLSNNSFSGNIPAELGDC-RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGN  592 (768)
T ss_dssp             TTCCEEECCSSCCEEECCGGGGGC-TTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEE
T ss_pred             CCCCEEECCCCcccCcCCHHHcCC-CCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccc
Confidence            889999999998874444667777 8899999998877643222                                    


Q ss_pred             ----------------------------------ccCCCcccCeeeccCcccccccccccCCCCCccEEECCCCCCCCcC
Q psy11648        483 ----------------------------------AFGNLDVLELLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLT  528 (584)
Q Consensus       483 ----------------------------------~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~ls~n~i~~~~  528 (584)
                                                        .+..+++|+.||+++|.+++.+|..++.+++|+.|++++|++++.+
T Consensus       593 ~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~i  672 (768)
T 3rgz_A          593 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI  672 (768)
T ss_dssp             EEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCC
T ss_pred             ccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCC
Confidence                                              2445678999999999999999999999999999999999999999


Q ss_pred             cccccCCCCccEEEcCCCcCC-ccCccccCCCCcceEECCCCCCC-CCCCC
Q psy11648        529 GEQFYFSFKLRILNISHNRLR-SLPRDVFSNTIIEKLDISYNQDK-IRPGR  577 (584)
Q Consensus       529 ~~~~~~~~~L~~L~L~~n~l~-~lp~~l~~~~~L~~l~l~~n~l~-~~p~~  577 (584)
                      |..+..+++|+.|+|++|+++ .+|..+..+++|+.|++++|+++ .+|+.
T Consensus       673 p~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          673 PDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS
T ss_pred             ChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            999999999999999999999 78999999999999999999998 77764



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 584
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 78.5 bits (192), Expect = 2e-16
 Identities = 54/266 (20%), Positives = 111/266 (41%), Gaps = 17/266 (6%)

Query: 312 NIHKRLKEIRLSNNYLELIESDTFYNLKELNTITLSYNLLKSIKTTSFKNLNNMLNIVLS 371
           ++      + L NN +  I+   F NLK L+T+ L  N +  I   +F  L  +  + LS
Sbjct: 28  DLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLS 87

Query: 372 FNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNYITNLYE 431
            NQ+K +       L  L   + +  K++    N  + +   +   N   S+      ++
Sbjct: 88  KNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQ 147

Query: 432 NDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLE 491
             KK     +  + +++  I  +P         SL +L+LD N+I  +DA +   L+ L 
Sbjct: 148 GMKK-----LSYIRIADTNITTIPQGLPP----SLTELHLDGNKITKVDAASLKGLNNLA 198

Query: 492 LLSLEHNNIAVVVKRTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSL 551
            L L  N+I+ V   +    P+L+ + L+ N++  + G        ++++ + +N + ++
Sbjct: 199 KLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADH-KYIQVVYLHNNNISAI 257

Query: 552 PRDVFS-------NTIIEKLDISYNQ 570
             + F              + +  N 
Sbjct: 258 GSNDFCPPGYNTKKASYSGVSLFSNP 283


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query584
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.47
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.95  E-value=4.4e-25  Score=218.99  Aligned_cols=342  Identities=26%  Similarity=0.313  Sum_probs=252.2

Q ss_pred             hccCCcEEEcCCCcccccchhhhcCCCCCCEEEcCCCccceeecCCccccccccceEEeecccccCCCCchhhHhhhcCC
Q psy11648        186 LLSNLETLLLRCNKITDLNGNLFRHLYNLQELSLSFNKLQIIELNSNVFDVFEKLQLLEISFSLFNSNEFPYYILNKNLN  265 (584)
Q Consensus       186 ~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~  265 (584)
                      .+.+|++|++++++++.+  +.++.+++|++|++++|++++.   + .+..+++|++|++++|.+.  .++. +  +.++
T Consensus        42 ~l~~l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l---~-~l~~L~~L~~L~L~~n~i~--~i~~-l--~~l~  110 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDI---T-PLKNLTKLVDILMNNNQIA--DITP-L--ANLT  110 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCC---G-GGTTCTTCCEEECCSSCCC--CCGG-G--TTCT
T ss_pred             HhCCCCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCC---c-cccCCcccccccccccccc--cccc-c--cccc
Confidence            578899999999999876  3588899999999999998765   2 4888999999999999885  4554 2  6889


Q ss_pred             CCCEEEccCccccccccccccCCCCCcEEEcccCCCcccccccccccccCCccEEEcCCCcccccccccccCCCCCcEEE
Q psy11648        266 TLEWLAMDNNNIKNIRNYSLYNLTSLNYINLEYNKISKIHNNLFHFNIHKRLKEIRLSNNYLELIESDTFYNLKELNTIT  345 (584)
Q Consensus       266 ~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~~i~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~  345 (584)
                      +|+.++++++.++....  ......+.......+.+..+.......  ..............     ..+..........
T Consensus       111 ~L~~L~~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~--~~~~~~~~~~~~~~-----~~~~~~~~~~~~~  181 (384)
T d2omza2         111 NLTGLTLFNNQITDIDP--LKNLTNLNRLELSSNTISDISALSGLT--SLQQLSFGNQVTDL-----KPLANLTTLERLD  181 (384)
T ss_dssp             TCCEEECCSSCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCT--TCSEEEEEESCCCC-----GGGTTCTTCCEEE
T ss_pred             ccccccccccccccccc--ccccccccccccccccccccccccccc--cccccccccccchh-----hhhcccccccccc
Confidence            99999999988887654  344566777777666554333322111  11111111111111     1233344444555


Q ss_pred             ccCCcCCCcChhhhccCcCCCEEeccCCCCCccCCccCCCCCCCcEEecCCCCCCCCChhhhcccccCCCCceEECCCCc
Q psy11648        346 LSYNLLKSIKTTSFKNLNNMLNIVLSFNQIKYIYPNAFVNLPNLVKLDLQDNKLKDFNLNVFSNITSKQTPMNLNLSNNY  425 (584)
Q Consensus       346 l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~l~~L~l~~~~  425 (584)
                      ...+....  ......+++++.+++++|.+++..+  +..+++|+++++++|.+++.+     .+...+.++.+++++|.
T Consensus       182 ~~~~~~~~--~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~-----~l~~l~~L~~L~l~~n~  252 (384)
T d2omza2         182 ISSNKVSD--ISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIG-----TLASLTNLTDLDLANNQ  252 (384)
T ss_dssp             CCSSCCCC--CGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCG-----GGGGCTTCSEEECCSSC
T ss_pred             cccccccc--ccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcc-----hhhcccccchhccccCc
Confidence            55544332  2345677888888888888887633  456788899999988877643     22345678889999888


Q ss_pred             cccccccccccccCcccEEEccCCCCCCCChhhHHHhhCCCcEEEccCCcccccCccccCCCcccCeeeccCcccccccc
Q psy11648        426 ITNLYENDKKQAPIYIKSLDLSNNRIQEVPVNFLQTFADSLRKLYLDFNEIKHLDATAFGNLDVLELLSLEHNNIAVVVK  505 (584)
Q Consensus       426 l~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~  505 (584)
                      +++.++   +..+++|++++++++.+..++.  +..+ +.++.++++.|.+.+..  .+..+++++++++++|.+++.. 
T Consensus       253 l~~~~~---~~~~~~L~~L~l~~~~l~~~~~--~~~~-~~l~~l~~~~n~l~~~~--~~~~~~~l~~L~ls~n~l~~l~-  323 (384)
T d2omza2         253 ISNLAP---LSGLTKLTELKLGANQISNISP--LAGL-TALTNLELNENQLEDIS--PISNLKNLTYLTLYFNNISDIS-  323 (384)
T ss_dssp             CCCCGG---GTTCTTCSEEECCSSCCCCCGG--GTTC-TTCSEEECCSSCCSCCG--GGGGCTTCSEEECCSSCCSCCG-
T ss_pred             cCCCCc---ccccccCCEeeccCcccCCCCc--cccc-ccccccccccccccccc--ccchhcccCeEECCCCCCCCCc-
Confidence            887654   3447899999999999887753  5566 88999999999887653  4678899999999999998764 


Q ss_pred             cccCCCCCccEEECCCCCCCCcCcccccCCCCccEEEcCCCcCCccCccccCCCCcceEECCCC
Q psy11648        506 RTFIGMPNLQIIDLSFNEISMLTGEQFYFSFKLRILNISHNRLRSLPRDVFSNTIIEKLDISYN  569 (584)
Q Consensus       506 ~~~~~~~~L~~L~ls~n~i~~~~~~~~~~~~~L~~L~L~~n~l~~lp~~l~~~~~L~~l~l~~n  569 (584)
                       .+..+++|++|++++|++++++  .+.++++|++|++++|+++.++. +..+++|+.|+|++|
T Consensus       324 -~l~~l~~L~~L~L~~n~l~~l~--~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         324 -PVSSLTKLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             -GGGGCTTCCEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCCE
T ss_pred             -ccccCCCCCEEECCCCCCCCCh--hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCCC
Confidence             3788999999999999998864  48889999999999999999874 788899999999987



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure