Psyllid ID: psy11868
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 374 | 2.2.26 [Sep-21-2011] | |||||||
| Q29RZ2 | 644 | Peptidylprolyl isomerase | yes | N/A | 0.914 | 0.531 | 0.688 | 1e-149 | |
| Q96BP3 | 646 | Peptidylprolyl isomerase | yes | N/A | 0.914 | 0.529 | 0.685 | 1e-148 | |
| Q8CEC6 | 646 | Peptidylprolyl isomerase | yes | N/A | 0.914 | 0.529 | 0.679 | 1e-148 | |
| Q5NVL7 | 646 | Peptidylprolyl isomerase | yes | N/A | 0.914 | 0.529 | 0.685 | 1e-148 | |
| P0C1J0 | 630 | Peptidyl-prolyl cis-trans | N/A | N/A | 0.903 | 0.536 | 0.557 | 1e-106 | |
| O74942 | 610 | Peptidyl-prolyl cis-trans | yes | N/A | 0.885 | 0.542 | 0.439 | 4e-75 | |
| Q5ASQ0 | 162 | Peptidyl-prolyl cis-trans | no | N/A | 0.390 | 0.901 | 0.554 | 4e-43 | |
| Q4WCR3 | 161 | Peptidyl-prolyl cis-trans | no | N/A | 0.398 | 0.925 | 0.556 | 9e-43 | |
| Q2U6U0 | 161 | Peptidyl-prolyl cis-trans | no | N/A | 0.390 | 0.906 | 0.554 | 1e-42 | |
| Q9H2H8 | 161 | Peptidyl-prolyl cis-trans | no | N/A | 0.406 | 0.944 | 0.535 | 1e-41 |
| >sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 528 bits (1359), Expect = e-149, Method: Compositional matrix adjust.
Identities = 236/343 (68%), Positives = 294/343 (85%), Gaps = 1/343 (0%)
Query: 33 VRVFSFLSGKLTRVYDESLARFADLQKAKQQLPNMEFGRRMATERDLEKSEQLSLSNVLF 92
VR+F FL+GKL RV+DESL+ F +LQ+ +QQLP+MEFGRRMA ER+LEK + + L N++F
Sbjct: 302 VRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLINIVF 361
Query: 93 DDSGFIVLYATMLGVKFVNIVTNQCVRFIGKPENLRLLHLSLFQGKVKTRKAATTLEMEA 152
D++G VLY TMLG+K +N+ TN+CVR +GK EN+R++ L+LFQG K +AATT+EM+A
Sbjct: 362 DETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKA 421
Query: 153 AKNPTLEAIQPDPTLFCTGFNKNRFYLFSRREPADIKSPETDRDVFNEKPSKEDIISATE 212
++NP L+ IQ DPT+ CT F KNRFY+F++REP D KS ++DRDVFNEKPSKE++++AT+
Sbjct: 422 SENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMAATQ 481
Query: 213 ASGEQVLYDSAIIHTSMGDIHLQLFK-ECAKTVENFCVHSKNNYYNGHIFHRVIKGFMIQ 271
A G + + DSAIIHTSMGDIH++LF EC KTVENFCVHS+N YYNGH FHR+IKGFMIQ
Sbjct: 482 AEGPKRVSDSAIIHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQ 541
Query: 272 TGDPTGTGTGGQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQFFITLTPTPWLD 331
TGDPTGTG GG+SIWGGEF+DEF S L+HDRPYT+SMANAG NTNGSQFFIT+ PTPWLD
Sbjct: 542 TGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLD 601
Query: 332 NKHTVFGRVTKGMEVVQNISNVKTNHKTDQPYDDIQVISISVK 374
NKHTVFGRVTKGMEVVQ ISNVK N KTD+PY+D+ +I+I+VK
Sbjct: 602 NKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK 644
|
Putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing. Bos taurus (taxid: 9913) EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8 |
| >sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P0C1J0|CYP15_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O74942|CYP9_SCHPO Peptidyl-prolyl cis-trans isomerase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp9 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q2U6U0|PPIL1_ASPOR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9H2H8|PPIL3_HUMAN Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 374 | ||||||
| 189238464 | 600 | PREDICTED: similar to cyclophilin [Tribo | 0.941 | 0.586 | 0.713 | 1e-152 | |
| 193688356 | 624 | PREDICTED: peptidylprolyl isomerase doma | 0.930 | 0.557 | 0.709 | 1e-149 | |
| 380015314 | 608 | PREDICTED: peptidylprolyl isomerase doma | 0.938 | 0.577 | 0.732 | 1e-149 | |
| 449278708 | 623 | Peptidylprolyl isomerase domain and WD r | 0.930 | 0.558 | 0.679 | 1e-149 | |
| 66518074 | 612 | PREDICTED: peptidylprolyl isomerase doma | 0.938 | 0.573 | 0.732 | 1e-148 | |
| 348551650 | 644 | PREDICTED: peptidylprolyl isomerase doma | 0.914 | 0.531 | 0.690 | 1e-148 | |
| 50761531 | 625 | PREDICTED: peptidylprolyl isomerase doma | 0.930 | 0.556 | 0.679 | 1e-148 | |
| 395825388 | 645 | PREDICTED: peptidylprolyl isomerase doma | 0.914 | 0.530 | 0.688 | 1e-148 | |
| 224090699 | 628 | PREDICTED: peptidylprolyl isomerase doma | 0.930 | 0.554 | 0.676 | 1e-148 | |
| 351699838 | 576 | Peptidylprolyl isomerase domain and WD r | 0.914 | 0.593 | 0.690 | 1e-148 |
| >gi|189238464|ref|XP_966906.2| PREDICTED: similar to cyclophilin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 544 bits (1402), Expect = e-152, Method: Compositional matrix adjust.
Identities = 254/356 (71%), Positives = 303/356 (85%), Gaps = 4/356 (1%)
Query: 20 ARFAELKLSETEPVRVFSFLSGKLTRVYDESLARFADLQKAKQQLPNMEFGRRMATERDL 79
ARFA LS VRVF+F++GKL RV DE+L RF +LQ+A QQLPNMEFGRRMA ERDL
Sbjct: 248 ARFA--TLSTDRKVRVFNFVTGKLVRVLDETLPRFTELQQATQQLPNMEFGRRMAVERDL 305
Query: 80 EKSEQLSLSNVLFDDSGFIVLYATMLGVKFVNIVTNQCVRFIGKPENLRLLHLSLFQGKV 139
EKSE + L+N++FD SG ++YAT+LG+K VN+ TN+CVR IGK ENLRLL+++L+QG
Sbjct: 306 EKSEAVVLANIVFDYSGHFIMYATLLGIKLVNLYTNKCVRIIGKNENLRLLNIALYQGSA 365
Query: 140 KTRKAATTLEMEAAKNPTLEAIQPDPTLFCTGFNKNRFYLFSRREPADIKSPETDRDVFN 199
K KAA TLE+EA+ NPTL+AIQPDPTL CT + K+RFYLFSRREP +++ + DRDVFN
Sbjct: 366 KKSKAAVTLEIEASTNPTLDAIQPDPTLICTAYKKSRFYLFSRREPDELQG-DQDRDVFN 424
Query: 200 EKPSKEDIISATEASGEQVLYDSAIIHTSMGDIHLQLF-KECAKTVENFCVHSKNNYYNG 258
EKPSKED +AT+ Q LY++A+IHT GDIH++LF KE KTVENFCVH+KN Y+NG
Sbjct: 425 EKPSKEDTFAATDNPAVQRLYENAVIHTVFGDIHIKLFMKETPKTVENFCVHAKNGYFNG 484
Query: 259 HIFHRVIKGFMIQTGDPTGTGTGGQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGS 318
HIFHRVIKGFMIQTGDPTG GTGG+SIWGGEF+DE + +L+HDRPYTVSMANAGPNTNGS
Sbjct: 485 HIFHRVIKGFMIQTGDPTGNGTGGESIWGGEFEDEIRPNLRHDRPYTVSMANAGPNTNGS 544
Query: 319 QFFITLTPTPWLDNKHTVFGRVTKGMEVVQNISNVKTNHKTDQPYDDIQVISISVK 374
QFFITLTPTPWLDNKHTVFGRV KGMEVVQNISNVKTN KTD+PYDDI+++S++VK
Sbjct: 545 QFFITLTPTPWLDNKHTVFGRVVKGMEVVQNISNVKTNAKTDKPYDDIRIVSVTVK 600
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193688356|ref|XP_001949639.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|380015314|ref|XP_003691649.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|449278708|gb|EMC86499.1| Peptidylprolyl isomerase domain and WD repeat-containing protein 1, partial [Columba livia] | Back alignment and taxonomy information |
|---|
| >gi|66518074|ref|XP_396986.2| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|348551650|ref|XP_003461643.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Cavia porcellus] | Back alignment and taxonomy information |
|---|
| >gi|50761531|ref|XP_424751.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|395825388|ref|XP_003785917.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|224090699|ref|XP_002189534.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
| >gi|351699838|gb|EHB02757.1| Peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Heterocephalus glaber] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 374 | ||||||
| UNIPROTKB|F1NAJ2 | 657 | PPWD1 "Uncharacterized protein | 0.930 | 0.529 | 0.650 | 8.4e-136 | |
| ZFIN|ZDB-GENE-070615-16 | 622 | ppwd1 "peptidylprolyl isomeras | 0.914 | 0.549 | 0.653 | 3.6e-135 | |
| UNIPROTKB|Q29RZ2 | 644 | PPWD1 "Peptidylprolyl isomeras | 0.914 | 0.531 | 0.658 | 4.6e-135 | |
| UNIPROTKB|E2RIS6 | 646 | PPWD1 "Uncharacterized protein | 0.914 | 0.529 | 0.658 | 4.6e-135 | |
| UNIPROTKB|F1SKT6 | 480 | LOC100512871 "Uncharacterized | 0.914 | 0.712 | 0.655 | 1.2e-134 | |
| UNIPROTKB|F1SKT8 | 646 | PPWD1 "Peptidylprolyl isomeras | 0.914 | 0.529 | 0.655 | 1.2e-134 | |
| RGD|1310204 | 646 | Ppwd1 "peptidylprolyl isomeras | 0.914 | 0.529 | 0.653 | 2e-134 | |
| UNIPROTKB|B4DWR9 | 490 | PPWD1 "cDNA FLJ53227, highly s | 0.914 | 0.697 | 0.655 | 4.1e-134 | |
| UNIPROTKB|F5H7P7 | 616 | PPWD1 "Peptidylprolyl isomeras | 0.914 | 0.555 | 0.655 | 4.1e-134 | |
| UNIPROTKB|Q96BP3 | 646 | PPWD1 "Peptidylprolyl isomeras | 0.914 | 0.529 | 0.655 | 4.1e-134 |
| UNIPROTKB|F1NAJ2 PPWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 1262 (449.3 bits), Expect = 8.4e-136, Sum P(2) = 8.4e-136
Identities = 227/349 (65%), Positives = 286/349 (81%)
Query: 27 LSETEPVRVFSFLSGKLTRVYDESLARFADLQKAKQQLPNMEFGRRMATERDLEKSEQLS 86
L VR+F FL+GKL RV+DESL+ F +LQ+ +QQLP+MEFGRRMA ER+LEK + +
Sbjct: 309 LGSDRKVRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVR 368
Query: 87 LSNVLFDDSGFIVLYATMLGVKFVNIVTNQCVRFIGKPENLRLLHLSLFQGKVKTRKAAT 146
L N++FD++G VLY TMLG+K +N+ TN+C+R +GK EN+R++ L+LFQG K +AA
Sbjct: 369 LINIIFDETGHFVLYGTMLGIKVINVETNRCIRILGKQENIRVMQLALFQGVAKKHRAAI 428
Query: 147 TLEMEAAKNPTLEAIQPDPTLFCTGFNKNRFYLFSRREPADIKSPETDRDVFNEKPSKED 206
T+EM+A++NP L+ IQ DPT+ CT F KNRFY+F++REP D KS ++DRDVFNEKPSKE+
Sbjct: 429 TIEMKASENPVLQNIQADPTVICTAFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEE 488
Query: 207 IISATEASGEQVLYDSAIIHTSMGDIHLQLFK-ECAKTVENFCVHSKNNYYNGHIFHRVI 265
+++AT+A G + + DSAIIHTSMGDIH++LF EC KTVENFCVHS+N YYNGHIFHR+I
Sbjct: 489 VMAATQAEGPKRVSDSAIIHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHIFHRII 548
Query: 266 KGFMIQXXXXXXXXXXXQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQFFITLT 325
KGFMIQ +SIWGGEF+DEF S L+HDRPYT+SMANAGPNTNGSQFFIT+
Sbjct: 549 KGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGPNTNGSQFFITVV 608
Query: 326 PTPWLDNKHTVFGRVTKGMEVVQNISNVKTNHKTDQPYDDIQVISISVK 374
PTPWLDNKH+VFGRVTKGMEVVQ ISNVK N KTD+PY+DI +I+I+VK
Sbjct: 609 PTPWLDNKHSVFGRVTKGMEVVQRISNVKVNPKTDKPYEDISIINITVK 657
|
|
| ZFIN|ZDB-GENE-070615-16 ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29RZ2 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RIS6 PPWD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SKT6 LOC100512871 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SKT8 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing 1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1310204 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DWR9 PPWD1 "cDNA FLJ53227, highly similar to Peptidylprolyl isomerase domain and WDrepeat-containing protein 1 (EC 5.2.1.8)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H7P7 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96BP3 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8CEC6 | PPWD1_MOUSE | 5, ., 2, ., 1, ., 8 | 0.6793 | 0.9144 | 0.5294 | yes | N/A |
| Q5NVL7 | PPWD1_PONAB | 5, ., 2, ., 1, ., 8 | 0.6851 | 0.9144 | 0.5294 | yes | N/A |
| Q96BP3 | PPWD1_HUMAN | 5, ., 2, ., 1, ., 8 | 0.6851 | 0.9144 | 0.5294 | yes | N/A |
| Q29RZ2 | PPWD1_BOVIN | 5, ., 2, ., 1, ., 8 | 0.6880 | 0.9144 | 0.5310 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 5.2.1 | 0.766 |
| 4th Layer | 5.2.1.8 | 0.824 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 374 | |||
| cd01927 | 148 | cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo | 1e-98 | |
| cd01923 | 159 | cd01923, cyclophilin_RING, cyclophilin_RING: cyclo | 6e-65 | |
| cd00317 | 146 | cd00317, cyclophilin, cyclophilin: cyclophilin-typ | 8e-65 | |
| cd01922 | 146 | cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY | 2e-62 | |
| COG0652 | 158 | COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase | 5e-62 | |
| cd01928 | 153 | cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 | 5e-62 | |
| pfam00160 | 144 | pfam00160, Pro_isomerase, Cyclophilin type peptidy | 9e-59 | |
| cd01925 | 171 | cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC | 2e-58 | |
| cd01926 | 164 | cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik | 2e-56 | |
| PTZ00060 | 183 | PTZ00060, PTZ00060, cyclophilin; Provisional | 4e-45 | |
| cd01921 | 166 | cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph | 2e-42 | |
| PLN03149 | 186 | PLN03149, PLN03149, peptidyl-prolyl isomerase H (c | 4e-39 | |
| cd01920 | 155 | cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP | 2e-24 | |
| PRK10903 | 190 | PRK10903, PRK10903, peptidyl-prolyl cis-trans isom | 6e-21 | |
| PRK10791 | 164 | PRK10791, PRK10791, peptidyl-prolyl cis-trans isom | 2e-19 | |
| cd01924 | 176 | cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 | 9e-11 | |
| PTZ00221 | 249 | PTZ00221, PTZ00221, cyclophilin; Provisional | 3e-06 |
| >gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
Score = 288 bits (740), Expect = 1e-98
Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
Query: 224 IIHTSMGDIHLQLF-KECAKTVENFCVHSKNNYYNGHIFHRVIKGFMIQTGDPTGTGTGG 282
IIHT+ GDIH++LF +E KTVENF H++N YYN IFHRVIKGFMIQTGDPTG GTGG
Sbjct: 1 IIHTTKGDIHIRLFPEEAPKTVENFTTHARNGYYNNTIFHRVIKGFMIQTGDPTGDGTGG 60
Query: 283 QSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQFFITLTPTPWLDNKHTVFGRVTK 342
+SIWG EF+DEF LKHDRPYT+SMANAGPNTNGSQFFIT TPWLDNKHTVFGRV K
Sbjct: 61 ESIWGKEFEDEFSPSLKHDRPYTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVK 120
Query: 343 GMEVVQNISNVKTNHKTDQPYDDIQVISI 371
GM+VVQ I NVKT+ K D+PY+DI++I+I
Sbjct: 121 GMDVVQRIENVKTD-KNDRPYEDIKIINI 148
|
This group consists of several hypothetical and putative eukaryotic and bacterial proteins which have a cyclophilin domain and a WD40 domain. Function of the protein is not known. Length = 148 |
| >gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | Back alignment and domain information |
|---|
| >gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 374 | |||
| KOG0882|consensus | 558 | 100.0 | ||
| KOG0881|consensus | 164 | 100.0 | ||
| KOG0546|consensus | 372 | 100.0 | ||
| KOG0880|consensus | 217 | 100.0 | ||
| KOG0883|consensus | 518 | 100.0 | ||
| cd01927 | 148 | cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ | 100.0 | |
| cd01923 | 159 | cyclophilin_RING cyclophilin_RING: cyclophilin-typ | 100.0 | |
| cd01928 | 153 | Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro | 100.0 | |
| COG0652 | 158 | PpiB Peptidyl-prolyl cis-trans isomerase (rotamase | 100.0 | |
| KOG0884|consensus | 161 | 100.0 | ||
| cd01922 | 146 | cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c | 100.0 | |
| cd01921 | 166 | cyclophilin_RRM cyclophilin_RRM: cyclophilin-type | 100.0 | |
| KOG0879|consensus | 177 | 100.0 | ||
| cd01925 | 171 | cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: | 100.0 | |
| cd01926 | 164 | cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph | 100.0 | |
| PLN03149 | 186 | peptidyl-prolyl isomerase H (cyclophilin H); Provi | 100.0 | |
| PTZ00060 | 183 | cyclophilin; Provisional | 100.0 | |
| PTZ00221 | 249 | cyclophilin; Provisional | 100.0 | |
| PRK10791 | 164 | peptidyl-prolyl cis-trans isomerase B (rotamase B) | 100.0 | |
| KOG0111|consensus | 298 | 100.0 | ||
| PRK10903 | 190 | peptidyl-prolyl cis-trans isomerase A (rotamase A) | 100.0 | |
| KOG0885|consensus | 439 | 100.0 | ||
| cd01920 | 155 | cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc | 100.0 | |
| cd00317 | 146 | cyclophilin cyclophilin: cyclophilin-type peptidyl | 100.0 | |
| KOG0415|consensus | 479 | 100.0 | ||
| PF00160 | 155 | Pro_isomerase: Cyclophilin type peptidyl-prolyl ci | 100.0 | |
| cd01924 | 176 | cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc | 100.0 | |
| KOG0865|consensus | 167 | 100.0 | ||
| KOG0882|consensus | 558 | 98.32 | ||
| KOG1408|consensus | 1080 | 96.1 | ||
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 94.98 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 94.9 | |
| KOG1446|consensus | 311 | 93.61 | ||
| KOG0266|consensus | 456 | 92.99 | ||
| KOG0266|consensus | 456 | 91.83 | ||
| KOG1407|consensus | 313 | 88.9 | ||
| KOG0291|consensus | 893 | 88.78 | ||
| KOG0275|consensus | 508 | 88.74 | ||
| KOG1408|consensus | 1080 | 88.51 | ||
| PTZ00420 | 568 | coronin; Provisional | 88.34 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 88.06 | |
| KOG0640|consensus | 430 | 87.89 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 87.88 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 87.83 | |
| KOG0318|consensus | 603 | 87.78 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 86.96 | |
| KOG0319|consensus | 775 | 86.77 | ||
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 86.75 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 86.39 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 86.35 | |
| KOG0291|consensus | 893 | 86.06 | ||
| PF12903 | 147 | DUF3830: Protein of unknown function (DUF3830); In | 85.77 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 85.73 | |
| PTZ00421 | 493 | coronin; Provisional | 84.62 | |
| KOG0316|consensus | 307 | 83.52 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 83.46 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 82.08 | |
| PTZ00421 | 493 | coronin; Provisional | 81.8 | |
| KOG0285|consensus | 460 | 81.69 | ||
| KOG4547|consensus | 541 | 81.17 | ||
| KOG0275|consensus | 508 | 81.11 | ||
| KOG0282|consensus | 503 | 80.1 |
| >KOG0882|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-119 Score=894.17 Aligned_cols=350 Identities=57% Similarity=0.955 Sum_probs=338.3
Q ss_pred eeccccceeeeeeecCCCCEEEEEeCCceEEEEeechhHHHHHHHHhccCCCccchhhhhhhhhhcccccccCcceEEEc
Q psy11868 14 VYDESLARFAELKLSETEPVRVFSFLSGKLTRVYDESLARFADLQKAKQQLPNMEFGRRMATERDLEKSEQLSLSNVLFD 93 (374)
Q Consensus 14 ~~~~~~~~~~~~~~~~d~~ir~f~~~tgkl~~~~des~~~~~~~~~~~~~~~~~~f~rr~a~e~e~~~~~~~~~~~~~fd 93 (374)
-++|++++++ ++++||+||+|+|+||||++.|||+++.++.+|++.+.|.+||||||||+||||||.+.....|++||
T Consensus 208 Efsp~g~qis--tl~~DrkVR~F~~KtGklvqeiDE~~t~~~~q~ks~y~l~~VelgRRmaverelek~~~~~~~~~~fd 285 (558)
T KOG0882|consen 208 EFSPDGAQIS--TLNPDRKVRGFVFKTGKLVQEIDEVLTDAQYQPKSPYGLMHVELGRRMAVERELEKHGSTVGTNAVFD 285 (558)
T ss_pred EEccccCccc--ccCcccEEEEEEeccchhhhhhhccchhhhhccccccccceeehhhhhhHHhhHhhhcCcccceeEEc
Confidence 3688999999 99999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCceEEEeeeeeeEEEEeeeceeEEEecCCCccccchhhcccccccccccccchhhhhccCCcccccCCCceEEEeecc
Q psy11868 94 DSGFIVLYATMLGVKFVNIVTNQCVRFIGKPENLRLLHLSLFQGKVKTRKAATTLEMEAAKNPTLEAIQPDPTLFCTGFN 173 (374)
Q Consensus 94 ~s~~~~~y~t~~gikv~n~~t~~~~~~~g~~e~~r~~~~~l~q~~~~~~~~~~~~~~~~~~n~~l~~~~~dp~l~~ta~~ 173 (374)
||||||||||+|||||+|+.||+|+|||||+|++||+++|||||.++++ ..+++++|+.||+|+ .+.||+++|||||
T Consensus 286 es~~flly~t~~gikvin~~tn~v~ri~gk~e~ir~~~~sl~q~~~k~~--~~~~~~~a~~np~~~-~~~dpt~~c~a~k 362 (558)
T KOG0882|consen 286 ESGNFLLYGTILGIKVINLDTNTVVRILGKDEAIRFTRLSLYQGAQKSN--LAALEVAASNNPLLE-FQKDPTIVCTAFK 362 (558)
T ss_pred CCCCEEEeecceeEEEEEeecCeEEEEeccchhhhhhhHHHHhhhhhcc--chhhhhhhccCcccc-cCCCCeEEEeeee
Confidence 9999999999999999999999999999999999999999999986665 445599999999998 8899999999999
Q ss_pred CceeEEeecCCCCCCCCCCCcccccCCCCCchhccchhhccCceeecceEEEeEeceeEEEEec-ccchHHHHHHHhhhc
Q psy11868 174 KNRFYLFSRREPADIKSPETDRDVFNEKPSKEDIISATEASGEQVLYDSAIIHTSMGDIHLQLF-KECAKTVENFCVHSK 252 (374)
Q Consensus 174 k~rfylfs~~~p~~~~~~~~~rd~~~ekp~~e~~~~~~~~~~~~~~~d~vi~~Tt~G~I~IeLf-d~aPktveNF~~L~k 252 (374)
||||||| +||++.+ ++||||||+|.+++++++.+..++..+.+.||+||++|||+|.|| ++||+||+||++||+
T Consensus 363 k~rfylf--~ep~~~~---~~~dvfne~p~~~~~~~~~~~~g~~~l~~~aiihtt~gdi~~kl~p~ecpktvenf~th~r 437 (558)
T KOG0882|consen 363 KNRFYLF--REPEFTE---SDRDVFNEKPLKEELMEARQEEGNKLLGKAAIIHTTQGDIHIKLYPEECPKTVENFTTHSR 437 (558)
T ss_pred cceEEEE--ecCCCCc---chhhhhccCcChhHhhhhhhccCceecccceEEEecccceEEEecccccchhhhhhhcccc
Confidence 9999999 7887766 678999999999999999988899999999999999999999999 999999999999999
Q ss_pred CCccCCcEEEEEEcCeEEeeCCCCCCCCCCccccCCCCcccccCCCCCCCcceEeecccCCCCCcceEEEEcCCCCCCCC
Q psy11868 253 NNYYNGHIFHRVIKGFMIQTGDPTGTGTGGQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQFFITLTPTPWLDN 332 (374)
Q Consensus 253 ~GyY~gt~FhRVi~~f~IQgGDp~g~GtgG~si~G~~f~dE~~~~LkH~r~G~VSman~gpntngSQFFITl~~~p~LDg 332 (374)
+|||||+.|||||++||||+|||.|+|+||+||||++|+||++++|+|+||++|||||+||||||||||||+.++|||||
T Consensus 438 ngyy~~~~fhriik~fmiqtgdp~g~gtggesiwg~dfedefh~~lrhdrpft~smanag~ntngsqffit~~~tpwld~ 517 (558)
T KOG0882|consen 438 NGYYDNHTFHRIIKGFMIQTGDPLGDGTGGESIWGKDFEDEFHPNLRHDRPFTVSMANAGPNTNGSQFFITTVPTPWLDG 517 (558)
T ss_pred CccccCcchHHhhhhheeecCCCCCCCCCCcccccccchhhcCcccccCCCceEEecccCCCCCCceEEEEecCccccCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCeEEEEEEeCHHHHHHHhcCCCCCCCCCCCCCeEEEEEEEC
Q psy11868 333 KHTVFGRVTKGMEVVQNISNVKTNHKTDQPYDDIQVISISVK 374 (374)
Q Consensus 333 k~tVFGrVieGmdVL~~Ie~~~td~~~~kP~~~I~I~~i~Vk 374 (374)
||||||||+.|||||++|++++|+ +++||+++++|.+|+|+
T Consensus 518 khtvfgrv~~gm~vvqri~~v~t~-k~drp~e~v~iinisv~ 558 (558)
T KOG0882|consen 518 KHTVFGRVTAGMDVVQRIEQVKTD-KYDRPYEDVKIINISVK 558 (558)
T ss_pred cceeEEEEecchhHHhHhhhcccC-cCCCCCCceeEEEEecC
Confidence 999999999999999999999997 99999999999999986
|
|
| >KOG0881|consensus | Back alignment and domain information |
|---|
| >KOG0546|consensus | Back alignment and domain information |
|---|
| >KOG0880|consensus | Back alignment and domain information |
|---|
| >KOG0883|consensus | Back alignment and domain information |
|---|
| >cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0884|consensus | Back alignment and domain information |
|---|
| >cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >KOG0879|consensus | Back alignment and domain information |
|---|
| >cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >PTZ00060 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >PTZ00221 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >KOG0111|consensus | Back alignment and domain information |
|---|
| >PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >KOG0885|consensus | Back alignment and domain information |
|---|
| >cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >KOG0415|consensus | Back alignment and domain information |
|---|
| >PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms | Back alignment and domain information |
|---|
| >cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >KOG0865|consensus | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG4547|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 374 | ||||
| 2a2n_A | 176 | Crystal Structure Of The Peptidylprolyl Isomerase D | 8e-73 | ||
| 2fu0_A | 160 | Plasmodium Falciparum Cyclophilin Pfe0505w Putative | 1e-48 | ||
| 2oju_A | 167 | X-Ray Structure Of Complex Of Human Cyclophilin J W | 4e-35 | ||
| 1xyh_A | 161 | Crystal Structure Of Recombinant Human Cyclophilin | 5e-35 | ||
| 1xwn_A | 174 | Solution Structure Of Cyclophilin Like 1(Ppil1) And | 1e-33 | ||
| 2x7k_A | 166 | The Crystal Structure Of Ppil1 In Complex With Cycl | 1e-33 | ||
| 2k7n_A | 203 | Solution Structure Of The Ppil1 Bound To A Fragment | 2e-33 | ||
| 1zkc_A | 197 | Crystal Structure Of The Cyclophiln_ring Domain Of | 7e-32 | ||
| 2he9_A | 192 | Structure Of The Peptidylprolyl Isomerase Domain Of | 1e-28 | ||
| 1ist_A | 162 | Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng | 2e-27 | ||
| 2b71_A | 196 | Plasmodium Yoelii Cyclophilin-Like Protein Length = | 2e-27 | ||
| 1c5f_A | 177 | Crystal Structure Of The Cyclophilin-Like Domain Fr | 2e-27 | ||
| 2plu_A | 186 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 6e-27 | ||
| 1xo7_A | 166 | Crystal Structure Of Cyclophilin From Trypanosoma C | 2e-26 | ||
| 1qng_A | 170 | Plasmodium Falciparum Cyclophilin Complexed With Cy | 4e-26 | ||
| 2haq_A | 172 | Crystal Structure Of Cyclophilin A From Leishmania | 7e-26 | ||
| 4frv_A | 185 | Crystal Structure Of Mutated Cyclophilin B That Cau | 9e-26 | ||
| 4fru_A | 185 | Crystal Structure Of Horse Wild-Type Cyclophilin B | 1e-25 | ||
| 2wfi_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 1e-25 | ||
| 2wfj_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 1e-25 | ||
| 3bt8_A | 172 | Crystal Structure Of Mutant Cyclophilin (R147a) Fro | 1e-25 | ||
| 1w74_A | 191 | X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer | 2e-25 | ||
| 2gw2_A | 198 | Crystal Structure Of The Peptidyl-Prolyl Isomerase | 2e-25 | ||
| 3ich_A | 188 | Crystal Structure Of Cyclophilin B At 1.2 A Resolut | 2e-25 | ||
| 1cyn_A | 178 | Cyclophilin B Complexed With [d-(Cholinylester)ser8 | 3e-25 | ||
| 1qnh_A | 170 | Plasmodium Falciparum Cyclophilin (Double Mutant) C | 3e-25 | ||
| 2poe_A | 185 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 3e-25 | ||
| 2rmc_A | 182 | Crystal Structure Of Murine Cyclophilin C Complexed | 4e-25 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 1e-24 | ||
| 2cfe_A | 162 | The 1.5 A Crystal Structure Of The Malassezia Sympo | 2e-24 | ||
| 2esl_A | 190 | Human Cyclophilin C In Complex With Cyclosporin A L | 4e-24 | ||
| 2xgy_B | 173 | Complex Of Rabbit Endogenous Lentivirus (Relik)caps | 7e-24 | ||
| 3rdd_A | 184 | Human Cyclophilin A Complexed With An Inhibitor Len | 8e-24 | ||
| 2rma_A | 165 | Crystal Structures Of Cyclophilin A Complexed With | 9e-24 | ||
| 1bck_A | 165 | Human Cyclophilin A Complexed With 2-Thr Cyclospori | 9e-24 | ||
| 5cyh_A | 164 | Cyclophilin A Complexed With Dipeptide Gly-Pro Leng | 9e-24 | ||
| 4dgd_A | 165 | Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 | 1e-23 | ||
| 1m9e_A | 164 | X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- | 1e-23 | ||
| 2wlw_A | 165 | Structure Of The N-Terminal Capsid Domain Of Hiv-2 | 2e-23 | ||
| 2x83_B | 163 | Evolutionary Basis Of Hiv Restriction By The Antire | 2e-23 | ||
| 3k0o_A | 165 | Room Temperature Structure Of Cypa Mutant Ser99thr | 2e-23 | ||
| 3k2c_A | 193 | Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom | 2e-23 | ||
| 2alf_A | 164 | Crystal Structure Of Human Cypa Mutant K131a Length | 2e-23 | ||
| 3k0r_A | 165 | Cryogenic Structure Of Cypa Mutant Arg55lys Length | 3e-23 | ||
| 2hqj_A | 183 | Cyclophilin From Leishmania Major Length = 183 | 3e-23 | ||
| 2x2a_A | 165 | Free Acetyl-Cypa Trigonal Form Length = 165 | 4e-23 | ||
| 2x2c_K | 165 | Acetyl-Cypa:cyclosporine Complex Length = 165 | 4e-23 | ||
| 2hq6_A | 185 | Structure Of The Cyclophilin_cecyp16-like Domain Of | 9e-23 | ||
| 1h0p_A | 182 | Cyclophilin_5 From C. Elegans Length = 182 | 2e-22 | ||
| 2x25_B | 169 | Free Acetyl-Cypa Orthorhombic Form Length = 169 | 2e-22 | ||
| 2r99_A | 173 | Crystal Structure Of Cyclophilin Abh-Like Domain Of | 2e-22 | ||
| 1qoi_A | 177 | U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = | 3e-22 | ||
| 3r49_A | 166 | Human Cyclophilin D Complexed With Quinolin-8-Amine | 3e-22 | ||
| 2bit_X | 165 | Crystal Structure Of Human Cyclophilin D At 1.7 A R | 3e-22 | ||
| 3qyu_A | 164 | Crystal Structure Of Human Cyclophilin D At 1.54 A | 4e-22 | ||
| 2z6w_A | 165 | Crystal Structure Of Human Cyclophilin D In Complex | 4e-22 | ||
| 1zmf_A | 165 | C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 | 5e-22 | ||
| 1dyw_A | 173 | Biochemical And Structural Characterization Of A Di | 2e-21 | ||
| 1aws_A | 164 | Secypa Complexed With Hagpia (Pseudo-Symmetric Mono | 3e-21 | ||
| 3pmp_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 6e-21 | ||
| 3o7t_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 9e-21 | ||
| 2c3b_A | 172 | The Crystal Structure Of Aspergillus Fumigatus Cycl | 2e-20 | ||
| 2ck1_A | 172 | The Structure Of Oxidised Cyclophilin A From S. Man | 2e-20 | ||
| 3uch_A | 174 | Crystal Structure Of A Hypotherical Peptidyl-Prolyl | 3e-20 | ||
| 1z81_A | 229 | Crystal Structure Of Cyclophilin From Plasmodium Yo | 3e-18 | ||
| 4i9y_A | 167 | Structure Of The C-terminal Domain Of Nup358 Length | 2e-16 | ||
| 3s6m_A | 167 | The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer | 9e-15 | ||
| 3bo7_A | 201 | Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro | 2e-14 | ||
| 3t1u_A | 163 | Crystal Structure Of The Complex Of Cyclophilin-a E | 5e-13 | ||
| 1clh_A | 166 | Three-Dimensional Solution Structure Of Escherichia | 8e-13 | ||
| 1j2a_A | 166 | Structure Of E. Coli Cyclophilin B K163t Mutant Len | 9e-13 | ||
| 2nul_A | 164 | Peptidylprolyl Isomerase From E. Coli Length = 164 | 5e-12 | ||
| 3bkp_A | 232 | Crystal Structure Of The Toxoplasma Gondii Cyclophi | 8e-12 | ||
| 1lop_A | 164 | Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P | 3e-11 |
| >pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 | Back alignment and structure |
|
| >pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 | Back alignment and structure |
| >pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 | Back alignment and structure |
| >pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 | Back alignment and structure |
| >pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 | Back alignment and structure |
| >pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 | Back alignment and structure |
| >pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 | Back alignment and structure |
| >pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 | Back alignment and structure |
| >pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 | Back alignment and structure |
| >pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 | Back alignment and structure |
| >pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 | Back alignment and structure |
| >pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 | Back alignment and structure |
| >pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 | Back alignment and structure |
| >pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 | Back alignment and structure |
| >pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 | Back alignment and structure |
| >pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 | Back alignment and structure |
| >pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 | Back alignment and structure |
| >pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 | Back alignment and structure |
| >pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 | Back alignment and structure |
| >pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 | Back alignment and structure |
| >pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 | Back alignment and structure |
| >pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 | Back alignment and structure |
| >pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 | Back alignment and structure |
| >pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 | Back alignment and structure |
| >pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 | Back alignment and structure |
| >pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 | Back alignment and structure |
| >pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 | Back alignment and structure |
| >pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 | Back alignment and structure |
| >pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 | Back alignment and structure |
| >pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 | Back alignment and structure |
| >pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 | Back alignment and structure |
| >pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 | Back alignment and structure |
| >pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 | Back alignment and structure |
| >pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 | Back alignment and structure |
| >pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 | Back alignment and structure |
| >pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 | Back alignment and structure |
| >pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 | Back alignment and structure |
| >pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 | Back alignment and structure |
| >pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 | Back alignment and structure |
| >pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 | Back alignment and structure |
| >pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 | Back alignment and structure |
| >pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 | Back alignment and structure |
| >pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 | Back alignment and structure |
| >pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 | Back alignment and structure |
| >pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 | Back alignment and structure |
| >pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 | Back alignment and structure |
| >pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 | Back alignment and structure |
| >pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 | Back alignment and structure |
| >pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 | Back alignment and structure |
| >pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 | Back alignment and structure |
| >pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 | Back alignment and structure |
| >pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 | Back alignment and structure |
| >pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 | Back alignment and structure |
| >pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 | Back alignment and structure |
| >pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 | Back alignment and structure |
| >pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 | Back alignment and structure |
| >pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 | Back alignment and structure |
| >pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 | Back alignment and structure |
| >pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 | Back alignment and structure |
| >pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 | Back alignment and structure |
| >pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 | Back alignment and structure |
| >pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 | Back alignment and structure |
| >pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 | Back alignment and structure |
| >pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 | Back alignment and structure |
| >pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 | Back alignment and structure |
| >pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 | Back alignment and structure |
|---|
Score = 326 bits (838), Expect = e-113
Identities = 134/174 (77%), Positives = 155/174 (89%), Gaps = 1/174 (0%)
Query: 202 PSKEDIISATEASGEQVLYDSAIIHTSMGDIHLQLF-KECAKTVENFCVHSKNNYYNGHI 260
PSKE++++AT+A G + + DSAIIHTSMGDIH +LF EC KTVENFCVHS+N YYNGH
Sbjct: 3 PSKEEVMAATQAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHT 62
Query: 261 FHRVIKGFMIQTGDPTGTGTGGQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQF 320
FHR+IKGFMIQTGDPTGTG GG+SIWGGEF+DEF S L+HDRPYT+SMANAG NTNGSQF
Sbjct: 63 FHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQF 122
Query: 321 FITLTPTPWLDNKHTVFGRVTKGMEVVQNISNVKTNHKTDQPYDDIQVISISVK 374
FIT+ PTPWLDNKHTVFGRVTKGMEVVQ ISNVK N KTD+PY+D+ +I+I+VK
Sbjct: 123 FITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK 176
|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 374 | |||
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 100.0 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 100.0 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 100.0 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 100.0 | |
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 100.0 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 100.0 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 100.0 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 100.0 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 100.0 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 100.0 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 100.0 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 100.0 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 100.0 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 100.0 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 100.0 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 100.0 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 100.0 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 100.0 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 100.0 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 100.0 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 100.0 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 4fru_A | 185 | Cyclophilin B, peptidyl-prolyl CIS-trans isomerase | 100.0 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 100.0 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 100.0 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 100.0 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 100.0 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 100.0 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 100.0 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 100.0 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 100.0 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 100.0 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 100.0 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 100.0 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 96.46 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 96.15 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 96.04 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 95.97 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 95.82 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 95.73 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 95.71 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 95.69 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 95.53 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 95.4 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 95.32 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 95.16 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 95.15 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 95.1 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 95.02 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 94.98 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 94.95 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 94.79 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 94.79 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 94.75 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 94.75 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 94.72 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 94.63 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 94.41 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 94.35 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 94.29 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 94.27 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 94.2 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 94.13 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 94.11 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 94.08 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 94.01 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 93.93 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 93.89 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 93.81 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 93.75 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 93.68 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 93.59 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 93.55 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 93.46 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 93.22 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 93.12 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 93.11 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 93.09 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 92.95 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 92.92 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 92.92 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 92.83 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 92.79 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 92.77 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 92.72 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 92.68 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 92.59 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 92.44 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 92.13 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 92.04 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 91.99 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 91.99 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 91.97 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 91.96 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 91.81 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 91.67 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 91.55 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 91.55 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 91.53 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 91.52 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 91.51 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 91.36 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 91.11 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 91.08 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 90.98 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 90.88 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 90.86 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 90.79 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 90.75 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 90.52 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 90.23 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 90.11 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 90.08 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 90.06 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 90.04 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 90.02 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 89.95 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 89.64 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 89.4 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 89.24 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 89.17 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 89.01 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 88.9 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 88.73 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 88.58 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 88.53 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 88.5 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 88.16 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 88.13 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 88.03 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 88.0 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 87.79 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 87.31 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 87.11 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 87.06 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 86.95 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 86.92 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 86.83 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 86.73 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 86.7 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 86.61 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 86.39 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 86.2 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 85.89 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 85.68 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 85.59 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 85.57 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 85.3 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 85.11 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 84.42 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 84.0 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 83.63 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 83.26 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 82.83 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 82.81 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 82.79 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 82.26 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 82.17 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 81.64 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 81.54 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 80.63 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 80.46 |
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-52 Score=380.44 Aligned_cols=174 Identities=77% Similarity=1.282 Sum_probs=157.7
Q ss_pred CCCchhccchhhccCceeecceEEEeEeceeEEEEec-ccchHHHHHHHhhhcCCccCCcEEEEEEcCeEEeeCCCCCCC
Q psy11868 201 KPSKEDIISATEASGEQVLYDSAIIHTSMGDIHLQLF-KECAKTVENFCVHSKNNYYNGHIFHRVIKGFMIQTGDPTGTG 279 (374)
Q Consensus 201 kp~~e~~~~~~~~~~~~~~~d~vi~~Tt~G~I~IeLf-d~aPktveNF~~L~k~GyY~gt~FhRVi~~f~IQgGDp~g~G 279 (374)
+|+.|++.+++...+|+...+.++++|++|+|+|+|| +.||+||+||+.||+.|||+|+.||||+|+|||||||+.++|
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~v~~~t~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~FhRvi~~f~iQgGd~~~~g 81 (176)
T 2a2n_A 2 SPSKEEVMAATQAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTG 81 (176)
T ss_dssp -----------CCCSCCCCCSEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSS
T ss_pred CcchhhhhhcccCCCCCCCCCEEEEEecCccEEEEEeCCCChHHHHHHHHHhhcCccCCCEEEEEECCcEEEccCCCCCC
Confidence 5778888777777888888999999999999999999 999999999999999999999999999999999999999999
Q ss_pred CCCccccCCCCcccccCCCCCCCcceEeecccCCCCCcceEEEEcCCCCCCCCCCeEEEEEEeCHHHHHHHhcCCCCCCC
Q psy11868 280 TGGQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQFFITLTPTPWLDNKHTVFGRVTKGMEVVQNISNVKTNHKT 359 (374)
Q Consensus 280 tgG~si~G~~f~dE~~~~LkH~r~G~VSman~gpntngSQFFITl~~~p~LDgk~tVFGrVieGmdVL~~Ie~~~td~~~ 359 (374)
+||+|+||..|+||+.+.++|+++|+|||||++||+|+||||||+.++||||++|+|||+|++|||||++|+++++++.+
T Consensus 82 ~gg~si~g~~~~dE~~~~l~h~~~G~lsmA~~gp~s~gSQFFIt~~~~~~LDg~~tVFG~Vv~Gmdvv~~I~~~~t~~~~ 161 (176)
T 2a2n_A 82 MGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKT 161 (176)
T ss_dssp SCCCCTTSSCBCCCCCTTCCSCSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCTTT
T ss_pred CCCCcccCCccccccccccccCCceEEEEEeCCCCCcccEEEEECCCCCccCCCeeEEEEEeCCHHHHHHHHcCCccCCC
Confidence 99999999999999987899999999999999999999999999999999999999999999999999999999997457
Q ss_pred CCCCCCeEEEEEEEC
Q psy11868 360 DQPYDDIQVISISVK 374 (374)
Q Consensus 360 ~kP~~~I~I~~i~Vk 374 (374)
++|.++|+|.+|+|+
T Consensus 162 ~~P~~~v~I~~v~v~ 176 (176)
T 2a2n_A 162 DKPYEDVSIINITVK 176 (176)
T ss_dssp CCBSSCCBEEEEEEC
T ss_pred CccCCCeEEEEEEEC
Confidence 999999999999985
|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* | Back alignment and structure |
|---|
| >4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 374 | ||||
| d1zkca1 | 178 | b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso | 4e-52 | |
| d1xwna1 | 166 | b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome | 2e-49 | |
| d2a2na1 | 164 | b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma | 7e-48 | |
| d2ok3a1 | 159 | b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B | 7e-48 | |
| d2cfea1 | 162 | b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s | 4e-46 | |
| d2fu0a1 | 155 | b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { | 2e-44 | |
| d2c3ba1 | 171 | b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper | 1e-40 | |
| d1qnga_ | 170 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium | 2e-40 | |
| d2b71a1 | 169 | b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 | 8e-40 | |
| d1a33a_ | 174 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( | 2e-39 | |
| d1xo7a_ | 166 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom | 1e-38 | |
| d2igva1 | 172 | b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno | 1e-38 | |
| d1w74a_ | 171 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 1e-38 | |
| d2rmca_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus | 6e-38 | |
| d1h0pa_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd | 6e-38 | |
| d1ihga2 | 195 | b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain | 7e-37 | |
| d2z6wa1 | 164 | b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c | 5e-36 | |
| d2r99a1 | 161 | b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl | 2e-35 | |
| d1qoia_ | 173 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom | 4e-34 | |
| d1z81a1 | 186 | b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas | 9e-34 | |
| d1lopa_ | 164 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 3e-32 | |
| d1v9ta_ | 166 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 3e-29 |
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 169 bits (429), Expect = 4e-52
Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 1/152 (0%)
Query: 223 AIIHTSMGDIHLQLFKECA-KTVENFCVHSKNNYYNGHIFHRVIKGFMIQTGDPTGTGTG 281
+HT+ GD++L+L + KT ENF K +YY+G IFHR I+ F+IQ GDPTGTGTG
Sbjct: 3 VRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTG 62
Query: 282 GQSIWGGEFKDEFKSHLKHDRPYTVSMANAGPNTNGSQFFITLTPTPWLDNKHTVFGRVT 341
G+S WG FKDEF+ +L H +SMAN+GPN+N SQFFIT +LD KHT+FGRV
Sbjct: 63 GESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVV 122
Query: 342 KGMEVVQNISNVKTNHKTDQPYDDIQVISISV 373
G +V+ + NV+++ KTD+P ++I++ + +V
Sbjct: 123 GGFDVLTAMENVESDPKTDRPKEEIRIDATTV 154
|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 374 | |||
| d2fu0a1 | 155 | Putative cyclophilin PFE0505w {Plasmodium falcipar | 100.0 | |
| d2ok3a1 | 159 | Cyclophilin-like protein PPIL3B {Human (Homo sapie | 100.0 | |
| d2a2na1 | 164 | Peptidylprolyl isomerase domain and WD repeat-cont | 100.0 | |
| d1zkca1 | 178 | Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop | 100.0 | |
| d2b71a1 | 169 | Cyclophilin-like protein PY00693 {Plasmodium yoeli | 100.0 | |
| d1xwna1 | 166 | Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 | 100.0 | |
| d2r99a1 | 161 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1w74a_ | 171 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob | 100.0 | |
| d2igva1 | 172 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d1qoia_ | 173 | Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 | 100.0 | |
| d2cfea1 | 162 | Cyclophilin-like allergen Mal s 6 {Malassezia symp | 100.0 | |
| d2z6wa1 | 164 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1xo7a_ | 166 | Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId | 100.0 | |
| d1qnga_ | 170 | Cyclophilin (eukaryotic) {Plasmodium falciparum [T | 100.0 | |
| d1a33a_ | 174 | Cyclophilin (eukaryotic) {Nematode (Brugia malayi) | 100.0 | |
| d2rmca_ | 182 | Cyclophilin (eukaryotic) {Mouse (Mus musculus), va | 100.0 | |
| d1h0pa_ | 182 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d1z81a1 | 186 | Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId | 100.0 | |
| d1ihga2 | 195 | Cyclophilin 40 isomerase domain {Cow (Bos taurus) | 100.0 | |
| d1lopa_ | 164 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d1v9ta_ | 166 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d2c3ba1 | 171 | Cyclophilin (eukaryotic) {Aspergillus fumigatus [T | 100.0 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 95.8 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 95.43 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 95.38 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 95.33 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 95.17 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 94.76 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 94.28 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 94.13 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 93.84 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 93.78 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 93.78 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 93.76 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 93.74 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 93.46 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 93.33 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 93.01 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 92.79 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 92.7 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 92.48 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 91.85 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 91.65 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 91.65 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 91.51 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 90.9 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 90.71 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 90.68 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 90.56 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 90.17 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 90.12 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 89.11 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 88.57 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 88.52 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 88.09 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 87.47 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 86.64 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 86.37 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 86.3 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 85.31 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 84.67 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 82.91 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 82.33 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 80.62 |
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Putative cyclophilin PFE0505w species: Plasmodium falciparum [TaxId: 5833]
Probab=100.00 E-value=2.1e-45 Score=321.90 Aligned_cols=152 Identities=66% Similarity=1.160 Sum_probs=148.2
Q ss_pred ceEEEeEeceeEEEEec-ccchHHHHHHHhhhcCCccCCcEEEEEEcCeEEeeCCCCCCCCCCccccCCCCcccccCCCC
Q psy11868 221 DSAIIHTSMGDIHLQLF-KECAKTVENFCVHSKNNYYNGHIFHRVIKGFMIQTGDPTGTGTGGQSIWGGEFKDEFKSHLK 299 (374)
Q Consensus 221 d~vi~~Tt~G~I~IeLf-d~aPktveNF~~L~k~GyY~gt~FhRVi~~f~IQgGDp~g~GtgG~si~G~~f~dE~~~~Lk 299 (374)
..|+++|++|+|+|+|| +.||++|+||+.||++|||+|+.||||++++++|+||+.+.+.++.+.|+..+++|....+.
T Consensus 2 ~~~~i~T~~G~i~ieL~~~~aP~tv~nF~~l~~~g~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (155)
T d2fu0a1 2 KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLN 81 (155)
T ss_dssp CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTBC
T ss_pred ceEEEEEcccEEEEEEcCCCChHHHHHHhhHhhCCccccceeeeeeecceeeccCCCCCCcCCcccCCCccccccccccc
Confidence 46899999999999999 99999999999999999999999999999999999999999999999999999999988999
Q ss_pred CCCcceEeecccCCCCCcceEEEEcCCCCCCCCCCeEEEEEEeCHHHHHHHhcCCCCCCCCCCCCCeEEEEEEE
Q psy11868 300 HDRPYTVSMANAGPNTNGSQFFITLTPTPWLDNKHTVFGRVTKGMEVVQNISNVKTNHKTDQPYDDIQVISISV 373 (374)
Q Consensus 300 H~r~G~VSman~gpntngSQFFITl~~~p~LDgk~tVFGrVieGmdVL~~Ie~~~td~~~~kP~~~I~I~~i~V 373 (374)
|.++|+++|++++|++++|||||++.+.|+||++|+|||+|++|||||++|++++++ .+++|+++|+|.+|+|
T Consensus 82 ~~~~~~~~~~~~~~~s~~sqFfI~~~~~~~ld~~~tvFG~Vi~G~~vv~~I~~~~t~-~~~~P~~~i~I~~v~i 154 (155)
T d2fu0a1 82 HSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTD-KRDKPLEDIKILNIKI 154 (155)
T ss_dssp SSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBC-TTSCBSSCCBEEEEEE
T ss_pred cCCccEEEecccCCCCCCccceecccCccccccceEEEEEEeccHHHHHHHHhCCCC-CCCCcCCCcEEEEEEE
Confidence 999999999999999999999999999999999999999999999999999999998 7999999999999998
|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|