Psyllid ID: psy11884

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640----
MKRGPWNRRIRGATGKSGYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQTSPQGSVGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDIFLFFSRLIDFIKSFLSSFKK
ccccccccccccccccccccEEEEEEccEEEEEEEEccccccccHHHHccccccccccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccccEEEEEEEEHEEcccccEEEEEccccccccccccccccccccccccccccccEEEEEEEccEEEEEcccccccEEEEEccccccccccEEEEEEEEEEEccccccccccEEEcccccccEEEEEEEccccccEEEcccEEEEEEccHHHHccccEEEEccccccEEEEEEccccccccEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccc
cccccccccEccccccccHHHHHHEEcccEEEEEEccccccccccHHHHHcccccccEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEcEEEEEccccccHHHccccccccccEEEEccccccEEEEEccccccccccEcccccEEEEcccccEEcccccccccccEEEEEEccccccccccccHcHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccEcEEEEHHHHHcccEEEEEEcccEEcccccccccccEEEEEEEHHHHHcccEEEEEEcccEEcccccccccccccccccccccccccEEEEcccEEEEEEcccccccccEEEcccccccccccEEEEEEEEEEEEccccccccEEEEccccccEEEEEEEEccccEEEccccEEEEEEEEHHHHHccccEEEEcccccEEEEEEccccccccEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
mkrgpwnrrirgatgksGYSALLMSVSKFSVETEIDRKiglyapyvskrfrnyghfpkiqinvhansqSYVFFYeesdgltySSIRQTAKELQRFRnygqfrlfdTKIAISSCNVTKKCFysiqtspqgsvgsgLMKTLVLQKVLTMILSLKAvirvpprlfssfkygalqlnrfhlvnpqpliylrhsahfhtspslsnlkrkdyYQILGISKNSSAKEIKKAYYELAKkyhpdtnktdpnaskkfHEVSEAYEVlsddtkrqeydtwgatseqmsaagasrsttAEDYMhrwnfkssvdpeELFRKIfgdtgfdfkVTEEEFIankygfgssqEVILKIDKCLQQVPVDLQLqrttciggisitEEEFIankygfgssqeVILKIDFEtaarggykevdvnvidicpkcrgtrcelgtksvrctycqgsgyettttgpfimkttcrycsgsgiyikfpcqncdgmgqniqrrtvsipipqgiedgqtirfpigqdqifvtfqvipssryhrdqsdihteesISISQAILGGTinvegiygdtlsveiqpgtsshtkikipykglknrnssgyghhfvhvkievprypsekqKDLVREFFsvepntngnkddsnqalsgyrDIFLFFSRLIDFIKSFLSSFKK
mkrgpwnrrirgatgksgysaLLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQtspqgsvgsgLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFhtspslsnlkrKDYYQILGisknssakEIKKAYYELAKkyhpdtnktdpnaskKFHEVSEAyevlsddtkRQEYDTWgatseqmsaagasRSTTAEDYMHRWnfkssvdpeELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPkcrgtrcelgtksvrctycqgsgyettttgpfimKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSveiqpgtsshtkikipykGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFsvepntngnkddsnqalSGYRDIFLFFSRLIDFIKSFLSSFKK
MKRGPWNRRIRGATGKSGYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQTSPQGSVGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDIFLFFSRLIDFIKSFLSSFKK
*****************GYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQTSPQGSVGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISK******IKKAYYELA************************************************************YMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRD**DIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRY*****************************LSGYRDIFLFFSRLIDFIKSFL*****
**********RGATGKSGYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFY*I*******VGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKY*************QPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSE*************EDYMHRWNFKSSVDPEELFRKIFGDTGFDFKV******************************VDLQLQRTTCIGGISIT****I***YGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRG**********RCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVRE**************************LFFSRLIDFIKSFLSSF**
MKRGPWNRRIRGATGKSGYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQTSPQGSVGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGAT**************AEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDIFLFFSRLIDFIKSFLSSFKK
**************GKSGYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQTSPQGSVGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTR**L*TKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEP*************SGYRDIFLFFSRLIDFIKSFLSSFKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRGPWNRRIRGATGKSGYSALLMSVSKFSVETEIDRKIGLYAPYVSKRFRNYGHFPKIQINVHANSQSYVFFYEESDGLTYSSIRQTAKELQRFRNYGQFRLFDTKIAISSCNVTKKCFYSIQTSPQGSVGSGLMKTLVLQKVLTMILSLKAVIRVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSPSLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDIFLFFSRLIDFIKSFLSSFKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query644 2.2.26 [Sep-21-2011]
Q24331529 Protein tumorous imaginal N/A N/A 0.583 0.710 0.463 1e-110
Q27237520 Protein tumorous imaginal yes N/A 0.579 0.717 0.451 1e-103
Q96EY1480 DnaJ homolog subfamily A yes N/A 0.645 0.866 0.391 5e-92
Q99M87480 DnaJ homolog subfamily A yes N/A 0.684 0.918 0.382 6e-91
Q8TA83456 DnaJ homolog dnj-10 OS=Ca yes N/A 0.559 0.789 0.391 3e-77
Q3AF07381 Chaperone protein DnaJ OS yes N/A 0.534 0.902 0.319 6e-49
O27352376 Chaperone protein DnaJ OS yes N/A 0.529 0.906 0.323 4e-48
Q74IT7388 Chaperone protein DnaJ OS yes N/A 0.538 0.894 0.306 4e-48
A5CD86377 Chaperone protein DnaJ OS yes N/A 0.520 0.888 0.305 9e-48
B3CVD9377 Chaperone protein DnaJ OS yes N/A 0.520 0.888 0.305 2e-47
>sp|Q24331|TID_DROVI Protein tumorous imaginal discs, mitochondrial OS=Drosophila virilis GN=l(2)tid PE=2 SV=1 Back     alignment and function desciption
 Score =  400 bits (1029), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/438 (46%), Positives = 283/438 (64%), Gaps = 62/438 (14%)

Query: 197 SLSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEV 256
           S S ++ KDYY  LG++KN++AK+IKKAYYELAKKYHPDTNK DP+ASKKF +VSEAYEV
Sbjct: 72  SSSRMQAKDYYATLGVAKNANAKDIKKAYYELAKKYHPDTNKDDPDASKKFQDVSEAYEV 131

Query: 257 LSDDTKRQEYDTWGATSEQMS-------AAGASRSTTAEDYMHRWNFKSSVDPEELFRKI 309
           LSDD KR+EYDT+G T+E M+                 + +   W F+S++DPEELFRKI
Sbjct: 132 LSDDQKRREYDTYGQTTENMNRQGAGGAGGFGGGPFGPDGFSQNWQFRSTIDPEELFRKI 191

Query: 310 FGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEE 369
           FG         E  F +N +                                      ++
Sbjct: 192 FG---------EGNFRSNSF--------------------------------------DD 204

Query: 370 FIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQ 429
           F  +K+GFG +QE+++ + F  AARG  K+V+VNV+D CPKC G++CE GTK  RC YC 
Sbjct: 205 FADSKFGFGQAQELVMDLTFAQAARGVNKDVNVNVVDQCPKCAGSKCEPGTKPGRCQYCN 264

Query: 430 GSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQT 489
           G+G+ET +TGPF+M++TCRYC G+  YIK+PC  C+G GQ +QRR V++P+P GIE+GQT
Sbjct: 265 GTGFETISTGPFVMRSTCRYCQGTRQYIKYPCAECEGKGQTVQRRKVTVPVPAGIENGQT 324

Query: 490 IRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEI 549
           +R  +G  ++FVTF+V  S  + RD +D+HT+  IS++QA+LGGT+ V+G+Y D   + I
Sbjct: 325 VRMQVGSKELFVTFRVERSDYFRRDGADVHTDAPISLAQAVLGGTVRVQGVYEDQW-LNI 383

Query: 550 QPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNG 609
           +PGTSSH KI +  KGLK  N+ G+G H+VH+KIEVP+  S++Q+ L+  +  +E +T G
Sbjct: 384 EPGTSSHRKIALRGKGLKRVNAHGHGDHYVHIKIEVPKKLSQEQRALLEAYAELEEDTPG 443

Query: 610 N-------KDDSNQALSG 620
                   KD S +A +G
Sbjct: 444 QIHGMAQRKDGSKKATAG 461
May act as a tumor suppressor in larval imaginal disks.
Drosophila virilis (taxid: 7244)
>sp|Q27237|TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2 Back     alignment and function description
>sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 Back     alignment and function description
>sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 Back     alignment and function description
>sp|Q8TA83|DNJ10_CAEEL DnaJ homolog dnj-10 OS=Caenorhabditis elegans GN=dnj-10 PE=4 SV=1 Back     alignment and function description
>sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q74IT7|DNAJ_LACJO Chaperone protein DnaJ OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query644
307204018485 Protein tumorous imaginal discs, mitocho 0.572 0.760 0.509 1e-123
322785350543 hypothetical protein SINV_09539 [Solenop 0.586 0.696 0.488 1e-120
380026912520 PREDICTED: protein tumorous imaginal dis 0.572 0.709 0.511 1e-120
383852683522 PREDICTED: protein tumorous imaginal dis 0.600 0.741 0.484 1e-120
328793508520 PREDICTED: protein tumorous imaginal dis 0.572 0.709 0.511 1e-120
332023854479 Protein tumorous imaginal discs, mitocho 0.585 0.787 0.495 1e-120
157128157491 chaperone protein dnaj [Aedes aegypti] g 0.618 0.810 0.476 1e-119
340720435522 PREDICTED: protein tumorous imaginal dis 0.599 0.739 0.487 1e-119
307180424519 Protein tumorous imaginal discs, mitocho 0.625 0.776 0.470 1e-119
350410070529 PREDICTED: protein tumorous imaginal dis 0.596 0.725 0.480 1e-118
>gi|307204018|gb|EFN82922.1| Protein tumorous imaginal discs, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  450 bits (1157), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/418 (50%), Positives = 290/418 (69%), Gaps = 49/418 (11%)

Query: 193 HTSPSLSN-LKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVS 251
           H S  L+N L +++YY+ILG+SKN+SAK+IKKAYYELAKKYHPDTNK DPN  +KF EVS
Sbjct: 69  HRSIYLTNKLLKRNYYEILGVSKNASAKDIKKAYYELAKKYHPDTNKGDPNTGRKFQEVS 128

Query: 252 EAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFG 311
           EAYEVLSD++KR+EYDTWGATSEQM   G  +   A++Y H W ++S+++ EELFRKIFG
Sbjct: 129 EAYEVLSDESKRKEYDTWGATSEQMGMGGMGQK--AKNYNH-WQYRSTINAEELFRKIFG 185

Query: 312 DTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFI 371
           D GF                                              G     ++F 
Sbjct: 186 DAGFQ--------------------------------------------SGAFTDFDDFA 201

Query: 372 ANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGS 431
            +KYGFG++QE+I+ + F  AARG  K++D+NVID+CPKC G+RCELGTK  +C YC G+
Sbjct: 202 ESKYGFGAAQEIIMNLTFSQAARGINKDIDINVIDVCPKCDGSRCELGTKPGKCFYCNGT 261

Query: 432 GYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIR 491
           G ET +TGPF+M +TCRYC G+ +YIKFPC NCDG GQ +QR+ V++P+P G+EDGQTIR
Sbjct: 262 GVETISTGPFVMSSTCRYCQGTRVYIKFPCNNCDGKGQAVQRKRVTVPVPAGVEDGQTIR 321

Query: 492 FPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQP 551
             +G+ ++FVTF+V  S  + RD +D+HT+  IS++QAILGGTI VEG+Y D  +++I P
Sbjct: 322 LAVGRKEVFVTFRVEKSRYFRRDGADVHTDAEISLAQAILGGTIRVEGVYEDQ-TIQIAP 380

Query: 552 GTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNG 609
           GTSSHT++++  KGLK  N  GYG H+V++KI VP+  ++KQ+ L++ +  +E +T G
Sbjct: 381 GTSSHTRVRLSGKGLKKINGVGYGDHYVNIKITVPKKLTDKQQALLQAYAELETDTPG 438

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322785350|gb|EFZ12024.1| hypothetical protein SINV_09539 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|380026912|ref|XP_003697183.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|383852683|ref|XP_003701855.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328793508|ref|XP_394833.2| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332023854|gb|EGI64078.1| Protein tumorous imaginal discs, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157128157|ref|XP_001661333.1| chaperone protein dnaj [Aedes aegypti] gi|108872682|gb|EAT36907.1| AAEL011055-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|340720435|ref|XP_003398644.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307180424|gb|EFN68450.1| Protein tumorous imaginal discs, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350410070|ref|XP_003488936.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query644
UNIPROTKB|G3V9U3453 Dnaja3 "Protein Dnaja3" [Rattu 0.392 0.558 0.432 1e-90
RGD|1306527480 Dnaja3 "DnaJ (Hsp40) homolog, 0.392 0.527 0.432 1.3e-90
UNIPROTKB|G3V6I5480 Dnaja3 "RCG49803, isoform CRA_ 0.392 0.527 0.432 1.3e-90
UNIPROTKB|I3LLG4476 DNAJA3 "Uncharacterized protei 0.389 0.527 0.431 7.1e-90
MGI|MGI:1933786480 Dnaja3 "DnaJ (Hsp40) homolog, 0.392 0.527 0.436 1.2e-89
ZFIN|ZDB-GENE-030131-7837453 dnaja3a "DnaJ (Hsp40) homolog, 0.380 0.540 0.414 3.5e-88
ZFIN|ZDB-GENE-040115-3474 dnaja3b "DnaJ (Hsp40) homolog, 0.360 0.489 0.437 2.4e-87
WB|WBGene00001028456 dnj-10 [Caenorhabditis elegans 0.383 0.541 0.422 9.2e-86
UNIPROTKB|E9PSW5429 Dnaja3 "Protein Dnaja3" [Rattu 0.291 0.438 0.439 3.5e-76
FB|FBgn0002174520 l(2)tid "lethal (2) tumorous i 0.391 0.484 0.477 3e-69
UNIPROTKB|G3V9U3 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 580 (209.2 bits), Expect = 1.0e-90, Sum P(2) = 1.0e-90
 Identities = 112/259 (43%), Positives = 162/259 (62%)

Query:   369 EFIANKYG-----FGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSV 423
             EF ++ +G     F   QE I+++ F  AA+G  KE  VN++D C +C G   E GTK  
Sbjct:   192 EFSSSPFGDFQNVFDQPQEYIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQ 251

Query:   424 RCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQG 483
              C YC GSG ET  TGPF+M++TCR C G G  I  PC  C G GQ  Q++ V++P+P G
Sbjct:   252 HCHYCSGSGMETINTGPFVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTVPVPAG 311

Query:   484 IEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGD 543
             +EDGQT+R P+G+ +IFVTF+V  S  + RD +DIH++  ISI+QAILGGT   +G+Y +
Sbjct:   312 VEDGQTVRMPVGKREIFVTFRVQKSPVFRRDGADIHSDLFISIAQAILGGTAKAQGLY-E 370

Query:   544 TLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSV 603
             T++V I  G  +  KI++  KG+   NS GYG H++H+KI VP+  S +Q++L+  +   
Sbjct:   371 TINVTIPAGIQTDQKIRLTGKGIPRINSYGYGDHYIHIKIRVPKRLSSRQQNLILSYAED 430

Query:   604 EPNTNGNKDDSNQALSGYR 622
             E +  G  +      +G R
Sbjct:   431 ETDVEGTVNGVTHTSTGKR 449
GO:0005524 "ATP binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0009408 "response to heat" evidence=IEA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
RGD|1306527 Dnaja3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6I5 Dnaja3 "RCG49803, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLG4 DNAJA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1933786 Dnaja3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7837 dnaja3a "DnaJ (Hsp40) homolog, subfamily A, member 3A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040115-3 dnaja3b "DnaJ (Hsp40) homolog, subfamily A, member 3B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00001028 dnj-10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSW5 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0002174 l(2)tid "lethal (2) tumorous imaginal discs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96EY1DNJA3_HUMANNo assigned EC number0.39140.64590.8666yesN/A
Q99M87DNJA3_MOUSENo assigned EC number0.38220.68470.9187yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query644
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-87
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 6e-87
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 7e-72
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-70
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-69
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-69
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-67
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 3e-57
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-55
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 4e-55
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-55
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-54
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-53
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-52
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 9e-51
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 3e-49
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-48
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 6e-43
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 3e-42
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-42
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 6e-42
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 7e-40
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-33
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 6e-33
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 4e-32
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-30
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 5e-30
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 5e-28
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-26
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 4e-25
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 8e-25
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-24
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-24
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 4e-24
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-24
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 7e-22
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-21
pfam0155681 pfam01556, DnaJ_C, DnaJ C terminal domain 3e-21
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-20
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-20
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 3e-19
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-18
cd1071965 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H 2e-18
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 5e-18
pfam0068465 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain 3e-16
COG5407610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-10
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-08
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 5e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 8e-06
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-05
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 6e-05
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 1e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.002
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 0.002
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.003
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information 
 Score =  276 bits (707), Expect = 2e-87
 Identities = 133/412 (32%), Positives = 188/412 (45%), Gaps = 74/412 (17%)

Query: 205 DYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQ 264
           DYY+ILG+SK++S +EIKKAY +LAKKYHPD NK D  A +KF E++EAYEVLSD  KR 
Sbjct: 1   DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNK-DKEAEEKFKEINEAYEVLSDPEKRA 59

Query: 265 EYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEF 324
           +YD +G         G        D      F    D  ++F   FG  G          
Sbjct: 60  QYDQFGHAGFNGGGGGGGGGFNGFD---IGFFG---DFGDIFGDFFGGGG---------- 103

Query: 325 IANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVI 384
                G G  +          +  P                            G      
Sbjct: 104 -----GSGRRR----------RSGPRR--------------------------GEDLRYD 122

Query: 385 LKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGP---- 440
           L++ FE A  G  KE+++   + C  C GT  + GT    C  C G+G      G     
Sbjct: 123 LELTFEEAVFGVEKEIEIPRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRRQQGTPFGF 182

Query: 441 FIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQ-- 498
           F  + TC  C G G  IK PC  C G G+  +R+T+++ IP G++ GQ +R   G+    
Sbjct: 183 FQQQQTCPTCGGEGKIIKEPCSTCKGKGRVKERKTITVKIPAGVDTGQRLRVS-GKGNAG 241

Query: 499 --------IFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQ 550
                   ++V  +V P   + RD +D++ E  IS +QAILGG I V  + GD   ++I 
Sbjct: 242 ENGGPNGDLYVVIRVKPHKIFERDGNDLYIEVPISFTQAILGGEIEVPTLDGDV-KLKIP 300

Query: 551 PGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFS 602
            GT S T  ++  KG+     +G G   V VK+E P+  S++QK+L+ E   
Sbjct: 301 AGTQSGTVFRLKGKGVPRLRGNGRGDLLVTVKVETPKNLSKEQKELLEELAE 352

This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 644
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14288369 chaperone protein DnaJ; Provisional 100.0
PRK14296372 chaperone protein DnaJ; Provisional 100.0
PRK14286372 chaperone protein DnaJ; Provisional 100.0
PRK14298377 chaperone protein DnaJ; Provisional 100.0
PRK14284391 chaperone protein DnaJ; Provisional 100.0
PRK14276380 chaperone protein DnaJ; Provisional 100.0
PRK14277386 chaperone protein DnaJ; Provisional 100.0
PRK14297380 chaperone protein DnaJ; Provisional 100.0
PRK14287371 chaperone protein DnaJ; Provisional 100.0
PRK14280376 chaperone protein DnaJ; Provisional 100.0
PRK14278378 chaperone protein DnaJ; Provisional 100.0
PRK14285365 chaperone protein DnaJ; Provisional 100.0
PRK14279392 chaperone protein DnaJ; Provisional 100.0
PRK14301373 chaperone protein DnaJ; Provisional 100.0
PTZ00037421 DnaJ_C chaperone protein; Provisional 100.0
PRK14295389 chaperone protein DnaJ; Provisional 100.0
PRK14294366 chaperone protein DnaJ; Provisional 100.0
PRK14282369 chaperone protein DnaJ; Provisional 100.0
PRK10767371 chaperone protein DnaJ; Provisional 100.0
PRK14281397 chaperone protein DnaJ; Provisional 100.0
PRK14291382 chaperone protein DnaJ; Provisional 100.0
PRK14300372 chaperone protein DnaJ; Provisional 100.0
PRK14283378 chaperone protein DnaJ; Provisional 100.0
PRK14292371 chaperone protein DnaJ; Provisional 100.0
PRK14290365 chaperone protein DnaJ; Provisional 100.0
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK14289386 chaperone protein DnaJ; Provisional 100.0
PRK14293374 chaperone protein DnaJ; Provisional 100.0
KOG0712|consensus337 100.0
PRK14299291 chaperone protein DnaJ; Provisional 100.0
PRK10266306 curved DNA-binding protein CbpA; Provisional 100.0
KOG0715|consensus288 100.0
KOG0713|consensus336 100.0
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 100.0
KOG0714|consensus306 99.82
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 99.78
KOG0716|consensus279 99.68
KOG0691|consensus296 99.64
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.63
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.61
KOG0718|consensus546 99.6
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.59
KOG0717|consensus508 99.57
PHA03102153 Small T antigen; Reviewed 99.54
KOG0624|consensus504 99.53
KOG0719|consensus264 99.52
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.52
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.48
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.44
KOG0721|consensus230 99.44
PRK14287371 chaperone protein DnaJ; Provisional 99.33
KOG0550|consensus486 99.32
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.32
PRK14289386 chaperone protein DnaJ; Provisional 99.31
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 99.29
PRK14293374 chaperone protein DnaJ; Provisional 99.27
PRK14285365 chaperone protein DnaJ; Provisional 99.27
PRK14279392 chaperone protein DnaJ; Provisional 99.26
PRK14301373 chaperone protein DnaJ; Provisional 99.24
PRK05014171 hscB co-chaperone HscB; Provisional 99.23
PRK14286372 chaperone protein DnaJ; Provisional 99.21
PRK14297380 chaperone protein DnaJ; Provisional 99.21
KOG0722|consensus329 99.2
PRK14280376 chaperone protein DnaJ; Provisional 99.2
KOG0720|consensus490 99.2
PRK14276380 chaperone protein DnaJ; Provisional 99.19
PRK14298377 chaperone protein DnaJ; Provisional 99.18
PRK01356166 hscB co-chaperone HscB; Provisional 99.18
PRK14296372 chaperone protein DnaJ; Provisional 99.18
PRK14282369 chaperone protein DnaJ; Provisional 99.17
PRK00294173 hscB co-chaperone HscB; Provisional 99.17
PRK14292371 chaperone protein DnaJ; Provisional 99.16
PTZ00100116 DnaJ chaperone protein; Provisional 99.16
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.16
PRK14295389 chaperone protein DnaJ; Provisional 99.16
PRK03578176 hscB co-chaperone HscB; Provisional 99.15
PRK14278378 chaperone protein DnaJ; Provisional 99.15
PRK14277386 chaperone protein DnaJ; Provisional 99.15
PRK10767371 chaperone protein DnaJ; Provisional 99.15
PRK14283378 chaperone protein DnaJ; Provisional 99.14
PRK14284391 chaperone protein DnaJ; Provisional 99.14
PRK14294366 chaperone protein DnaJ; Provisional 99.13
PRK14300372 chaperone protein DnaJ; Provisional 99.09
PRK14288369 chaperone protein DnaJ; Provisional 99.09
PRK14281397 chaperone protein DnaJ; Provisional 99.08
PRK14291382 chaperone protein DnaJ; Provisional 99.04
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.0
PHA02624 647 large T antigen; Provisional 98.98
PRK14290365 chaperone protein DnaJ; Provisional 98.92
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.87
KOG1150|consensus250 98.8
PRK14299291 chaperone protein DnaJ; Provisional 98.78
PLN03165111 chaperone protein dnaJ-related; Provisional 98.62
PRK10266306 curved DNA-binding protein CbpA; Provisional 98.6
PRK01773173 hscB co-chaperone HscB; Provisional 98.6
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.56
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.33
KOG0568|consensus342 98.11
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 98.09
KOG1789|consensus 2235 97.93
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.74
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 97.66
KOG0723|consensus112 97.64
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 97.55
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 97.28
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 97.11
KOG0712|consensus337 97.1
KOG0715|consensus288 96.22
KOG2813|consensus406 95.96
PLN03165111 chaperone protein dnaJ-related; Provisional 95.94
KOG2813|consensus406 95.92
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 95.85
KOG3192|consensus168 94.93
KOG0431|consensus453 93.58
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 90.81
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 90.09
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 89.49
KOG2824|consensus281 86.81
PRK14714 1337 DNA polymerase II large subunit; Provisional 81.24
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-85  Score=692.97  Aligned_cols=358  Identities=37%  Similarity=0.638  Sum_probs=314.6

Q ss_pred             CccChhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHhhhhhhhhcCcccccccccccCCccccccccCC
Q psy11884        202 KRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGA  281 (644)
Q Consensus       202 ~~~d~Y~vLGv~~~as~~eIKkaYRkLa~~~HPDk~~~~~~a~e~f~~I~~AYevLsd~~kR~~YD~~G~~~~~~~~~g~  281 (644)
                      +.+|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|++||||||||+||++||+||.++.+.+++++
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg   81 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGG   81 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCC
Confidence            56899999999999999999999999999999999998899999999999999999999999999999998886332211


Q ss_pred             CCCCCccccccccCCCCCCChHHHHHhhhCCCCCCcchhhHHHhhccCCCCCchhhhhhhhhccccCcchhhcccccccC
Q psy11884        282 SRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIG  361 (644)
Q Consensus       282 ~~~~~~~~f~~~~~~~~~~d~~dlF~~fFG~~~f~~~~~~~~~~~~~~~f~~s~~~~~~~~k~~~~~p~~~~~qr~~~~g  361 (644)
                      .   ++.+|      .+  |+.|||++|||+++++             ...                             
T Consensus        82 ~---g~~~f------gg--~~~DIF~~~FgGg~~~-------------~~~-----------------------------  108 (371)
T COG0484          82 F---GFGGF------GG--DFGDIFEDFFGGGGGG-------------RRR-----------------------------  108 (371)
T ss_pred             C---CcCCC------CC--CHHHHHHHhhcCCCcc-------------cCC-----------------------------
Confidence            1   11111      11  7899999999743211             000                             


Q ss_pred             CccchhhhhhhccCCCCCceEEEEecCHHHHhcCceEEEEeeeeecCCCCCcccccCCCccccCCCCCCcceEEeee--c
Q psy11884        362 GISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTT--G  439 (644)
Q Consensus       362 g~~~~~~~~~~~~~~~g~d~ev~L~vTLeEa~~G~~k~i~v~~~~~C~~C~GtG~~~g~~~~~C~~C~G~G~~~~~~--G  439 (644)
                                .+...+|.|+.+.|+|||||||.|++++|.+++...|+.|+|+|+++++...+|+.|+|+|.+.+..  |
T Consensus       109 ----------~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC~tC~G~G~v~~~~~~g  178 (371)
T COG0484         109 ----------PNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTG  178 (371)
T ss_pred             ----------CCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCcCCCCCCcCeEEEEEeee
Confidence                      0012468899999999999999999999999999999999999999999999999999999876555  8


Q ss_pred             CceeeeecCCCCceeEEEeeccccCCCCceeEEEEEEEEeeCCCCCCCCEEEEecCC---------ceEEEEEEeecCCC
Q psy11884        440 PFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQ---------DQIFVTFQVIPSSR  510 (644)
Q Consensus       440 ~~~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~e~~~l~V~IPpGv~dG~~I~~~g~g---------gDL~v~i~vkph~~  510 (644)
                      .+.++++|+.|+|+|++|+++|+.|+|.|++.+.++++|+||||+.+|++|+++++|         |||||.|.|++|+.
T Consensus       179 ~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~~Ggp~GDLyv~i~v~~h~~  258 (371)
T COG0484         179 FFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGPNGGPAGDLYVFVHVKPHPI  258 (371)
T ss_pred             EEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCCCCCCCccEEEEEEeecCCC
Confidence            788999999999999999999999999999999999999999999999999999743         79999999999999


Q ss_pred             ccccCCCeEEEEecCHhHhhcCCEEEEEeeeCcEEEEEeCCCCCCCcEEEEcCCCcCCCCCCCCccEEEEEEEECCCCCC
Q psy11884        511 YHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPS  590 (644)
Q Consensus       511 F~R~G~DL~~~~~Isl~eALlG~~~~I~tLdG~~l~V~IppG~~~g~~irI~GeG~P~~~~~~rGDL~V~f~V~fP~~Ls  590 (644)
                      |+|+|+||+++++|++.+|++|+++.|+||||+ ++|+||+|+++|++++|+|+|||..++..+|||||+|+|++|++|+
T Consensus       259 F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g~-~~l~ip~Gtq~G~~~rl~gkG~p~~~~~~~GDl~v~v~v~~P~~ls  337 (371)
T COG0484         259 FERDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKLKIPAGTQTGEVFRLRGKGMPKLRSGGRGDLYVRVKVETPKNLS  337 (371)
T ss_pred             eEECCCceEeccccCHHHHhcCCEEEEEecCCC-EEEecCCCCccCcEEEEcCCCccccCCCCcCCEEEEEEEEcCCCCC
Confidence            999999999999999999999999999999999 7999999999999999999999997777889999999999999999


Q ss_pred             HHHHHHHHHHhhhCCCCCCCCCCCCccccCccchhhhhHHHHHHHH
Q psy11884        591 EKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDIFLFFSRLIDFIK  636 (644)
Q Consensus       591 ~~q~~lL~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  636 (644)
                      .+|++||++|+....+  ...           +...||++||+|.+
T Consensus       338 ~~q~~lL~~~~~~~~~--~~~-----------~~~~~~~k~k~~f~  370 (371)
T COG0484         338 DEQKELLEEFAKSLGE--GPE-----------QSPGFFDKLKNFFK  370 (371)
T ss_pred             HHHHHHHHHHHHhhcc--ccc-----------cChhhhHHhHhhcc
Confidence            9999999999975411  111           11189999988854

>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>KOG2813|consensus Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>KOG2813|consensus Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG2824|consensus Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query644
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-22
2ctt_A104 Solution Structure Of Zinc Finger Domain From Human 3e-18
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 7e-17
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 7e-17
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-16
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 4e-16
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-14
1nlt_A248 The Crystal Structure Of Hsp40 Ydj1 Length = 248 4e-14
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 4e-14
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-13
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-13
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 3e-13
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 6e-07
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 4e-13
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 4e-13
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 6e-13
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 8e-13
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-12
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-12
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-12
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 7e-12
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 7e-10
1exk_A79 Solution Structure Of The Cysteine-Rich Domain Of T 1e-08
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 3e-08
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 1e-06
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-06
3agx_A181 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 8e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 9e-06
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-05
2qld_A183 Human Hsp40 Hdj1 Length = 183 9e-05
3agz_A190 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 1e-04
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 3e-04
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 59/67 (88%)
Query: 205 DYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQ 264
           DYYQILG+ +N+S KEIKKAYY+LAKKYHPDTNK DP A +KF +++EAYEVLSD+ KR+
Sbjct: 8   DYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRK 67
Query: 265 EYDTWGA 271
           +YD +G+
Sbjct: 68  QYDAYGS 74
>pdb|2CTT|A Chain A, Solution Structure Of Zinc Finger Domain From Human Dnaj Subfamily A Menber 3 Length = 104 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1EXK|A Chain A, Solution Structure Of The Cysteine-Rich Domain Of The Escherichia Coli Chaperone Protein Dnaj Length = 79 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 Back     alignment and structure
>pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query644
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 8e-65
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 4e-47
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-36
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 4e-35
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-33
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-33
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-32
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-32
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-32
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-32
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-32
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 8e-32
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 9e-32
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-31
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 4e-31
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-31
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-30
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 7e-30
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-29
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 6e-29
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-27
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-26
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 1e-25
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 1e-24
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 2e-24
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-23
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-23
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 6e-23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-22
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 3e-21
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-18
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 2e-17
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 3e-17
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-17
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 5e-17
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 5e-16
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 1e-15
2guz_A71 Mitochondrial import inner membrane translocase su 4e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 5e-13
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 3e-11
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 3e-10
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
 Score =  215 bits (550), Expect = 8e-65
 Identities = 74/415 (17%), Positives = 138/415 (33%), Gaps = 131/415 (31%)

Query: 204 KDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKR 263
           KDYY ILG+      K IK AY  LA+KYHPD +K + +A  KF +++EA+EVL D+ +R
Sbjct: 28  KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSK-ENDAEAKFKDLAEAWEVLKDEQRR 86

Query: 264 QEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEE 323
            EYD               ++                            +  DF    ++
Sbjct: 87  AEYDQLWQHRNDPGFGRQRQTHE-----------------------QSYSQQDF----DD 119

Query: 324 FIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEV 383
             ++ +G  + Q                                          G   E+
Sbjct: 120 IFSSMFGQQAHQ-------------------------RR---------RQHAARGHDLEI 145

Query: 384 ILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIM 443
            + +  E       + +  N         G                              
Sbjct: 146 EVAVFLEETLAEQTRTISYN--LPVYNVFGM----------------------------- 174

Query: 444 KTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQ----- 498
                                    ++   +T+++ IP G+ DGQ IR   GQ       
Sbjct: 175 ------------------------IESETPKTLNVKIPAGVVDGQRIRLK-GQGTPGENG 209

Query: 499 -----IFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGT 553
                +++   + P   +     ++     ++  +A LG  + V  +   ++ + + PG+
Sbjct: 210 GPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKE-SILLTVPPGS 268

Query: 554 SSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTN 608
            +  +++I  KGL ++     G  F  +KI +P  P EK ++L ++  + E + +
Sbjct: 269 QAGQRLRIKGKGLVSKT--HTGDLFAVIKIVMPTKPDEKARELWQQLAAAEASFD 321
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query644
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 100.0
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 100.0
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 100.0
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 100.0
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 100.0
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.91
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.87
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.82
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.81
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.78
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.77
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.77
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.77
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.75
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.75
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.75
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.74
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.74
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.73
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.73
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.73
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.72
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.71
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.66
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.65
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.63
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.61
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.58
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.57
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.57
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.55
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.52
2guz_A71 Mitochondrial import inner membrane translocase su 99.51
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.5
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.49
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.47
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.46
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.45
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 99.42
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.42
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.4
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 99.21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.7
2guz_B65 Mitochondrial import inner membrane translocase su 98.64
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 98.64
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 98.63
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 98.56
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 98.54
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 97.61
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.55
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.48
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 97.28
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.04
3pmq_A 669 Decaheme cytochrome C MTRF; greek KEY, C type cyto 97.04
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 96.73
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 95.14
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 94.82
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=4.7e-57  Score=478.53  Aligned_cols=285  Identities=26%  Similarity=0.470  Sum_probs=153.1

Q ss_pred             CCccChhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHhhhhhhhhcCcccccccccccCCccccccccC
Q psy11884        201 LKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAG  280 (644)
Q Consensus       201 ~~~~d~Y~vLGv~~~as~~eIKkaYRkLa~~~HPDk~~~~~~a~e~f~~I~~AYevLsd~~kR~~YD~~G~~~~~~~~~g  280 (644)
                      +..+|||++|||+++||.+|||+|||+||++||||+++. +.|+++|++|++||++|+||.+|+.||+++......++.+
T Consensus        25 m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~-~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~  103 (329)
T 3lz8_A           25 MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKE-NDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGR  103 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCC-hHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccc
Confidence            356899999999999999999999999999999999975 5889999999999999999999999999854322111100


Q ss_pred             CCCCCCccccccccCCCCCCChHHHHHhhhCCCCCCcchhhHHHhhccCCCCCchhhhhhhhhccccCcchhhccccccc
Q psy11884        281 ASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCI  360 (644)
Q Consensus       281 ~~~~~~~~~f~~~~~~~~~~d~~dlF~~fFG~~~f~~~~~~~~~~~~~~~f~~s~~~~~~~~k~~~~~p~~~~~qr~~~~  360 (644)
                       +.+....+      |. ..+++|+|++|||+++..           .   +.                           
T Consensus       104 -~~~~~~~~------f~-~~~f~diF~~~Fg~~g~~-----------~---~~---------------------------  134 (329)
T 3lz8_A          104 -QRQTHEQS------YS-QQDFDDIFSSMFGQQAHQ-----------R---RR---------------------------  134 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             -ccccccCC------cC-CCchhhhhHhhhcCcCCC-----------C---CC---------------------------
Confidence             00000001      11 125678899998752111           0   00                           


Q ss_pred             CCccchhhhhhhccCCCCCceEEEEecCHHHHhcCceEEEEeeeeecCCCCCcccccCCCccccCCCCCCcceEEeeecC
Q psy11884        361 GGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGP  440 (644)
Q Consensus       361 gg~~~~~~~~~~~~~~~g~d~ev~L~vTLeEa~~G~~k~i~v~~~~~C~~C~GtG~~~g~~~~~C~~C~G~G~~~~~~G~  440 (644)
                                  ....+|.|+++.|.|||||+|+|++++|.+++.+.|                     |.|        
T Consensus       135 ------------~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~---------------------g~G--------  173 (329)
T 3lz8_A          135 ------------QHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN---------------------VFG--------  173 (329)
T ss_dssp             --------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC---------------------SCC--------
T ss_pred             ------------CCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec---------------------CCe--------
Confidence                        001357899999999999999999999999876522                     111        


Q ss_pred             ceeeeecCCCCceeEEEeeccccCCCCceeEEEEEEEEeeCCCCCCCCEEEEecCC---------ceEEEEEEeecCCCc
Q psy11884        441 FIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQ---------DQIFVTFQVIPSSRY  511 (644)
Q Consensus       441 ~~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~e~~~l~V~IPpGv~dG~~I~~~g~g---------gDL~v~i~vkph~~F  511 (644)
                                                ...+.+.++++|+||||+++|++|+|+|+|         |||+|+|+|+||+.|
T Consensus       174 --------------------------~v~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F  227 (329)
T 3lz8_A          174 --------------------------MIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLF  227 (329)
T ss_dssp             ---------------------------CCEEEEEEEEEEECTTCCTTCEEEESSCSCCC---CCCCCEEEEECCCCCSSC
T ss_pred             --------------------------EEEEecceEEEEeCCCCCCCCCEEEEcccccCCCCCCCCCcEEEEEEEecCCcc
Confidence                                      112334678999999999999999999742         699999999999999


Q ss_pred             cccCCCeEEEEecCHhHhhcCCEEEEEeeeCcEEEEEeCCCCCCCcEEEEcCCCcCCCCCCCCccEEEEEEEECCCCCCH
Q psy11884        512 HRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSE  591 (644)
Q Consensus       512 ~R~G~DL~~~~~Isl~eALlG~~~~I~tLdG~~l~V~IppG~~~g~~irI~GeG~P~~~~~~rGDL~V~f~V~fP~~Ls~  591 (644)
                      +|+|+||+++++|++++|+||++++|+||||+ +.|+||+|+++|++++|+|+|||..  ..+|||||+|+|+||+.|++
T Consensus       228 ~R~G~DL~~~~~Isl~eAllG~~v~VptLdG~-v~l~ip~gt~~g~~~rl~G~GmP~~--~~rGDL~v~~~V~~P~~l~~  304 (329)
T 3lz8_A          228 DIVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPGSQAGQRLRIKGKGLVSK--THTGDLFAVIKIVMPTKPDE  304 (329)
T ss_dssp             EEETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEEEECTTCCTTCEEEETTCSCBCS--SCBCCEEEEEEECCCSSCCH
T ss_pred             EEcCCcEEEEEECCHHHHcCCCeEEEECCCCC-EEEEECCCCCCCCEEEEcCCCCCCC--CCCCCEEEEEEEECCCCCCH
Confidence            99999999999999999999999999999998 4999999999999999999999976  46999999999999999999


Q ss_pred             HHHHHHHHHhh-hCC
Q psy11884        592 KQKDLVREFFS-VEP  605 (644)
Q Consensus       592 ~q~~lL~~l~~-~~~  605 (644)
                      +|+++|++|++ ...
T Consensus       305 ~q~~~l~~~~~~~~~  319 (329)
T 3lz8_A          305 KARELWQQLAAAEAS  319 (329)
T ss_dssp             HHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHhhccC
Confidence            99999999998 443
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 644
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-22
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 9e-22
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-21
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-19
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-19
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 5e-19
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 7e-19
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-15
d1c3ga290 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba 1e-14
d1exka_79 g.54.1.1 (A:) Cysteine-rich domain of the chaperon 8e-14
d1nlta280 b.4.1.1 (A:258-337) Mitochondrial protein import p 4e-13
d1nlta374 g.54.1.1 (A:139-212) Mitochondrial protein import 2e-11
d1m1qa_90 a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum 8e-09
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 8e-06
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 89.3 bits (221), Expect = 2e-22
 Identities = 38/68 (55%), Positives = 49/68 (72%)

Query: 203 RKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTK 262
           ++DYY+ILG+SK +  +EI+KAY  LA KYHPD N+ D  A  KF E+ EAYEVL+D  K
Sbjct: 2   KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQK 61

Query: 263 RQEYDTWG 270
           R  YD +G
Sbjct: 62  RAAYDQYG 69
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query644
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.86
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.83
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 99.78
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.72
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.69
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 99.59
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.57
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.53
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.5
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.47
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.34
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.27
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 99.2
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.18
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.8
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 97.44
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 97.23
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 97.15
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.95
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 95.98
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: HSP40/DnaJ peptide-binding domain
superfamily: HSP40/DnaJ peptide-binding domain
family: HSP40/DnaJ peptide-binding domain
domain: Heat shock protein 40 Sis1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.86  E-value=6.8e-23  Score=176.08  Aligned_cols=89  Identities=22%  Similarity=0.344  Sum_probs=84.3

Q ss_pred             CccccCCCeEEEEecCHhHhhcCCEEEEEeeeCcEEEEEeCCCCCCCcEEEEcCCCcCCC-CCCCCccEEEEEEEECCCC
Q psy11884        510 RYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNR-NSSGYGHHFVHVKIEVPRY  588 (644)
Q Consensus       510 ~F~R~G~DL~~~~~Isl~eALlG~~~~I~tLdG~~l~V~IppG~~~g~~irI~GeG~P~~-~~~~rGDL~V~f~V~fP~~  588 (644)
                      .|+|+|+||+++++|++.||++|++++|+|+||+.+.|++|+++++|++++|+|+|||.. +++.+|||||+|+|.+|++
T Consensus         1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i~ip~~~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~P~~   80 (90)
T d1c3ga2           1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPIS   80 (90)
T ss_dssp             SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEEEESSCCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBCCSS
T ss_pred             CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceecccccccccccccccCCCCCCcCCCCCCcCCEEEEEEEEcCCC
Confidence            489999999999999999999999999999999999999999999999999999999985 4457899999999999999


Q ss_pred             CCHHHHHHHH
Q psy11884        589 PSEKQKDLVR  598 (644)
Q Consensus       589 Ls~~q~~lL~  598 (644)
                      ||++|+++|+
T Consensus        81 ls~~qk~~lE   90 (90)
T d1c3ga2          81 LNDAQKRAID   90 (90)
T ss_dssp             CCTTHHHHTC
T ss_pred             CCHHHHHhhC
Confidence            9999999874
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure