Psyllid ID: psy11884
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 644 | ||||||
| 307204018 | 485 | Protein tumorous imaginal discs, mitocho | 0.572 | 0.760 | 0.509 | 1e-123 | |
| 322785350 | 543 | hypothetical protein SINV_09539 [Solenop | 0.586 | 0.696 | 0.488 | 1e-120 | |
| 380026912 | 520 | PREDICTED: protein tumorous imaginal dis | 0.572 | 0.709 | 0.511 | 1e-120 | |
| 383852683 | 522 | PREDICTED: protein tumorous imaginal dis | 0.600 | 0.741 | 0.484 | 1e-120 | |
| 328793508 | 520 | PREDICTED: protein tumorous imaginal dis | 0.572 | 0.709 | 0.511 | 1e-120 | |
| 332023854 | 479 | Protein tumorous imaginal discs, mitocho | 0.585 | 0.787 | 0.495 | 1e-120 | |
| 157128157 | 491 | chaperone protein dnaj [Aedes aegypti] g | 0.618 | 0.810 | 0.476 | 1e-119 | |
| 340720435 | 522 | PREDICTED: protein tumorous imaginal dis | 0.599 | 0.739 | 0.487 | 1e-119 | |
| 307180424 | 519 | Protein tumorous imaginal discs, mitocho | 0.625 | 0.776 | 0.470 | 1e-119 | |
| 350410070 | 529 | PREDICTED: protein tumorous imaginal dis | 0.596 | 0.725 | 0.480 | 1e-118 |
| >gi|307204018|gb|EFN82922.1| Protein tumorous imaginal discs, mitochondrial [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 450 bits (1157), Expect = e-123, Method: Compositional matrix adjust.
Identities = 213/418 (50%), Positives = 290/418 (69%), Gaps = 49/418 (11%)
Query: 193 HTSPSLSN-LKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVS 251
H S L+N L +++YY+ILG+SKN+SAK+IKKAYYELAKKYHPDTNK DPN +KF EVS
Sbjct: 69 HRSIYLTNKLLKRNYYEILGVSKNASAKDIKKAYYELAKKYHPDTNKGDPNTGRKFQEVS 128
Query: 252 EAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFG 311
EAYEVLSD++KR+EYDTWGATSEQM G + A++Y H W ++S+++ EELFRKIFG
Sbjct: 129 EAYEVLSDESKRKEYDTWGATSEQMGMGGMGQK--AKNYNH-WQYRSTINAEELFRKIFG 185
Query: 312 DTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFI 371
D GF G ++F
Sbjct: 186 DAGFQ--------------------------------------------SGAFTDFDDFA 201
Query: 372 ANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGS 431
+KYGFG++QE+I+ + F AARG K++D+NVID+CPKC G+RCELGTK +C YC G+
Sbjct: 202 ESKYGFGAAQEIIMNLTFSQAARGINKDIDINVIDVCPKCDGSRCELGTKPGKCFYCNGT 261
Query: 432 GYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIR 491
G ET +TGPF+M +TCRYC G+ +YIKFPC NCDG GQ +QR+ V++P+P G+EDGQTIR
Sbjct: 262 GVETISTGPFVMSSTCRYCQGTRVYIKFPCNNCDGKGQAVQRKRVTVPVPAGVEDGQTIR 321
Query: 492 FPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQP 551
+G+ ++FVTF+V S + RD +D+HT+ IS++QAILGGTI VEG+Y D +++I P
Sbjct: 322 LAVGRKEVFVTFRVEKSRYFRRDGADVHTDAEISLAQAILGGTIRVEGVYEDQ-TIQIAP 380
Query: 552 GTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNG 609
GTSSHT++++ KGLK N GYG H+V++KI VP+ ++KQ+ L++ + +E +T G
Sbjct: 381 GTSSHTRVRLSGKGLKKINGVGYGDHYVNIKITVPKKLTDKQQALLQAYAELETDTPG 438
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322785350|gb|EFZ12024.1| hypothetical protein SINV_09539 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|380026912|ref|XP_003697183.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383852683|ref|XP_003701855.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328793508|ref|XP_394833.2| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|332023854|gb|EGI64078.1| Protein tumorous imaginal discs, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|157128157|ref|XP_001661333.1| chaperone protein dnaj [Aedes aegypti] gi|108872682|gb|EAT36907.1| AAEL011055-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|340720435|ref|XP_003398644.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307180424|gb|EFN68450.1| Protein tumorous imaginal discs, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|350410070|ref|XP_003488936.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 644 | ||||||
| UNIPROTKB|G3V9U3 | 453 | Dnaja3 "Protein Dnaja3" [Rattu | 0.392 | 0.558 | 0.432 | 1e-90 | |
| RGD|1306527 | 480 | Dnaja3 "DnaJ (Hsp40) homolog, | 0.392 | 0.527 | 0.432 | 1.3e-90 | |
| UNIPROTKB|G3V6I5 | 480 | Dnaja3 "RCG49803, isoform CRA_ | 0.392 | 0.527 | 0.432 | 1.3e-90 | |
| UNIPROTKB|I3LLG4 | 476 | DNAJA3 "Uncharacterized protei | 0.389 | 0.527 | 0.431 | 7.1e-90 | |
| MGI|MGI:1933786 | 480 | Dnaja3 "DnaJ (Hsp40) homolog, | 0.392 | 0.527 | 0.436 | 1.2e-89 | |
| ZFIN|ZDB-GENE-030131-7837 | 453 | dnaja3a "DnaJ (Hsp40) homolog, | 0.380 | 0.540 | 0.414 | 3.5e-88 | |
| ZFIN|ZDB-GENE-040115-3 | 474 | dnaja3b "DnaJ (Hsp40) homolog, | 0.360 | 0.489 | 0.437 | 2.4e-87 | |
| WB|WBGene00001028 | 456 | dnj-10 [Caenorhabditis elegans | 0.383 | 0.541 | 0.422 | 9.2e-86 | |
| UNIPROTKB|E9PSW5 | 429 | Dnaja3 "Protein Dnaja3" [Rattu | 0.291 | 0.438 | 0.439 | 3.5e-76 | |
| FB|FBgn0002174 | 520 | l(2)tid "lethal (2) tumorous i | 0.391 | 0.484 | 0.477 | 3e-69 |
| UNIPROTKB|G3V9U3 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 580 (209.2 bits), Expect = 1.0e-90, Sum P(2) = 1.0e-90
Identities = 112/259 (43%), Positives = 162/259 (62%)
Query: 369 EFIANKYG-----FGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSV 423
EF ++ +G F QE I+++ F AA+G KE VN++D C +C G E GTK
Sbjct: 192 EFSSSPFGDFQNVFDQPQEYIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQ 251
Query: 424 RCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQG 483
C YC GSG ET TGPF+M++TCR C G G I PC C G GQ Q++ V++P+P G
Sbjct: 252 HCHYCSGSGMETINTGPFVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTVPVPAG 311
Query: 484 IEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGD 543
+EDGQT+R P+G+ +IFVTF+V S + RD +DIH++ ISI+QAILGGT +G+Y +
Sbjct: 312 VEDGQTVRMPVGKREIFVTFRVQKSPVFRRDGADIHSDLFISIAQAILGGTAKAQGLY-E 370
Query: 544 TLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSV 603
T++V I G + KI++ KG+ NS GYG H++H+KI VP+ S +Q++L+ +
Sbjct: 371 TINVTIPAGIQTDQKIRLTGKGIPRINSYGYGDHYIHIKIRVPKRLSSRQQNLILSYAED 430
Query: 604 EPNTNGNKDDSNQALSGYR 622
E + G + +G R
Sbjct: 431 ETDVEGTVNGVTHTSTGKR 449
|
|
| RGD|1306527 Dnaja3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6I5 Dnaja3 "RCG49803, isoform CRA_a" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLG4 DNAJA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1933786 Dnaja3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7837 dnaja3a "DnaJ (Hsp40) homolog, subfamily A, member 3A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040115-3 dnaja3b "DnaJ (Hsp40) homolog, subfamily A, member 3B" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001028 dnj-10 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSW5 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002174 l(2)tid "lethal (2) tumorous imaginal discs" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 644 | |||
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 2e-87 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 6e-87 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 7e-72 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 2e-70 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 1e-69 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 2e-69 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 2e-67 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 3e-57 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 3e-55 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-55 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 5e-55 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-54 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 3e-53 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 1e-52 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 9e-51 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 3e-49 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-48 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 6e-43 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 3e-42 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 5e-42 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 6e-42 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 7e-40 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 1e-33 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 6e-33 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 4e-32 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-30 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 5e-30 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 5e-28 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 3e-26 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 4e-25 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 8e-25 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 2e-24 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 4e-24 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 4e-24 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 6e-24 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 7e-22 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-21 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 3e-21 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 2e-20 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 3e-20 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 3e-19 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-18 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 2e-18 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 5e-18 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 3e-16 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 2e-10 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 3e-08 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-08 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 8e-06 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 2e-05 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 6e-05 | |
| PRK01356 | 166 | PRK01356, hscB, co-chaperone HscB; Provisional | 1e-04 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 0.002 | |
| TIGR00714 | 155 | TIGR00714, hscB, Fe-S protein assembly co-chaperon | 0.002 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 0.003 |
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
Score = 276 bits (707), Expect = 2e-87
Identities = 133/412 (32%), Positives = 188/412 (45%), Gaps = 74/412 (17%)
Query: 205 DYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQ 264
DYY+ILG+SK++S +EIKKAY +LAKKYHPD NK D A +KF E++EAYEVLSD KR
Sbjct: 1 DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNK-DKEAEEKFKEINEAYEVLSDPEKRA 59
Query: 265 EYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEF 324
+YD +G G D F D ++F FG G
Sbjct: 60 QYDQFGHAGFNGGGGGGGGGFNGFD---IGFFG---DFGDIFGDFFGGGG---------- 103
Query: 325 IANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEVI 384
G G + + P G
Sbjct: 104 -----GSGRRR----------RSGPRR--------------------------GEDLRYD 122
Query: 385 LKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGP---- 440
L++ FE A G KE+++ + C C GT + GT C C G+G G
Sbjct: 123 LELTFEEAVFGVEKEIEIPRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRRQQGTPFGF 182
Query: 441 FIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQ-- 498
F + TC C G G IK PC C G G+ +R+T+++ IP G++ GQ +R G+
Sbjct: 183 FQQQQTCPTCGGEGKIIKEPCSTCKGKGRVKERKTITVKIPAGVDTGQRLRVS-GKGNAG 241
Query: 499 --------IFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQ 550
++V +V P + RD +D++ E IS +QAILGG I V + GD ++I
Sbjct: 242 ENGGPNGDLYVVIRVKPHKIFERDGNDLYIEVPISFTQAILGGEIEVPTLDGDV-KLKIP 300
Query: 551 PGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFS 602
GT S T ++ KG+ +G G V VK+E P+ S++QK+L+ E
Sbjct: 301 AGTQSGTVFRLKGKGVPRLRGNGRGDLLVTVKVETPKNLSKEQKELLEELAE 352
|
This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 644 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712|consensus | 337 | 100.0 | ||
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| KOG0715|consensus | 288 | 100.0 | ||
| KOG0713|consensus | 336 | 100.0 | ||
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 100.0 | |
| KOG0714|consensus | 306 | 99.82 | ||
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.78 | |
| KOG0716|consensus | 279 | 99.68 | ||
| KOG0691|consensus | 296 | 99.64 | ||
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.63 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.61 | |
| KOG0718|consensus | 546 | 99.6 | ||
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.59 | |
| KOG0717|consensus | 508 | 99.57 | ||
| PHA03102 | 153 | Small T antigen; Reviewed | 99.54 | |
| KOG0624|consensus | 504 | 99.53 | ||
| KOG0719|consensus | 264 | 99.52 | ||
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.52 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.48 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.44 | |
| KOG0721|consensus | 230 | 99.44 | ||
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.33 | |
| KOG0550|consensus | 486 | 99.32 | ||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.32 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.31 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 99.29 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.27 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.27 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.26 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.24 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.23 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.21 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.21 | |
| KOG0722|consensus | 329 | 99.2 | ||
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.2 | |
| KOG0720|consensus | 490 | 99.2 | ||
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.19 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.18 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.18 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.18 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.17 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.17 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.16 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.16 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.16 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.16 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.15 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.15 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.15 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.15 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.14 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.14 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.13 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.09 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.09 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.08 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.04 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.0 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.98 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 98.92 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.87 | |
| KOG1150|consensus | 250 | 98.8 | ||
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 98.78 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 98.62 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 98.6 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.6 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.56 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.33 | |
| KOG0568|consensus | 342 | 98.11 | ||
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 98.09 | |
| KOG1789|consensus | 2235 | 97.93 | ||
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 97.74 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 97.66 | |
| KOG0723|consensus | 112 | 97.64 | ||
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.55 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 97.28 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 97.11 | |
| KOG0712|consensus | 337 | 97.1 | ||
| KOG0715|consensus | 288 | 96.22 | ||
| KOG2813|consensus | 406 | 95.96 | ||
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 95.94 | |
| KOG2813|consensus | 406 | 95.92 | ||
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 95.85 | |
| KOG3192|consensus | 168 | 94.93 | ||
| KOG0431|consensus | 453 | 93.58 | ||
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 90.81 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 90.09 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 89.49 | |
| KOG2824|consensus | 281 | 86.81 | ||
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 81.24 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-85 Score=692.97 Aligned_cols=358 Identities=37% Similarity=0.638 Sum_probs=314.6
Q ss_pred CccChhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHhhhhhhhhcCcccccccccccCCccccccccCC
Q psy11884 202 KRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGA 281 (644)
Q Consensus 202 ~~~d~Y~vLGv~~~as~~eIKkaYRkLa~~~HPDk~~~~~~a~e~f~~I~~AYevLsd~~kR~~YD~~G~~~~~~~~~g~ 281 (644)
+.+|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|++||||||||+||++||+||.++.+.+++++
T Consensus 2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg 81 (371)
T COG0484 2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGG 81 (371)
T ss_pred CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCC
Confidence 56899999999999999999999999999999999998899999999999999999999999999999998886332211
Q ss_pred CCCCCccccccccCCCCCCChHHHHHhhhCCCCCCcchhhHHHhhccCCCCCchhhhhhhhhccccCcchhhcccccccC
Q psy11884 282 SRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIG 361 (644)
Q Consensus 282 ~~~~~~~~f~~~~~~~~~~d~~dlF~~fFG~~~f~~~~~~~~~~~~~~~f~~s~~~~~~~~k~~~~~p~~~~~qr~~~~g 361 (644)
. ++.+| .+ |+.|||++|||+++++ ...
T Consensus 82 ~---g~~~f------gg--~~~DIF~~~FgGg~~~-------------~~~----------------------------- 108 (371)
T COG0484 82 F---GFGGF------GG--DFGDIFEDFFGGGGGG-------------RRR----------------------------- 108 (371)
T ss_pred C---CcCCC------CC--CHHHHHHHhhcCCCcc-------------cCC-----------------------------
Confidence 1 11111 11 7899999999743211 000
Q ss_pred CccchhhhhhhccCCCCCceEEEEecCHHHHhcCceEEEEeeeeecCCCCCcccccCCCccccCCCCCCcceEEeee--c
Q psy11884 362 GISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTT--G 439 (644)
Q Consensus 362 g~~~~~~~~~~~~~~~g~d~ev~L~vTLeEa~~G~~k~i~v~~~~~C~~C~GtG~~~g~~~~~C~~C~G~G~~~~~~--G 439 (644)
.+...+|.|+.+.|+|||||||.|++++|.+++...|+.|+|+|+++++...+|+.|+|+|.+.+.. |
T Consensus 109 ----------~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC~tC~G~G~v~~~~~~g 178 (371)
T COG0484 109 ----------PNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTG 178 (371)
T ss_pred ----------CCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCcCCCCCCcCeEEEEEeee
Confidence 0012468899999999999999999999999999999999999999999999999999999876555 8
Q ss_pred CceeeeecCCCCceeEEEeeccccCCCCceeEEEEEEEEeeCCCCCCCCEEEEecCC---------ceEEEEEEeecCCC
Q psy11884 440 PFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQ---------DQIFVTFQVIPSSR 510 (644)
Q Consensus 440 ~~~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~e~~~l~V~IPpGv~dG~~I~~~g~g---------gDL~v~i~vkph~~ 510 (644)
.+.++++|+.|+|+|++|+++|+.|+|.|++.+.++++|+||||+.+|++|+++++| |||||.|.|++|+.
T Consensus 179 ~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~~Ggp~GDLyv~i~v~~h~~ 258 (371)
T COG0484 179 FFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGPNGGPAGDLYVFVHVKPHPI 258 (371)
T ss_pred EEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCCCCCCCccEEEEEEeecCCC
Confidence 788999999999999999999999999999999999999999999999999999743 79999999999999
Q ss_pred ccccCCCeEEEEecCHhHhhcCCEEEEEeeeCcEEEEEeCCCCCCCcEEEEcCCCcCCCCCCCCccEEEEEEEECCCCCC
Q psy11884 511 YHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPS 590 (644)
Q Consensus 511 F~R~G~DL~~~~~Isl~eALlG~~~~I~tLdG~~l~V~IppG~~~g~~irI~GeG~P~~~~~~rGDL~V~f~V~fP~~Ls 590 (644)
|+|+|+||+++++|++.+|++|+++.|+||||+ ++|+||+|+++|++++|+|+|||..++..+|||||+|+|++|++|+
T Consensus 259 F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g~-~~l~ip~Gtq~G~~~rl~gkG~p~~~~~~~GDl~v~v~v~~P~~ls 337 (371)
T COG0484 259 FERDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKLKIPAGTQTGEVFRLRGKGMPKLRSGGRGDLYVRVKVETPKNLS 337 (371)
T ss_pred eEECCCceEeccccCHHHHhcCCEEEEEecCCC-EEEecCCCCccCcEEEEcCCCccccCCCCcCCEEEEEEEEcCCCCC
Confidence 999999999999999999999999999999999 7999999999999999999999997777889999999999999999
Q ss_pred HHHHHHHHHHhhhCCCCCCCCCCCCccccCccchhhhhHHHHHHHH
Q psy11884 591 EKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDIFLFFSRLIDFIK 636 (644)
Q Consensus 591 ~~q~~lL~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 636 (644)
.+|++||++|+....+ ... +...||++||+|.+
T Consensus 338 ~~q~~lL~~~~~~~~~--~~~-----------~~~~~~~k~k~~f~ 370 (371)
T COG0484 338 DEQKELLEEFAKSLGE--GPE-----------QSPGFFDKLKNFFK 370 (371)
T ss_pred HHHHHHHHHHHHhhcc--ccc-----------cChhhhHHhHhhcc
Confidence 9999999999975411 111 11189999988854
|
|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712|consensus | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0715|consensus | Back alignment and domain information |
|---|
| >KOG0713|consensus | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0714|consensus | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >KOG0716|consensus | Back alignment and domain information |
|---|
| >KOG0691|consensus | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0718|consensus | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0624|consensus | Back alignment and domain information |
|---|
| >KOG0719|consensus | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721|consensus | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0550|consensus | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0722|consensus | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0720|consensus | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1150|consensus | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568|consensus | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >KOG1789|consensus | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0723|consensus | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >KOG0712|consensus | Back alignment and domain information |
|---|
| >KOG0715|consensus | Back alignment and domain information |
|---|
| >KOG2813|consensus | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >KOG2813|consensus | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3192|consensus | Back alignment and domain information |
|---|
| >KOG0431|consensus | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >KOG2824|consensus | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 644 | ||||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 1e-22 | ||
| 2ctt_A | 104 | Solution Structure Of Zinc Finger Domain From Human | 3e-18 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 7e-17 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 7e-17 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 3e-16 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 4e-16 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 3e-14 | ||
| 1nlt_A | 248 | The Crystal Structure Of Hsp40 Ydj1 Length = 248 | 4e-14 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 4e-14 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 2e-13 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 3e-13 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 3e-13 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 6e-07 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 4e-13 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 4e-13 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 6e-13 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 8e-13 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 2e-12 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 3e-12 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 4e-12 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 7e-12 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 7e-10 | ||
| 1exk_A | 79 | Solution Structure Of The Cysteine-Rich Domain Of T | 1e-08 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 3e-08 | ||
| 2l6l_A | 155 | Solution Structure Of Human J-Protein Co-Chaperone, | 2e-07 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 1e-06 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 1e-06 | ||
| 3agx_A | 181 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 8e-06 | ||
| 1wjz_A | 94 | Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P | 9e-06 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-05 | ||
| 2qld_A | 183 | Human Hsp40 Hdj1 Length = 183 | 9e-05 | ||
| 3agz_A | 190 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 1e-04 | ||
| 2qsa_A | 109 | Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 | 3e-04 |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
|
| >pdb|2CTT|A Chain A, Solution Structure Of Zinc Finger Domain From Human Dnaj Subfamily A Menber 3 Length = 104 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|1EXK|A Chain A, Solution Structure Of The Cysteine-Rich Domain Of The Escherichia Coli Chaperone Protein Dnaj Length = 79 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 | Back alignment and structure |
| >pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 | Back alignment and structure |
| >pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 | Back alignment and structure |
| >pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 644 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 8e-65 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 4e-47 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 1e-36 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 4e-35 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 2e-33 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 4e-33 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 2e-32 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-32 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 2e-32 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 4e-32 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 4e-32 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 8e-32 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 9e-32 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 2e-31 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 4e-31 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 5e-31 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 3e-30 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 7e-30 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 1e-29 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 6e-29 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 2e-27 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 4e-26 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 1e-25 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 1e-24 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 2e-24 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 1e-23 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 1e-23 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 6e-23 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-22 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 3e-21 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 5e-18 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 2e-17 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 3e-17 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 4e-17 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 5e-17 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 5e-16 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 1e-15 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 4e-14 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 5e-13 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 3e-11 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 3e-10 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-05 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
Score = 215 bits (550), Expect = 8e-65
Identities = 74/415 (17%), Positives = 138/415 (33%), Gaps = 131/415 (31%)
Query: 204 KDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKR 263
KDYY ILG+ K IK AY LA+KYHPD +K + +A KF +++EA+EVL D+ +R
Sbjct: 28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSK-ENDAEAKFKDLAEAWEVLKDEQRR 86
Query: 264 QEYDTWGATSEQMSAAGASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEE 323
EYD ++ + DF ++
Sbjct: 87 AEYDQLWQHRNDPGFGRQRQTHE-----------------------QSYSQQDF----DD 119
Query: 324 FIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCIGGISITEEEFIANKYGFGSSQEV 383
++ +G + Q G E+
Sbjct: 120 IFSSMFGQQAHQ-------------------------RR---------RQHAARGHDLEI 145
Query: 384 ILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIM 443
+ + E + + N G
Sbjct: 146 EVAVFLEETLAEQTRTISYN--LPVYNVFGM----------------------------- 174
Query: 444 KTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQ----- 498
++ +T+++ IP G+ DGQ IR GQ
Sbjct: 175 ------------------------IESETPKTLNVKIPAGVVDGQRIRLK-GQGTPGENG 209
Query: 499 -----IFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGT 553
+++ + P + ++ ++ +A LG + V + ++ + + PG+
Sbjct: 210 GPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKE-SILLTVPPGS 268
Query: 554 SSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTN 608
+ +++I KGL ++ G F +KI +P P EK ++L ++ + E + +
Sbjct: 269 QAGQRLRIKGKGLVSKT--HTGDLFAVIKIVMPTKPDEKARELWQQLAAAEASFD 321
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 644 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 100.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 100.0 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 100.0 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 100.0 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.91 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.87 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.82 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.81 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.78 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.77 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.77 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.77 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.75 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.75 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.75 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.74 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.74 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.73 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.73 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.73 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.72 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.71 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.66 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.65 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.63 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.61 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.58 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.57 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.57 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.55 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.52 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.51 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.5 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.49 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.47 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.46 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.45 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 99.42 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.42 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.4 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.21 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.7 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.64 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 98.64 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 98.63 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 98.56 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 98.54 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 97.61 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 97.55 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.48 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 97.28 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 97.04 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 97.04 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 96.73 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 95.14 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 94.82 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-57 Score=478.53 Aligned_cols=285 Identities=26% Similarity=0.470 Sum_probs=153.1
Q ss_pred CCccChhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHhhhhhhhhcCcccccccccccCCccccccccC
Q psy11884 201 LKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAG 280 (644)
Q Consensus 201 ~~~~d~Y~vLGv~~~as~~eIKkaYRkLa~~~HPDk~~~~~~a~e~f~~I~~AYevLsd~~kR~~YD~~G~~~~~~~~~g 280 (644)
+..+|||++|||+++||.+|||+|||+||++||||+++. +.|+++|++|++||++|+||.+|+.||+++......++.+
T Consensus 25 m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~-~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~ 103 (329)
T 3lz8_A 25 MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKE-NDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGR 103 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred ccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCC-hHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccc
Confidence 356899999999999999999999999999999999975 5889999999999999999999999999854322111100
Q ss_pred CCCCCCccccccccCCCCCCChHHHHHhhhCCCCCCcchhhHHHhhccCCCCCchhhhhhhhhccccCcchhhccccccc
Q psy11884 281 ASRSTTAEDYMHRWNFKSSVDPEELFRKIFGDTGFDFKVTEEEFIANKYGFGSSQEVILKIDKCLQQVPVDLQLQRTTCI 360 (644)
Q Consensus 281 ~~~~~~~~~f~~~~~~~~~~d~~dlF~~fFG~~~f~~~~~~~~~~~~~~~f~~s~~~~~~~~k~~~~~p~~~~~qr~~~~ 360 (644)
+.+....+ |. ..+++|+|++|||+++.. . +.
T Consensus 104 -~~~~~~~~------f~-~~~f~diF~~~Fg~~g~~-----------~---~~--------------------------- 134 (329)
T 3lz8_A 104 -QRQTHEQS------YS-QQDFDDIFSSMFGQQAHQ-----------R---RR--------------------------- 134 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred -ccccccCC------cC-CCchhhhhHhhhcCcCCC-----------C---CC---------------------------
Confidence 00000001 11 125678899998752111 0 00
Q ss_pred CCccchhhhhhhccCCCCCceEEEEecCHHHHhcCceEEEEeeeeecCCCCCcccccCCCccccCCCCCCcceEEeeecC
Q psy11884 361 GGISITEEEFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGP 440 (644)
Q Consensus 361 gg~~~~~~~~~~~~~~~g~d~ev~L~vTLeEa~~G~~k~i~v~~~~~C~~C~GtG~~~g~~~~~C~~C~G~G~~~~~~G~ 440 (644)
....+|.|+++.|.|||||+|+|++++|.+++.+.| |.|
T Consensus 135 ------------~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~---------------------g~G-------- 173 (329)
T 3lz8_A 135 ------------QHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN---------------------VFG-------- 173 (329)
T ss_dssp --------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC---------------------SCC--------
T ss_pred ------------CCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec---------------------CCe--------
Confidence 001357899999999999999999999999876522 111
Q ss_pred ceeeeecCCCCceeEEEeeccccCCCCceeEEEEEEEEeeCCCCCCCCEEEEecCC---------ceEEEEEEeecCCCc
Q psy11884 441 FIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQ---------DQIFVTFQVIPSSRY 511 (644)
Q Consensus 441 ~~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~e~~~l~V~IPpGv~dG~~I~~~g~g---------gDL~v~i~vkph~~F 511 (644)
...+.+.++++|+||||+++|++|+|+|+| |||+|+|+|+||+.|
T Consensus 174 --------------------------~v~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F 227 (329)
T 3lz8_A 174 --------------------------MIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLF 227 (329)
T ss_dssp ---------------------------CCEEEEEEEEEEECTTCCTTCEEEESSCSCCC---CCCCCEEEEECCCCCSSC
T ss_pred --------------------------EEEEecceEEEEeCCCCCCCCCEEEEcccccCCCCCCCCCcEEEEEEEecCCcc
Confidence 112334678999999999999999999742 699999999999999
Q ss_pred cccCCCeEEEEecCHhHhhcCCEEEEEeeeCcEEEEEeCCCCCCCcEEEEcCCCcCCCCCCCCccEEEEEEEECCCCCCH
Q psy11884 512 HRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSE 591 (644)
Q Consensus 512 ~R~G~DL~~~~~Isl~eALlG~~~~I~tLdG~~l~V~IppG~~~g~~irI~GeG~P~~~~~~rGDL~V~f~V~fP~~Ls~ 591 (644)
+|+|+||+++++|++++|+||++++|+||||+ +.|+||+|+++|++++|+|+|||.. ..+|||||+|+|+||+.|++
T Consensus 228 ~R~G~DL~~~~~Isl~eAllG~~v~VptLdG~-v~l~ip~gt~~g~~~rl~G~GmP~~--~~rGDL~v~~~V~~P~~l~~ 304 (329)
T 3lz8_A 228 DIVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPGSQAGQRLRIKGKGLVSK--THTGDLFAVIKIVMPTKPDE 304 (329)
T ss_dssp EEETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEEEECTTCCTTCEEEETTCSCBCS--SCBCCEEEEEEECCCSSCCH
T ss_pred EEcCCcEEEEEECCHHHHcCCCeEEEECCCCC-EEEEECCCCCCCCEEEEcCCCCCCC--CCCCCEEEEEEEECCCCCCH
Confidence 99999999999999999999999999999998 4999999999999999999999976 46999999999999999999
Q ss_pred HHHHHHHHHhh-hCC
Q psy11884 592 KQKDLVREFFS-VEP 605 (644)
Q Consensus 592 ~q~~lL~~l~~-~~~ 605 (644)
+|+++|++|++ ...
T Consensus 305 ~q~~~l~~~~~~~~~ 319 (329)
T 3lz8_A 305 KARELWQQLAAAEAS 319 (329)
T ss_dssp HHHHHHHHHHHHTTT
T ss_pred HHHHHHHHHHhhccC
Confidence 99999999998 443
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 644 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 2e-22 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 9e-22 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 7e-21 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 1e-19 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 3e-19 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 5e-19 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 7e-19 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-15 | |
| d1c3ga2 | 90 | b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba | 1e-14 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 8e-14 | |
| d1nlta2 | 80 | b.4.1.1 (A:258-337) Mitochondrial protein import p | 4e-13 | |
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 2e-11 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 8e-09 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 8e-06 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 89.3 bits (221), Expect = 2e-22
Identities = 38/68 (55%), Positives = 49/68 (72%)
Query: 203 RKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTK 262
++DYY+ILG+SK + +EI+KAY LA KYHPD N+ D A KF E+ EAYEVL+D K
Sbjct: 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQK 61
Query: 263 RQEYDTWG 270
R YD +G
Sbjct: 62 RAAYDQYG 69
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 644 | |||
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.86 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.83 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.78 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.72 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.69 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 99.59 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.57 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.53 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.5 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.47 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.34 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.27 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.2 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.18 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.8 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 97.44 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 97.23 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 97.15 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 96.95 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 95.98 |
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: HSP40/DnaJ peptide-binding domain superfamily: HSP40/DnaJ peptide-binding domain family: HSP40/DnaJ peptide-binding domain domain: Heat shock protein 40 Sis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.86 E-value=6.8e-23 Score=176.08 Aligned_cols=89 Identities=22% Similarity=0.344 Sum_probs=84.3
Q ss_pred CccccCCCeEEEEecCHhHhhcCCEEEEEeeeCcEEEEEeCCCCCCCcEEEEcCCCcCCC-CCCCCccEEEEEEEECCCC
Q psy11884 510 RYHRDQSDIHTEESISISQAILGGTINVEGIYGDTLSVEIQPGTSSHTKIKIPYKGLKNR-NSSGYGHHFVHVKIEVPRY 588 (644)
Q Consensus 510 ~F~R~G~DL~~~~~Isl~eALlG~~~~I~tLdG~~l~V~IppG~~~g~~irI~GeG~P~~-~~~~rGDL~V~f~V~fP~~ 588 (644)
.|+|+|+||+++++|++.||++|++++|+|+||+.+.|++|+++++|++++|+|+|||.. +++.+|||||+|+|.+|++
T Consensus 1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i~ip~~~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~P~~ 80 (90)
T d1c3ga2 1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPIS 80 (90)
T ss_dssp SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEEEESSCCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBCCSS
T ss_pred CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceecccccccccccccccCCCCCCcCCCCCCcCCEEEEEEEEcCCC
Confidence 489999999999999999999999999999999999999999999999999999999985 4457899999999999999
Q ss_pred CCHHHHHHHH
Q psy11884 589 PSEKQKDLVR 598 (644)
Q Consensus 589 Ls~~q~~lL~ 598 (644)
||++|+++|+
T Consensus 81 ls~~qk~~lE 90 (90)
T d1c3ga2 81 LNDAQKRAID 90 (90)
T ss_dssp CCTTHHHHTC
T ss_pred CCHHHHHhhC
Confidence 9999999874
|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|