Psyllid ID: psy11858

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MTLSMSSTLSTNSTLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKANECVSKNKVCPERKSNLRPSAHKADAYVRRRGAHTQTPPLFSHGLSPLSLPDSSHALLITRRAYVRRRGAHTQTPPLFSHGLSPLSLPDSSL
cccccccccccHHHHHHHHccccccccccccEEcccccccccccccccEEccccHHHHHHHHHHHHHcccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccc
cccEEEEEEcccccEEEcccccHHHHcHHHcEccHHHHHccccccccEEEccccHHHHHHHHHHHcccccccccEccccccEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHcHEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcHHHHHHHHHHHHHccccccccHHccccEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccc
mtlsmsstlstnSTLVETVSINYedfnesfltcgtclcmydggehtpkllpcshtvclHCLSRIAasqtretgtlrcpicreqitiprggvaalppsFLVNQLLDLMSRQrrhiipkcsthnsqellfcetcdtvfclqctggsnhsstsgdsehtiIPFSIAIKRMSEILLYKAnecvsknkvcperksnlrpsahkadayvrrrgahtqtpplfshglsplslpdsshaLLITRRAYVRrrgahtqtpplfshglsplslpdssl
mtlsmsstlstnsTLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAasqtretgtlrcpICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTGGsnhsstsgdsehTIIPFSIAIKRMSEILLYKANEcvsknkvcperksnlrpsahKADAYVRRRGAHTQTPPLFSHGLSPLSLPDSSHALLITRRAYVRRRGAHTqtpplfshglsplslpdssl
mtlsmsstlstnstlvetvsINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKANECVSKNKVCPERKSNLRPSAHKADAYVRRRGAHTQTPPLFSHGLSPLSLPDSSHALLITRRAYVRRRGAHTQTPPLFSHGlsplslpdssl
*************TLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTG************HTIIPFSIAIKRMSEILLYKANECVSKNKV**********************************************ALLITRRAYVR**************************
*****************************FLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDL******************ELLFCETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIA***************VS**KVCPERKSNLRPSAHKADAYVRRRGAHTQTPPLFSHGLS**********************************************
************STLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTG***********EHTIIPFSIAIKRMSEILLYKANECVSKNKVCPERKSNLRPSAHKADAYVRRRGAHTQTPPLFSHGLSPLSLPDSSHALLITRRAYVRRRGAHTQTPPLFSHGLS*********
**LSMSSTLSTNSTLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKANECVSKNKVCPERKSNLRPSAHKADAYVRRRGAHTQTPPLFSHGLSPLSLPDSSHALLITRRAYVRRRGAHTQT******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLSMSSTLSTNSTLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKANECVSKNKVCPERKSNLRPSAHKADAYVRRRGAHTQTPPLFSHGLSPLSLPDSSHALLITRRAYVRRRGAHTQTPPLFSHGLSPLSLPDSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query267 2.2.26 [Sep-21-2011]
F7H9X2 744 Tripartite motif-containi yes N/A 0.565 0.202 0.279 8e-14
D2GXS7 744 Tripartite motif-containi yes N/A 0.565 0.202 0.279 8e-14
Q9C040 744 Tripartite motif-containi yes N/A 0.565 0.202 0.279 9e-14
Q9ESN6 744 Tripartite motif-containi yes N/A 0.565 0.202 0.279 1e-13
A4IF63 744 Tripartite motif-containi yes N/A 0.565 0.202 0.274 1e-13
D3ZQG6 744 Tripartite motif-containi yes N/A 0.565 0.202 0.279 2e-13
O75382 744 Tripartite motif-containi no N/A 0.415 0.149 0.305 2e-11
Q80VI1 734 E3 ubiquitin-protein liga no N/A 0.284 0.103 0.435 3e-11
E1BD59 732 E3 ubiquitin-protein liga no N/A 0.284 0.103 0.435 5e-11
O70277 744 Tripartite motif-containi no N/A 0.415 0.149 0.305 6e-11
>sp|F7H9X2|TRIM2_CALJA Tripartite motif-containing protein 2 OS=Callithrix jacchus GN=TRIM2 PE=3 SV=1 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 83/186 (44%), Gaps = 35/186 (18%)

Query: 26  FNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQIT 85
            ++ FL C  CL  Y      PK+LPC HT C  CL     + +    TL CP+CR+   
Sbjct: 16  IDKQFLICSICLERY----KNPKVLPCLHTFCERCLQNYIPAHSL---TLSCPVCRQTSI 68

Query: 86  IPRGGVAALPPSFLVNQLLDLMSR------QRRHIIP-----------KCSTHNSQEL-L 127
           +P  GVAAL  +F +  L+D++ R      +   I+             C  H+   +  
Sbjct: 69  LPEKGVAALQNNFFITNLMDVLQRTPGSNVEESSILETVTAVAAGKPLSCPNHDGNVMEF 128

Query: 128 FCETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKANECVSKNKVCPE 187
           +C++C+T  C +CT G +       +EH  +P    +++    L  + +     NK  PE
Sbjct: 129 YCQSCETAMCRECTEGEH-------AEHPTVPLKDVVEQHKASLQVQLDAV---NKRLPE 178

Query: 188 RKSNLR 193
             S L+
Sbjct: 179 IDSALQ 184
E3 ubiquitin-protein ligase that mediates the ubiquitination of phosphorylated BCL2L11. Also mediates the UBE2D1-dependent ubiquitination of NEFL. Plays a neuroprotective function. May play a role in neuronal rapid ischemic tolerance.
Callithrix jacchus (taxid: 9483)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|D2GXS7|TRIM2_AILME Tripartite motif-containing protein 2 OS=Ailuropoda melanoleuca GN=TRIM2 PE=3 SV=1 Back     alignment and function description
>sp|Q9C040|TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens GN=TRIM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ESN6|TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus GN=Trim2 PE=1 SV=1 Back     alignment and function description
>sp|A4IF63|TRIM2_BOVIN Tripartite motif-containing protein 2 OS=Bos taurus GN=TRIM2 PE=2 SV=1 Back     alignment and function description
>sp|D3ZQG6|TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus GN=Trim2 PE=1 SV=2 Back     alignment and function description
>sp|O75382|TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens GN=TRIM3 PE=1 SV=2 Back     alignment and function description
>sp|Q80VI1|TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus GN=Trim56 PE=1 SV=1 Back     alignment and function description
>sp|E1BD59|TRI56_BOVIN E3 ubiquitin-protein ligase TRIM56 OS=Bos taurus GN=TRIM56 PE=3 SV=1 Back     alignment and function description
>sp|O70277|TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus GN=Trim3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
340713996 702 PREDICTED: tripartite motif-containing p 0.644 0.245 0.867 7e-84
350400611 932 PREDICTED: tripartite motif-containing p 0.644 0.184 0.867 8e-84
340713994 927 PREDICTED: tripartite motif-containing p 0.644 0.185 0.867 1e-83
328780417 927 PREDICTED: tripartite motif-containing p 0.644 0.185 0.862 5e-83
380025130 927 PREDICTED: LOW QUALITY PROTEIN: triparti 0.644 0.185 0.862 6e-83
383862071 936 PREDICTED: tripartite motif-containing p 0.644 0.183 0.862 7e-83
307203608 987 Chymotrypsin-1 [Harpegnathos saltator] 0.647 0.175 0.838 2e-82
91092518 685 PREDICTED: similar to NHL (ring finger b 0.644 0.251 0.843 4e-82
211065505 700 tripartite motif-containing 2 protein-li 0.647 0.247 0.832 2e-81
307180992 687 Tripartite motif-containing protein 2 [C 0.647 0.251 0.832 2e-81
>gi|340713996|ref|XP_003395519.1| PREDICTED: tripartite motif-containing protein 2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  316 bits (809), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 151/174 (86%), Positives = 160/174 (91%), Gaps = 2/174 (1%)

Query: 9   LSTNSTLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQ 68
           +S +S LVETVSINYEDFNESFLTCGTCLC+YDGGEHTPKLLPCSHTVCLHCL+RIAASQ
Sbjct: 17  VSMSSMLVETVSINYEDFNESFLTCGTCLCVYDGGEHTPKLLPCSHTVCLHCLTRIAASQ 76

Query: 69  TRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLF 128
           TRETG  RCPICRE ITIPRGGVAALPPSFLVNQLLDLMSRQRR +IPKCS H +QELLF
Sbjct: 77  TRETGAFRCPICRELITIPRGGVAALPPSFLVNQLLDLMSRQRREVIPKCSVHINQELLF 136

Query: 129 CETCDTVFCLQCTGGSNHSSTS-GDSEHTIIPFSIAIKRMSEILLYKANECVSK 181
           CETCDTVFC  CTGG NH+ TS G +EHTIIPFSIAIKRMSEILLYKANEC+SK
Sbjct: 137 CETCDTVFCTVCTGG-NHAGTSPGCTEHTIIPFSIAIKRMSEILLYKANECISK 189

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350400611|ref|XP_003485898.1| PREDICTED: tripartite motif-containing protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713994|ref|XP_003395518.1| PREDICTED: tripartite motif-containing protein 2-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328780417|ref|XP_392730.4| PREDICTED: tripartite motif-containing protein 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380025130|ref|XP_003696332.1| PREDICTED: LOW QUALITY PROTEIN: tripartite motif-containing protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|383862071|ref|XP_003706507.1| PREDICTED: tripartite motif-containing protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307203608|gb|EFN82637.1| Chymotrypsin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91092518|ref|XP_969733.1| PREDICTED: similar to NHL (ring finger b-box coiled coil) domain containing family member (nhl-3) [Tribolium castaneum] gi|270012903|gb|EFA09351.1| hypothetical protein TcasGA2_TC001677 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|211065505|ref|NP_001127784.2| tripartite motif-containing 2 protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307180992|gb|EFN68766.1| Tripartite motif-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
WB|WBGene00003599 698 nhl-3 [Caenorhabditis elegans 0.569 0.217 0.532 3.8e-43
ZFIN|ZDB-GENE-080522-4 774 trim3a "tripartite motif-conta 0.292 0.100 0.388 8.5e-16
UNIPROTKB|C9JVI3138 TRIM2 "Tripartite motif-contai 0.284 0.550 0.385 2.2e-15
UNIPROTKB|E9PMK8261 TRIM3 "Tripartite motif-contai 0.430 0.440 0.311 3e-14
UNIPROTKB|J9NRL4242 TRIM2 "Uncharacterized protein 0.588 0.648 0.280 1.6e-13
MGI|MGI:2685298 734 Trim56 "tripartite motif-conta 0.280 0.102 0.440 3.3e-13
UNIPROTKB|F5GX85 666 TRIM3 "Tripartite motif-contai 0.430 0.172 0.311 3.7e-13
UNIPROTKB|E9PKS6 742 TRIM3 "Tripartite motif-contai 0.430 0.154 0.311 4.4e-13
UNIPROTKB|A7MB36 744 TRIM3 "Uncharacterized protein 0.430 0.154 0.311 4.4e-13
UNIPROTKB|E2QVW6 744 TRIM3 "Uncharacterized protein 0.430 0.154 0.311 4.4e-13
WB|WBGene00003599 nhl-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 459 (166.6 bits), Expect = 3.8e-43, P = 3.8e-43
 Identities = 83/156 (53%), Positives = 108/156 (69%)

Query:    21 INYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAA-SQTRETGTLRCPI 79
             IN +DF+E+FLTC TCL  YDG    PKLLPCSH+VCL C++++A  S   +  TLRCP+
Sbjct:    13 INVDDFSETFLTCSTCLYTYDGNTRKPKLLPCSHSVCLFCVTQLAELSPETQPPTLRCPL 72

Query:    80 CREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQELLFCETCDTVFCLQ 139
             CRE   IP GGV   P +F +NQLLD+M  QR+ ++P CS H + +LL+CETCD VFC  
Sbjct:    73 CREVCPIPAGGVILFPAAFFINQLLDVMQIQRKDVVPSCSNHPTDQLLYCETCDLVFCEN 132

Query:   140 CTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKA 175
             C     +       EHT++P SIAIKRMSEI++Y+A
Sbjct:   133 CQDSVVNKKCD---EHTVVPLSIAIKRMSEIVVYRA 165
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-080522-4 trim3a "tripartite motif-containing 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C9JVI3 TRIM2 "Tripartite motif-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PMK8 TRIM3 "Tripartite motif-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRL4 TRIM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2685298 Trim56 "tripartite motif-containing 56" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F5GX85 TRIM3 "Tripartite motif-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PKS6 TRIM3 "Tripartite motif-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB36 TRIM3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVW6 TRIM3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 5e-04
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-04
smart0018440 smart00184, RING, Ring finger 0.004
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information 
 Score = 36.9 bits (86), Expect = 5e-04
 Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 4/52 (7%)

Query: 28 ESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPI 79
           S   C     +    E+ P +LPC H      L ++A    +  G  +CP 
Sbjct: 8  HSIFVCPISKEVMTDEENPPVMLPCGHVYSRKALEKLA----KNGGKFKCPY 55

This zinc-finger is the dimerisation motif for LisH proteins, and is also a typical RING-type of plant ubiquitin ligases. Length = 55
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
KOG4367|consensus 699 99.69
KOG2177|consensus 386 99.63
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.36
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.02
KOG4185|consensus296 99.01
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.99
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.98
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.95
KOG0287|consensus 442 98.86
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.85
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.82
PF1463444 zf-RING_5: zinc-RING finger domain 98.81
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.8
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.77
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.69
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.67
PHA02926242 zinc finger-like protein; Provisional 98.62
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.54
KOG1814|consensus445 98.5
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.47
KOG0320|consensus187 98.46
PHA02929238 N1R/p28-like protein; Provisional 98.45
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.43
KOG0823|consensus230 98.38
KOG0317|consensus293 98.2
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.18
PF0064342 zf-B_box: B-box zinc finger; InterPro: IPR000315 Z 98.08
KOG2164|consensus513 97.94
KOG2660|consensus331 97.92
cd0002139 BBOX B-Box-type zinc finger; zinc binding domain ( 97.87
KOG0978|consensus698 97.85
COG5152259 Uncharacterized conserved protein, contains RING a 97.82
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.73
smart0033642 BBOX B-Box-type zinc finger. 97.7
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.69
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.68
KOG0311|consensus 381 97.64
KOG0824|consensus324 97.59
KOG2879|consensus298 97.48
KOG3161|consensus 861 97.47
KOG4159|consensus398 97.44
KOG4628|consensus348 97.42
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.4
KOG0802|consensus543 97.33
COG5222427 Uncharacterized conserved protein, contains RING Z 97.3
KOG1002|consensus791 97.28
KOG1812|consensus384 97.07
KOG1813|consensus313 97.02
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.82
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.8
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.63
KOG1039|consensus344 96.58
KOG1785|consensus563 96.46
KOG0297|consensus 391 96.36
KOG0825|consensus 1134 96.23
KOG0804|consensus493 96.21
KOG4172|consensus62 96.1
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.01
KOG1493|consensus84 95.97
KOG4692|consensus489 95.89
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.83
KOG1734|consensus328 95.75
KOG1645|consensus 463 95.62
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.53
KOG3800|consensus300 95.42
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.39
KOG4739|consensus233 95.38
KOG1941|consensus518 95.05
KOG2817|consensus394 94.98
KOG4265|consensus349 94.9
KOG0827|consensus 465 94.72
KOG1815|consensus 444 94.71
KOG4275|consensus350 94.17
PF04641260 Rtf2: Rtf2 RING-finger 94.15
KOG3002|consensus299 94.09
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 93.86
KOG3039|consensus303 93.23
KOG1001|consensus674 92.28
COG52191525 Uncharacterized conserved protein, contains RING Z 91.84
PHA03096284 p28-like protein; Provisional 91.54
KOG1940|consensus276 91.34
COG5109396 Uncharacterized conserved protein, contains RING Z 91.34
KOG4362|consensus 684 90.85
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.85
KOG4185|consensus296 90.81
KOG1571|consensus355 90.77
KOG1428|consensus3738 90.49
KOG0828|consensus636 89.07
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 88.29
KOG2932|consensus389 87.95
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 86.83
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.62
KOG3579|consensus352 85.5
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 82.97
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 82.61
COG5175 480 MOT2 Transcriptional repressor [Transcription] 82.13
>KOG4367|consensus Back     alignment and domain information 
Probab=99.69  E-value=5.5e-17  Score=144.54  Aligned_cols=159  Identities=23%  Similarity=0.531  Sum_probs=129.5

Q ss_pred             cccceecccccccccCCCCceecCCCCHHHHhhHHHHHHhccC-------------------------------------
Q psy11858         28 ESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTR-------------------------------------   70 (267)
Q Consensus        28 ~~~l~C~iC~~~~~~~~r~P~~L~C~HsfC~~Ci~~~~~~~~~-------------------------------------   70 (267)
                      ++++.|+||...|.    +|++|+|+|+.|+.|......+...                                     
T Consensus         2 eeelkc~vc~~f~~----epiil~c~h~lc~~ca~~~~~~tp~~~spq~~~aa~s~vs~~~~~~~d~msl~~~ad~g~~~   77 (699)
T KOG4367|consen    2 EEELKCPVCGSFYR----EPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGS   77 (699)
T ss_pred             cccccCceehhhcc----CceEeecccHHHHHHHHhhcccCCCCCCchhhhhcCCCCCccccccccceeeEeeccCCCCc
Confidence            45899999999998    9999999999999998754432110                                     


Q ss_pred             -----------------------------------------CCCccccCCCCceeecCCCCCCCCCchHHHHHHHHHHHh
Q psy11858         71 -----------------------------------------ETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSR  109 (267)
Q Consensus        71 -----------------------------------------~~~~~~CP~C~~~~~~~~~~v~~l~~n~~l~~~v~~~~~  109 (267)
                                                               .+..+.||.|++++.....++..+|.|..+...++++..
T Consensus        78 ~~~~a~~~~t~~~~~~~g~~~~p~am~pp~t~l~~~lap~~~~~~i~c~~c~rs~~~dd~~l~~~p~n~~le~vi~ryq~  157 (699)
T KOG4367|consen   78 YGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ  157 (699)
T ss_pred             cCCeeecCCCccccCCCCceeCCCCCCCchhhccccccCCCCCceEEcchhhhheEecccccccCchhhHHHHHHHHHhh
Confidence                                                     024789999999999999999999999999999998864


Q ss_pred             hcc------------------------------------------------------------cCCCCCCCCCCccc-cc
Q psy11858        110 QRR------------------------------------------------------------HIIPKCSTHNSQEL-LF  128 (267)
Q Consensus       110 ~~~------------------------------------------------------------~~~~~C~~H~~~~~-~f  128 (267)
                      ...                                                            .....|..|..... .|
T Consensus       158 s~~aa~kcqlce~a~k~a~v~ceqcdv~yc~pc~~~~hp~rgplakh~l~~~~~grvs~~~s~r~~~~ct~h~~e~~smy  237 (699)
T KOG4367|consen  158 SKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY  237 (699)
T ss_pred             hhHHhhhhhhhcCChhhhhhhHhhCceEEechHHhccCCCCCchhhcccCCcccCceeeccchhhhhhccCCCCCCceEE
Confidence            310                                                            01457999976655 99


Q ss_pred             ccccccccccccccCCCCCCCCCCCCCceeeHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhHHHHH
Q psy11858        129 CETCDTVFCLQCTGGSNHSSTSGDSEHTIIPFSIAIKRMSEILLYKANECVSKNKVCPERKSNLRPSA  196 (267)
Q Consensus       129 C~~C~~~iC~~C~~~~~H~~~~~~~~H~~~~l~ea~~~~~e~l~~~~~~~~~~~~~~~e~l~~l~~~~  196 (267)
                      |.+|.+++|..|...+.|.      +|.+..+..+..-++.+|...++.+.++.++..|.+-+++.+.
T Consensus       238 c~~ck~pvc~~clee~khs------~hevkal~~~~k~hksqls~al~~lsdrak~a~e~l~~lr~m~  299 (699)
T KOG4367|consen  238 CVQCKMPVCYQCLEEGKHS------SHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMV  299 (699)
T ss_pred             EEecCChHHHHHHHhhccc------chhhhhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999988899      9999999999998888888888777777777777666554433

>KOG2177|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00336 BBOX B-Box-type zinc finger Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 8e-21
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 9e-13
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 9e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 3e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-04
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 6e-04
2dja_A84 Midline-2; tripartite motif protein 1, ZF-B_BOX, s 7e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 8e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 8e-04
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
 Score = 83.2 bits (206), Expect = 8e-21
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 5/81 (6%)

Query: 25  DFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQI 84
           D     L C  C+  +   +  PKLL C HT+C  CL ++ AS       +RCP C +  
Sbjct: 10  DALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSIN---GVRCPFCSKIT 66

Query: 85  TIPRGGVAALPPSFLVNQLLD 105
            I    +  L  +  V +   
Sbjct: 67  RIT--SLTQLTDNLTVLKSGP 85
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A Length = 84 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.5
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.46
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.39
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.38
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.35
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.34
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.32
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.31
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.31
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.3
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.3
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.3
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.29
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.26
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.26
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.24
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.23
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.19
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.19
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.18
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.18
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.17
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.17
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.14
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.13
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.12
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.12
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.12
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 99.11
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.09
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.07
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.07
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.01
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.0
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.99
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.99
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.97
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.94
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.91
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.9
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.87
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.85
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.83
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.82
2ect_A78 Ring finger protein 126; metal binding protein, st 98.82
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.8
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.78
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.74
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.71
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.69
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.69
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.68
2csv_A72 Tripartite motif protein 29; ZF-B_BOX domain, TRIM 98.55
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.51
2ea5_A68 Cell growth regulator with ring finger domain prot 98.51
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.51
2d8u_A64 Ubiquitin ligase TRIM63; tripartite motif-containi 98.5
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.49
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.48
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.45
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.45
2did_A53 Tripartite motif protein 39; ZF-B-box domian, Zn b 98.44
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.4
1fre_A42 Nuclear factor XNF7; zinc-binding protein, BBOX, d 98.39
2dja_A84 Midline-2; tripartite motif protein 1, ZF-B_BOX, s 98.38
2yvr_A50 Transcription intermediary factor 1-beta; ZF-B_BOX 98.36
2yrg_A59 Tripartite motif-containing protein 5; B-box domai 98.28
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.19
3ddt_A48 E3 ubiquitin-protein ligase TRIM63; zinc-binding m 98.09
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.08
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.04
2egm_A57 Tripartite motif-containing protein 41; ZF-B_BOX d 97.88
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.69
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.37
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.87
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.3
3nw0_A238 Non-structural maintenance of chromosomes element 90.5
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 89.11
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.11
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 82.44
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 Back     alignment and structure
>2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A Back     alignment and structure
>2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} Back     alignment and structure
>2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2egm_A Tripartite motif-containing protein 41; ZF-B_BOX domain, tripartite motif protein 41, TRIM41, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 267
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-07
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-06
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-05
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 5e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-04
d2d8ua151 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human ( 3e-04
d2djaa171 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) 4e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-04
d1frea_39 g.43.1.1 (A:) Nuclear factor XNF7 {African clawed 7e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.001
d2csva159 g.43.1.1 (A:8-66) Tripartite motif-containing prot 0.003
d2dida140 g.43.1.1 (A:8-47) Tripartite motif-containing prot 0.004
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Acute promyelocytic leukaemia proto-oncoprotein PML
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.3 bits (102), Expect = 6e-07
 Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 13/63 (20%)

Query: 30 FLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRG 89
          FL C  C          PKLLPC HT+C  CL             ++CPIC+    +   
Sbjct: 6  FLRCQQCQAEAK----CPKLLPCLHTLCSGCLEA---------SGMQCPICQAPWPLGAD 52

Query: 90 GVA 92
            A
Sbjct: 53 TPA 55
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 39 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.44
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.42
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.39
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.34
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.27
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.14
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.08
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.07
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.96
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.94
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.84
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.83
d1frea_39 Nuclear factor XNF7 {African clawed frog (Xenopus 98.74
d2dida140 Tripartite motif-containing protein 39 {Human (Hom 98.68
d2csva159 Tripartite motif-containing protein 29 {Human (Hom 98.66
d2d8ua151 Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax 98.61
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.52
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.43
d2dq5a147 Midline-1 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d2djaa171 Midline-2 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.24
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.18
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 91.57
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.44  E-value=2.4e-15  Score=110.20  Aligned_cols=67  Identities=28%  Similarity=0.677  Sum_probs=54.4

Q ss_pred             cceecccccccccCCCCceecCCCCHHHHhhHHHHHHhccCCCCccccCCCCceeecCCCCCCCCCchHHHHHHHHHHH
Q psy11858         30 FLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMS  108 (267)
Q Consensus        30 ~l~C~iC~~~~~~~~r~P~~L~C~HsfC~~Ci~~~~~~~~~~~~~~~CP~C~~~~~~~~~~v~~l~~n~~l~~~v~~~~  108 (267)
                      .+.||||++.|.    +|++++|||+||..||..|+...   .+...||.|+..+..     ..+..|..+.++++.+.
T Consensus        21 ~l~CpIC~~~~~----~pv~~~CgH~fC~~Ci~~~~~~~---~~~~~CP~Cr~~~~~-----~~l~~n~~l~~~ve~l~   87 (103)
T d1jm7a_          21 ILECPICLELIK----EPVSTKCDHIFCKFCMLKLLNQK---KGPSQCPLCKNDITK-----RSLQESTRFSQLVEELL   87 (103)
T ss_dssp             HTSCSSSCCCCS----SCCBCTTSCCCCSHHHHHHHHSS---SSSCCCTTTSCCCCT-----TTCBCCCSSSHHHHHHH
T ss_pred             CcCCCccCchhC----CeEEcCCCCchhhHHHHHHHHHC---CCCCcCcCCCCcCCh-----hhCCcCHHHHHHHHHHH
Confidence            799999999998    99999999999999999999753   345789999998864     34566666666666554
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure