Psyllid ID: psy1221
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 690 | 2.2.26 [Sep-21-2011] | |||||||
| Q6AXC6 | 880 | Probable ATP-dependent RN | yes | N/A | 0.389 | 0.305 | 0.404 | 9e-66 | |
| Q96FC9 | 970 | Probable ATP-dependent RN | no | N/A | 0.386 | 0.275 | 0.417 | 9e-66 | |
| Q92771 | 950 | Putative ATP-dependent RN | no | N/A | 0.386 | 0.281 | 0.417 | 3e-65 | |
| A8MPP1 | 907 | Putative ATP-dependent RN | yes | N/A | 0.385 | 0.293 | 0.403 | 4e-62 | |
| Q5R4R2 | 509 | Histidine--tRNA ligase, c | no | N/A | 0.247 | 0.335 | 0.572 | 4e-52 | |
| Q61035 | 509 | Histidine--tRNA ligase, c | no | N/A | 0.247 | 0.335 | 0.562 | 1e-51 | |
| P12081 | 509 | Histidine--tRNA ligase, c | no | N/A | 0.247 | 0.335 | 0.562 | 2e-51 | |
| Q2KI84 | 509 | Histidine--tRNA ligase, c | yes | N/A | 0.247 | 0.335 | 0.567 | 2e-51 | |
| Q5R5E5 | 506 | Probable histidine--tRNA | no | N/A | 0.271 | 0.369 | 0.502 | 7e-49 | |
| P49590 | 506 | Probable histidine--tRNA | no | N/A | 0.271 | 0.369 | 0.502 | 8e-49 |
| >sp|Q6AXC6|DDX11_MOUSE Probable ATP-dependent RNA helicase DDX11 OS=Mus musculus GN=Ddx11 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 252 bits (643), Expect = 9e-66, Method: Compositional matrix adjust.
Identities = 118/292 (40%), Positives = 187/292 (64%), Gaps = 23/292 (7%)
Query: 399 MPDIEKTQEKPKLSGLQSFLKGVQENNPNLSKPSEGGIEEAPSQVQEDQVR--NPMLSVV 456
+P + +QE L+G Q FLK +Q G E++P + Q +R +P++ +
Sbjct: 490 LPSLSDSQENRGLAGFQQFLKSLQS----------GPTEDSPEEGQAVALRPASPLMHIE 539
Query: 457 TFLESLVNKNEDGRILVTKNPELSKSHIKYILLNPANHFTDIVQDARSIIVAGGTMEPVS 516
FL +L N+DGR++V + + +S +K++LLNPA HF +V++ R++++AGGTM+P+S
Sbjct: 540 AFLAALTTANQDGRVIVNRQGSVGQSSLKFLLLNPAVHFAQVVKECRAVVIAGGTMQPMS 599
Query: 517 EFKDQLFGSLGVPESRIHHFSCGHVIPKENILPLILCSGPTNRKFDLTFENRTKGDTLKE 576
+F++QL GV R+ FSCGHVIP +NILPLI+CSGP+N++ + T++ R ++E
Sbjct: 600 DFREQLLACSGVEAGRVVEFSCGHVIPPDNILPLIICSGPSNQQLEFTYQRRELPQMVEE 659
Query: 577 IAMTITNLCTIVPKGMVCFFPSYDYEAIVYNYMRDNHFIERIARIAKKKVVFREPKKTSE 636
+ NLC +VP G+VCF PSY+Y V+ + + R++ +K +F+EPK+ S+
Sbjct: 660 TGRILCNLCNVVPGGVVCFLPSYEYLRQVHAHWDKTGL---LTRLSVRKKIFQEPKRASQ 716
Query: 637 VDKVLSDYGTSVEK--------GGALMLSVIGGKLSEGLNFSDDLGRCVVVM 680
V++VL Y + GAL+LSV+GGK+SEG+NFSDDLGRCVV++
Sbjct: 717 VEQVLMAYSKCIMSCSHSEGHLTGALLLSVVGGKMSEGINFSDDLGRCVVMV 768
|
DNA helicase involved in cellular proliferation. Possesses DNA-dependent ATPase and helicase activities. This helicase translocates on single-stranded DNA in the 5' to 3' direction in the presence of ATP and, to a lesser extent, dATP. Its unwinding activity requires a 5'-single-stranded region for helicase loading, since flush-ended duplex structures do not support unwinding. The helicase activity is capable of displacing duplex regions up to 100 bp, which can be extended to 500 bp by RPA or the cohesion establishment factor, the Ctf18-RFC (replication factor C) complex activities. Stimulates the flap endonuclease activity of FEN1. Required for normal sister chromatid cohesion. Required for maintaining the chromosome segregation and is essential for embryonic development and the prevention of aneuploidy. May function during either S, G2, or M phase of the cell cycle. Binds to both single- and double-stranded DNA. Mus musculus (taxid: 10090) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3 |
| >sp|Q96FC9|DDX11_HUMAN Probable ATP-dependent RNA helicase DDX11 OS=Homo sapiens GN=DDX11 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q92771|DDX12_HUMAN Putative ATP-dependent RNA helicase DDX12 OS=Homo sapiens GN=DDX12P PE=5 SV=3 | Back alignment and function description |
|---|
| >sp|A8MPP1|D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens GN=DDX11L8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R4R2|SYHC_PONAB Histidine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=HARS PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q61035|SYHC_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Hars PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P12081|SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q2KI84|SYHC_BOVIN Histidine--tRNA ligase, cytoplasmic OS=Bos taurus GN=HARS PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R5E5|SYHM_PONAB Probable histidine--tRNA ligase, mitochondrial OS=Pongo abelii GN=HARS2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P49590|SYHM_HUMAN Probable histidine--tRNA ligase, mitochondrial OS=Homo sapiens GN=HARS2 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 690 | ||||||
| 193608349 | 890 | PREDICTED: probable ATP-dependent RNA he | 0.405 | 0.314 | 0.506 | 1e-76 | |
| 363728123 | 941 | PREDICTED: DEAD/H (Asp-Glu-Ala-Asp/His) | 0.4 | 0.293 | 0.438 | 8e-72 | |
| 326912321 | 896 | PREDICTED: putative ATP-dependent RNA he | 0.4 | 0.308 | 0.435 | 9e-72 | |
| 281349618 | 897 | hypothetical protein PANDA_002012 [Ailur | 0.4 | 0.307 | 0.417 | 3e-68 | |
| 301756631 | 908 | PREDICTED: putative ATP-dependent RNA he | 0.4 | 0.303 | 0.417 | 4e-68 | |
| 327272138 | 914 | PREDICTED: putative ATP-dependent RNA he | 0.381 | 0.287 | 0.430 | 5e-68 | |
| 449482368 | 913 | PREDICTED: putative ATP-dependent RNA he | 0.465 | 0.351 | 0.378 | 6e-68 | |
| 345792101 | 905 | PREDICTED: DEAD/H (Asp-Glu-Ala-Asp/His) | 0.388 | 0.296 | 0.426 | 6e-68 | |
| 322801298 | 908 | hypothetical protein SINV_11349 [Solenop | 0.410 | 0.311 | 0.448 | 7e-68 | |
| 351702333 | 953 | Putative ATP-dependent RNA helicase DDX1 | 0.4 | 0.289 | 0.423 | 2e-67 |
| >gi|193608349|ref|XP_001949260.1| PREDICTED: probable ATP-dependent RNA helicase DDX11-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 294 bits (752), Expect = 1e-76, Method: Compositional matrix adjust.
Identities = 148/292 (50%), Positives = 195/292 (66%), Gaps = 12/292 (4%)
Query: 398 YMPDIEKTQEKPKLSGLQSFLKGVQ-ENNPNLSKPSEGGIEEAPSQVQEDQVRNPMLSVV 456
YMP + KPKLS LQ+FLK ++ + N + E + QV + NP+ V+
Sbjct: 496 YMPSVSLQPSKPKLSNLQTFLKQIETKKNSKGKELKEDENKHIDPQVADIISNNPLTPVM 555
Query: 457 TFLESLVNKNEDGRILVTKNPELSKSHIKYILLNPANHFTDIVQDARSIIVAGGTMEPVS 516
F+ESL N EDGRI+ T +SK +K++LLNPA HF +IV ARS+IV+GGTMEP+S
Sbjct: 556 AFIESLTNYCEDGRIISTTQAFVSKGVLKFLLLNPAVHFKEIVDKARSVIVSGGTMEPIS 615
Query: 517 EFKDQLFGSLGVPESRIHHFSCGHVIPKENILPLILCSGPTNRKFDLTFENRTKGDTLKE 576
EFKDQLF G RI HFSCGHV+P ++ILPLI+CSGPT ++FD +++ RT L E
Sbjct: 616 EFKDQLFNFNGDNSDRIMHFSCGHVVPPDHILPLIVCSGPTGKQFDFSYQERTSIKMLNE 675
Query: 577 IAMTITNLCTIVPKGMVCFFPSYDYEAIVYNYMRDNHFIERIARIAKKKVVFREPKKTSE 636
I + N+C VP G+VCFFPSYDYE VY Y+ N I R++++K +FREPK T++
Sbjct: 676 IGSLLENICRTVPAGIVCFFPSYDYEQFVYQYLEKNKVIN---RLSERKKLFREPKSTNQ 732
Query: 637 VDKVLSDYGTSVEK--------GGALMLSVIGGKLSEGLNFSDDLGRCVVVM 680
VD+VL +Y ++ GAL+ SVIGGKLSEGLNFSDDLGRCV+V+
Sbjct: 733 VDEVLKNYSQAITTTSVLNSKVTGALLFSVIGGKLSEGLNFSDDLGRCVIVI 784
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|363728123|ref|XP_416375.3| PREDICTED: DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|326912321|ref|XP_003202502.1| PREDICTED: putative ATP-dependent RNA helicase DDX11-like protein 8-like [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
| >gi|281349618|gb|EFB25202.1| hypothetical protein PANDA_002012 [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
| >gi|301756631|ref|XP_002914172.1| PREDICTED: putative ATP-dependent RNA helicase DDX11-like protein-like [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
| >gi|327272138|ref|XP_003220843.1| PREDICTED: putative ATP-dependent RNA helicase DDX11-like protein 8-like [Anolis carolinensis] | Back alignment and taxonomy information |
|---|
| >gi|449482368|ref|XP_002193292.2| PREDICTED: putative ATP-dependent RNA helicase DDX11-like protein 8-like [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
| >gi|345792101|ref|XP_543872.3| PREDICTED: DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 [Canis lupus familiaris] | Back alignment and taxonomy information |
|---|
| >gi|322801298|gb|EFZ21985.1| hypothetical protein SINV_11349 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|351702333|gb|EHB05252.1| Putative ATP-dependent RNA helicase DDX11-like protein [Heterocephalus glaber] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 690 | ||||||
| UNIPROTKB|F1NN99 | 908 | DDX11 "Uncharacterized protein | 0.4 | 0.303 | 0.445 | 3.7e-70 | |
| ZFIN|ZDB-GENE-041114-191 | 890 | ddx11 "DEAD/H (Asp-Glu-Ala-Asp | 0.385 | 0.298 | 0.440 | 1.4e-68 | |
| UNIPROTKB|E2RGR5 | 908 | DDX11 "Uncharacterized protein | 0.388 | 0.295 | 0.433 | 5.4e-67 | |
| RGD|1306675 | 882 | Ddx11 "DEAD/H (Asp-Glu-Ala-Asp | 0.392 | 0.307 | 0.434 | 2e-65 | |
| UNIPROTKB|E1BL06 | 913 | E1BL06 "Uncharacterized protei | 0.376 | 0.284 | 0.432 | 4.7e-65 | |
| MGI|MGI:2443590 | 880 | Ddx11 "DEAD/H (Asp-Glu-Ala-Asp | 0.392 | 0.307 | 0.413 | 1.1e-62 | |
| UNIPROTKB|Q96FC9 | 970 | DDX11 "Probable ATP-dependent | 0.388 | 0.276 | 0.426 | 1.5e-62 | |
| UNIPROTKB|Q92771 | 950 | DDX12P "Putative ATP-dependent | 0.388 | 0.282 | 0.426 | 6.5e-62 | |
| UNIPROTKB|F1SK84 | 682 | DDX11 "Uncharacterized protein | 0.378 | 0.382 | 0.423 | 1.3e-61 | |
| UNIPROTKB|A8MPP1 | 907 | DDX11L8 "Putative ATP-dependen | 0.386 | 0.294 | 0.411 | 5e-59 |
| UNIPROTKB|F1NN99 DDX11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 686 (246.5 bits), Expect = 3.7e-70, Sum P(2) = 3.7e-70
Identities = 131/294 (44%), Positives = 201/294 (68%)
Query: 397 NYMPDIEKTQEKPKLSGLQSFLKGVQENNPNLSKPSEGGIEEAPSQVQEDQVR--NPMLS 454
N P ++ +E KL+GLQ+FL +Q+ + EG ++ P + DQ+R +P++
Sbjct: 516 NPAPVVKTNKENQKLAGLQNFLMTLQQGSYK-----EGPLQSPPVEADSDQLRAASPLMH 570
Query: 455 VVTFLESLVNKNEDGRILVTKNPELSKSHIKYILLNPANHFTDIVQDARSIIVAGGTMEP 514
+ FL +L N NEDGR+++ + + +S +K++LLNPA HF +V++ R++I+AGGTM+P
Sbjct: 571 IEGFLSALTNANEDGRVILNRQGTIGQSSLKFLLLNPAVHFAKVVKECRAVIIAGGTMQP 630
Query: 515 VSEFKDQLFGSLGVPESRIHHFSCGHVIPKENILPLILCSGPTNRKFDLTFENRTKGDTL 574
V++F++QL GV +RI FSCGHVIP ENILP+ILCSGP+N++ + T++ R +
Sbjct: 631 VADFREQLLSYAGVDPARIVEFSCGHVIPPENILPIILCSGPSNQQLEFTYQTRDLPQMM 690
Query: 575 KEIAMTITNLCTIVPKGMVCFFPSYDYEAIVYNYMRDNHFIERIARIAKKKVVFREPKKT 634
E + NLC +VP G+VCFFPSYDYE VY + + R+A KKK+ F+EPKK
Sbjct: 691 DETGRILCNLCNVVPGGVVCFFPSYDYEKQVYAHWEKTGLLTRLA--TKKKI-FQEPKKA 747
Query: 635 SEVDKVLSDYGTSVEK-G-------GALMLSVIGGKLSEGLNFSDDLGRCVVVM 680
++V++VL++Y +++ G GAL+LSV+GGK+SEG+NFSDDLGRCV+++
Sbjct: 748 NQVEQVLAEYAKCIKRCGQAGGQMTGALLLSVVGGKMSEGINFSDDLGRCVIMV 801
|
|
| ZFIN|ZDB-GENE-041114-191 ddx11 "DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGR5 DDX11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1306675 Ddx11 "DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BL06 E1BL06 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2443590 Ddx11 "DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96FC9 DDX11 "Probable ATP-dependent RNA helicase DDX11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92771 DDX12P "Putative ATP-dependent RNA helicase DDX12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SK84 DDX11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MPP1 DDX11L8 "Putative ATP-dependent RNA helicase DDX11-like protein 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 690 | |||
| TIGR00604 | 705 | TIGR00604, rad3, DNA repair helicase (rad3) | 1e-44 | |
| PLN02972 | 763 | PLN02972, PLN02972, Histidyl-tRNA synthetase | 7e-41 | |
| cd00773 | 261 | cd00773, HisRS-like_core, Class II Histidinyl-tRNA | 1e-26 | |
| TIGR00604 | 705 | TIGR00604, rad3, DNA repair helicase (rad3) | 2e-26 | |
| COG0124 | 429 | COG0124, HisS, Histidyl-tRNA synthetase [Translati | 2e-24 | |
| PRK00037 | 412 | PRK00037, hisS, histidyl-tRNA synthetase; Reviewed | 9e-20 | |
| TIGR00442 | 397 | TIGR00442, hisS, histidyl-tRNA synthetase | 1e-19 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 7e-17 | |
| smart00491 | 142 | smart00491, HELICc2, helicase superfamily c-termin | 3e-16 | |
| PRK12420 | 423 | PRK12420, PRK12420, histidyl-tRNA synthetase; Prov | 5e-16 | |
| TIGR00443 | 313 | TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltran | 4e-15 | |
| pfam13307 | 165 | pfam13307, Helicase_C_2, Helicase C-terminal domai | 4e-15 | |
| PRK12292 | 391 | PRK12292, hisZ, ATP phosphoribosyltransferase regu | 6e-15 | |
| PLN02530 | 487 | PLN02530, PLN02530, histidine-tRNA ligase | 7e-14 | |
| pfam13393 | 308 | pfam13393, tRNA-synt_His, Histidyl-tRNA synthetase | 1e-13 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 6e-10 | |
| PRK12295 | 373 | PRK12295, hisZ, ATP phosphoribosyltransferase regu | 8e-08 | |
| COG3705 | 390 | COG3705, HisZ, ATP phosphoribosyltransferase invol | 1e-06 | |
| CHL00201 | 430 | CHL00201, syh, histidine-tRNA synthetase; Provisio | 2e-04 |
| >gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) | Back alignment and domain information |
|---|
Score = 170 bits (432), Expect = 1e-44
Identities = 76/275 (27%), Positives = 129/275 (46%), Gaps = 22/275 (8%)
Query: 415 QSFLKGVQENNPNLSKPSEGGIEEAPSQVQEDQV--------RNPMLSVVTFLESLVNKN 466
+FL+ ++E + +P E + ++E ++ + + T + + N
Sbjct: 348 DAFLEHLKEK-TFIDRPLRFCSERLSNLLRELEITHPEDFSALVLLFTFATLVLTYTNGF 406
Query: 467 EDGRILVTKNPELSKSHIKYILLNPANHFTDIVQDARSIIVAGGTMEPVSEFKDQLFGSL 526
+G +N + +K++ L+P+ + + RS+I+A GT+ P+ F L
Sbjct: 407 LEGIEPY-ENKTVPNPILKFMCLDPSIALKPLFERVRSVILASGTLSPLDAFPRNLG--- 462
Query: 527 GVPESRIHHFSCGHVIPKENILPLILCSGPTNRKFDLTFENRTKGDTLKEIAMTITNLCT 586
H++ +EN+L LI+ G TFE R ++ + +
Sbjct: 463 --FNPVSQDSPT-HILKRENLLTLIVTRGSDQVPLSSTFEIRNDPSLVRNLGELLVEFSK 519
Query: 587 IVPKGMVCFFPSYDY-EAIVYNYMRDNHFIERIARIAKKKVVFREPKKTSEVDKVLSDYG 645
I+P G+V FFPSY Y E IV + + I KKK++F E K E L Y
Sbjct: 520 IIPDGIVVFFPSYSYLENIV----STWKEMGILENIEKKKLIFVETKDAQETSDALERYK 575
Query: 646 TSVEKG-GALMLSVIGGKLSEGLNFSDDLGRCVVV 679
+V +G GA++LSV GGK+SEG++F DDLGR V++
Sbjct: 576 QAVSEGRGAVLLSVAGGKVSEGIDFCDDLGRAVIM 610
|
All proteins in this family for which funcitons are known are DNA-DNA helicases that funciton in the initiation of transcription and nucleotide excision repair as part of the TFIIH complex. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 705 |
| >gnl|CDD|215525 PLN02972, PLN02972, Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|238396 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >gnl|CDD|223202 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234586 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213530 TIGR00442, hisS, histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|214694 smart00491, HELICc2, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|237097 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232978 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltransferase, regulatory subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222037 pfam13307, Helicase_C_2, Helicase C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|237043 PRK12292, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178145 PLN02530, PLN02530, histidine-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|222097 pfam13393, tRNA-synt_His, Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|183413 PRK12295, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226228 COG3705, HisZ, ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|164576 CHL00201, syh, histidine-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 690 | |||
| KOG1133|consensus | 821 | 100.0 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 100.0 | |
| KOG1132|consensus | 945 | 100.0 | ||
| KOG1133|consensus | 821 | 99.98 | ||
| KOG1936|consensus | 518 | 99.97 | ||
| KOG1131|consensus | 755 | 99.96 | ||
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 99.95 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.95 | |
| PLN02972 | 763 | Histidyl-tRNA synthetase | 99.95 | |
| COG0124 | 429 | HisS Histidyl-tRNA synthetase [Translation, riboso | 99.94 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 99.93 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 99.93 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.92 | |
| KOG1132|consensus | 945 | 99.92 | ||
| PLN02530 | 487 | histidine-tRNA ligase | 99.9 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 99.9 | |
| PRK12420 | 423 | histidyl-tRNA synthetase; Provisional | 99.9 | |
| PRK12292 | 391 | hisZ ATP phosphoribosyltransferase regulatory subu | 99.89 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.89 | |
| KOG1131|consensus | 755 | 99.88 | ||
| PRK12421 | 392 | ATP phosphoribosyltransferase regulatory subunit; | 99.87 | |
| PRK12295 | 373 | hisZ ATP phosphoribosyltransferase regulatory subu | 99.85 | |
| CHL00201 | 430 | syh histidine-tRNA synthetase; Provisional | 99.85 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 99.84 | |
| TIGR00442 | 397 | hisS histidyl-tRNA synthetase. This model finds a | 99.84 | |
| TIGR00443 | 314 | hisZ_biosyn_reg ATP phosphoribosyltransferase, reg | 99.84 | |
| PRK00037 | 412 | hisS histidyl-tRNA synthetase; Reviewed | 99.79 | |
| PF13393 | 311 | tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI | 99.78 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 99.75 | |
| cd00773 | 261 | HisRS-like_core Class II Histidinyl-tRNA synthetas | 99.74 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 99.66 | |
| PRK12293 | 281 | hisZ ATP phosphoribosyltransferase regulatory subu | 99.6 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.49 | |
| COG3705 | 390 | HisZ ATP phosphoribosyltransferase involved in his | 99.47 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.45 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 99.45 | |
| PRK12294 | 272 | hisZ ATP phosphoribosyltransferase regulatory subu | 99.43 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 99.38 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.06 | |
| TIGR00418 | 563 | thrS threonyl-tRNA synthetase. This model represen | 99.01 | |
| KOG1035|consensus | 1351 | 98.99 | ||
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.83 | |
| PRK12444 | 639 | threonyl-tRNA synthetase; Reviewed | 98.54 | |
| PRK04173 | 456 | glycyl-tRNA synthetase; Provisional | 98.05 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 97.7 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 97.46 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 97.3 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 97.23 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 97.21 | |
| PRK12305 | 575 | thrS threonyl-tRNA synthetase; Reviewed | 97.16 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 97.16 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 97.15 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.14 | |
| PTZ00110 | 545 | helicase; Provisional | 97.12 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 97.05 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 97.04 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 96.89 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 96.84 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 96.83 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 96.82 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 96.76 | |
| PTZ00424 | 401 | helicase 45; Provisional | 96.71 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 96.69 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 96.66 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 96.57 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 96.39 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 96.08 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 96.05 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 95.99 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 95.98 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 95.95 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 95.84 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 95.62 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 95.39 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 95.21 | |
| KOG0343|consensus | 758 | 95.18 | ||
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 95.12 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 95.11 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 95.09 | |
| KOG0345|consensus | 567 | 95.01 | ||
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 94.98 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 94.83 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 94.8 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 94.77 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 94.73 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 94.66 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 94.66 | |
| KOG0342|consensus | 543 | 94.63 | ||
| KOG0332|consensus | 477 | 94.15 | ||
| PRK02362 | 737 | ski2-like helicase; Provisional | 94.07 | |
| PF12745 | 273 | HGTP_anticodon2: Anticodon binding domain of tRNAs | 94.03 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 93.56 | |
| KOG0333|consensus | 673 | 93.51 | ||
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 93.15 | |
| KOG0347|consensus | 731 | 92.49 | ||
| KOG0328|consensus | 400 | 92.48 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 92.07 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 91.83 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 90.8 | |
| KOG0331|consensus | 519 | 90.69 | ||
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 90.37 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 90.25 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 90.24 | |
| KOG0348|consensus | 708 | 89.08 | ||
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 88.9 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 88.85 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 88.71 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 88.67 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 88.23 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 87.81 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 87.39 | |
| PRK14799 | 545 | thrS threonyl-tRNA synthetase; Provisional | 87.36 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 86.91 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 86.75 | |
| KOG0341|consensus | 610 | 86.46 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 86.33 | |
| KOG0339|consensus | 731 | 85.74 | ||
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 84.19 | |
| KOG0327|consensus | 397 | 84.01 | ||
| PRK12325 | 439 | prolyl-tRNA synthetase; Provisional | 83.87 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 83.81 | |
| KOG0330|consensus | 476 | 83.07 | ||
| KOG0344|consensus | 593 | 82.76 | ||
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 81.26 | |
| KOG0926|consensus | 1172 | 80.11 | ||
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 80.04 |
| >KOG1133|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-43 Score=385.52 Aligned_cols=229 Identities=51% Similarity=0.909 Sum_probs=216.7
Q ss_pred ChHHHHHHHHHHHhccCCCceEEEEECCCCCccEEEEEecCchhhHHHHHhhcceEEEeCCCCCchhhHHHHhhccCCCC
Q psy1221 450 NPMLSVVTFLESLVNKNEDGRILVTKNPELSKSHIKYILLNPANHFTDIVQDARSIIVAGGTMEPVSEFKDQLFGSLGVP 529 (690)
Q Consensus 450 s~l~~l~~fl~~l~~~~~~~~i~~~~~~~~~~~~l~~~~ldp~~~~~~~~~~~~svil~SgTLsP~~~f~~~l~~~~Gl~ 529 (690)
++++.+..||.+|.+.+.+|++++..++. ++|+++.|+|+..|.+++.++|+||+++|||+|.+.|...|+. |.+
T Consensus 496 s~l~~l~~FL~~LTn~~~dGri~~~k~~s---~~lky~lL~pA~~f~evv~earavvLAGGTMeP~~e~~e~L~~--~~~ 570 (821)
T KOG1133|consen 496 SPLFELSSFLGALTNNNEDGRIFYSKQGS---GTLKYMLLNPAKHFAEVVLEARAVVLAGGTMEPVDELREQLFP--GCP 570 (821)
T ss_pred chhHHHHHHHHHHhCCCCCCcEEEeccCC---ceEEEEecCcHHHHHHHHHHhheeeecCCccccHHHHHHHhcc--cch
Confidence 68999999999999999999999976543 8999999999999999999999999999999999999999977 444
Q ss_pred CCceEEEEeCCCccCCCeeEEEeecCCCCcceeeeccccCChHHHHHHHHHHHHhhhcccCcEEEEeccHHHHHHHHHHH
Q psy1221 530 ESRIHHFSCGHVIPKENILPLILCSGPTNRKFDLTFENRTKGDTLKEIAMTITNLCTIVPKGMVCFFPSYDYEAIVYNYM 609 (690)
Q Consensus 530 ~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~l~~~I~~l~~~~~gg~lVfF~Sy~~l~~v~~~~ 609 (690)
+++..++|.|++|++|+.++++..||+|.+++|+|+.|.++++++.++..|.+++.++|||++||||||+||.+++++|
T Consensus 571 -~~i~~fsc~Hvip~e~il~~vv~~gpsg~p~eftf~~R~s~~~l~~l~~~~~nL~~~VPgGvV~FfPSy~yL~~v~k~w 649 (821)
T KOG1133|consen 571 -ERISPFSCSHVIPPENILPLVVSSGPSGQPLEFTFETRESPEMIKDLGSSISNLSNAVPGGVVCFFPSYAYLGQVRKRW 649 (821)
T ss_pred -hhccceecccccChhheeeeeeccCCCCCceEEEeeccCChHHHHHHHHHHHHHHhhCCCcEEEEeccHHHHHHHHHHH
Confidence 6788999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcCchhHHHHHhcCceEEEcCCCchhHHHHHHHhhhcccC-CceEEEEeeCcccccccccCCCcceEEEEEcCCCCCCC
Q psy1221 610 RDNHFIERIARIAKKKVVFREPKKTSEVDKVLSDYGTSVEK-GGALMLSVIGGKLSEGLNFSDDLGRCVVVMCNSNPLRV 688 (690)
Q Consensus 610 ~~~~~~~~~~~~~~~~~i~~E~~~~~~~~~~l~~f~~~~~~-~~aiLfaV~gG~~sEGIDf~g~~~r~ViivgLPfp~p~ 688 (690)
.++++. .+|..+|++|.|+++. .+.+++.|+++++. .|||||||+|||+||||||.|++|||||+||||||++.
T Consensus 650 ~~~gil---~ri~~kK~vF~E~k~~--~~dvl~~Ya~a~~~g~GaiLlaVVGGKlSEGINF~D~LgRaVvvVGlPyPN~~ 724 (821)
T KOG1133|consen 650 EQNGIL---ARIVGKKKVFYEPKDT--VEDVLEGYAEAAERGRGAILLAVVGGKLSEGINFSDDLGRAVVVVGLPYPNIQ 724 (821)
T ss_pred HhcchH---HHhhccchhhccCccc--HHHHHHHHHHHhhcCCCeEEEEEeccccccccccccccccEEEEeecCCCCCC
Confidence 999988 9999999999999976 68999999999876 58999999999999999999999999999999999987
Q ss_pred C
Q psy1221 689 P 689 (690)
Q Consensus 689 d 689 (690)
|
T Consensus 725 s 725 (821)
T KOG1133|consen 725 S 725 (821)
T ss_pred C
Confidence 6
|
|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >KOG1936|consensus | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PLN02972 Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >PLN02530 histidine-tRNA ligase | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK12420 histidyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00201 syh histidine-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >TIGR00442 hisS histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit | Back alignment and domain information |
|---|
| >PRK00037 hisS histidyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR00418 thrS threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG1035|consensus | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK12444 threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK04173 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK12305 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF12745 HGTP_anticodon2: Anticodon binding domain of tRNAs; InterPro: IPR024435 This is an anticodon binding domain, found largely on Gcn2 proteins which bind tRNA to down regulate translation in certain stress situations [] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK14799 thrS threonyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PRK12325 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 690 | ||||
| 4g85_A | 517 | Crystal Structure Of Human Hisrs Length = 517 | 9e-53 | ||
| 4g84_A | 464 | Crystal Structure Of Human Hisrs Length = 464 | 1e-52 | ||
| 3hri_A | 456 | Histidyl-Trna Synthetase (Apo) From Trypanosoma Bru | 3e-11 | ||
| 3hrk_A | 456 | Histidyl-Trna Synthetase From Trypanosoma Cruzi (Hi | 1e-10 | ||
| 3net_A | 465 | Crystal Structure Of Histidyl-Trna Synthetase From | 3e-10 | ||
| 1wu7_A | 434 | Crystal Structure Of Histidyl-Trna Synthetase From | 5e-07 | ||
| 3rac_A | 373 | Crystal Strucutre Of Histidine--Trna Ligase Subunit | 4e-05 | ||
| 3od1_A | 400 | The Crystal Structure Of An Atp Phosphoribosyltrans | 3e-04 |
| >pdb|4G85|A Chain A, Crystal Structure Of Human Hisrs Length = 517 | Back alignment and structure |
|
| >pdb|4G84|A Chain A, Crystal Structure Of Human Hisrs Length = 464 | Back alignment and structure |
| >pdb|3HRI|A Chain A, Histidyl-Trna Synthetase (Apo) From Trypanosoma Brucei Length = 456 | Back alignment and structure |
| >pdb|3HRK|A Chain A, Histidyl-Trna Synthetase From Trypanosoma Cruzi (Histidyl-Adenylate Complex) Length = 456 | Back alignment and structure |
| >pdb|3NET|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Nostoc Sp. Pcc 7120 Length = 465 | Back alignment and structure |
| >pdb|1WU7|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Thermoplasma Acidophilum Length = 434 | Back alignment and structure |
| >pdb|3RAC|A Chain A, Crystal Strucutre Of Histidine--Trna Ligase Subunit From Alicyclobacillus Acidocaldarius Subsp. Acidocaldarius Dsm 446 Length = 373 | Back alignment and structure |
| >pdb|3OD1|A Chain A, The Crystal Structure Of An Atp Phosphoribosyltransferase Regulatory SubunitHISTIDYL-Trna Synthetase From Bacillus Halodurans C Length = 400 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Length = 456 | Back alignment and structure |
|---|
Score = 171 bits (435), Expect = 7e-47
Identities = 37/188 (19%), Positives = 68/188 (36%), Gaps = 32/188 (17%)
Query: 3 GEKNLSPEVADKIGEYVLKHGHVDLVENLLADEFLAKSKQAKEGLEAIKLLFHYCQIYGL 62
L P V D I + DE + + E ++ ++ F + YG
Sbjct: 230 AVLGLEPTVVDAITTTLSLKS---------IDEIAQRVGEEHEAVKELRQFFEQVEAYGY 280
Query: 63 KDTIVFDLSLARGLDYYTGVIYEAVLKDQAVGSVAGGGRYDNLVGMFDPKNKTTPCVAAK 122
D ++FD S+ RGL YYTG+++E ++ ++ GGGRYDNL+ + PC
Sbjct: 281 GDWVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGRYDNLLTTYGSPTP-IPCA--- 336
Query: 123 LLHEVQGLLETSCRSCREDIGVERLFSIIENRNAEQGVKVKTTSTQVYVASAQKNLVEPR 182
G G + +++ + + V +++
Sbjct: 337 ------GF---G-------FGDCVIVELLQEKRLLPDIP---HVVDDVVIPFDESMRPHA 377
Query: 183 MQLCHELW 190
+ + L
Sbjct: 378 LAVLRRLR 385
|
| >3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 | Back alignment and structure |
|---|
| >3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Length = 373 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Length = 434 | Back alignment and structure |
|---|
| >3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Length = 400 | Back alignment and structure |
|---|
| >1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Length = 275 | Back alignment and structure |
|---|
| >1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Length = 344 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Length = 467 | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Length = 421 | Back alignment and structure |
|---|
| >1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Length = 423 | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Length = 420 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 690 | |||
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.98 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.96 | |
| 3lc0_A | 456 | Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t | 99.93 | |
| 4g84_A | 464 | Histidine--tRNA ligase, cytoplasmic; synthetase; 2 | 99.92 | |
| 3net_A | 465 | Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas | 99.92 | |
| 4g85_A | 517 | Histidine-tRNA ligase, cytoplasmic; synthetase; 3. | 99.92 | |
| 3od1_A | 400 | ATP phosphoribosyltransferase regulatory subunit; | 99.91 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.88 | |
| 1z7m_A | 344 | ATP phosphoribosyltransferase regulatory subunit; | 99.84 | |
| 1wu7_A | 434 | Histidyl-tRNA synthetase; ligase, structural genom | 99.84 | |
| 4e51_A | 467 | Histidine--tRNA ligase; seattle structural genomic | 99.82 | |
| 3rac_A | 373 | Histidine-tRNA ligase; structural genomics, PSI-bi | 99.82 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.79 | |
| 1h4v_B | 421 | Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA | 99.78 | |
| 1htt_A | 423 | Histidyl-tRNA synthetase; complex (tRNA synthetase | 99.77 | |
| 1usy_A | 275 | ATP phosphoribosyltransferase regulatory subunit; | 99.7 | |
| 1qe0_A | 420 | Histidyl-tRNA synthetase; class II tRNA synthetase | 99.7 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.68 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.91 | |
| 2j3l_A | 572 | Prolyl-tRNA synthetase; class II aminoacyl- T synt | 98.36 | |
| 1evl_A | 401 | Threonyl-tRNA synthetase; amino acid recognition, | 98.16 | |
| 2i4l_A | 458 | Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud | 98.11 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 97.81 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 97.66 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 97.51 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 97.49 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 97.45 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 97.45 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 97.44 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 97.44 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 97.41 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 97.39 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 97.39 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 97.28 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 97.27 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 97.24 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 97.21 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 97.12 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 97.05 | |
| 2zt5_A | 693 | Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP | 97.0 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 96.98 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 96.8 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 96.8 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 96.76 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 96.64 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 96.47 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 96.37 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 96.26 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 95.22 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 96.2 | |
| 1hc7_A | 477 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 96.07 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 96.05 | |
| 1nj8_A | 459 | Proline-tRNA synthetase, proline--tRNA ligase; cla | 95.53 | |
| 1nj1_A | 501 | PROR, proline-tRNA synthetase, proline--tRNA ligas | 95.48 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 95.47 | |
| 1qf6_A | 642 | THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m | 95.44 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 95.42 | |
| 3uh0_A | 460 | Threonyl-tRNA synthetase, mitochondrial; threonine | 95.39 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 95.34 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 95.33 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 95.27 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 95.19 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 95.15 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 95.07 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 94.76 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 94.7 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 94.62 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 94.56 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 94.51 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 94.36 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 94.24 | |
| 3a32_A | 471 | Probable threonyl-tRNA synthetase 1; aeropyrum per | 94.07 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 93.95 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 93.95 | |
| 1nyr_A | 645 | Threonyl-tRNA synthetase 1; ATP, threonine, ligase | 93.86 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 93.62 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 93.43 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 93.35 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 93.02 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 92.92 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 92.88 | |
| 1nnh_A | 294 | Asparaginyl-tRNA synthetase-related peptide; struc | 92.84 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 92.53 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 92.12 | |
| 1ati_A | 505 | Glycyl-tRNA synthetase; protein biosynthesis, liga | 92.02 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 91.92 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 91.85 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 91.67 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 91.63 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 91.53 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 90.92 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 90.78 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 90.75 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 89.87 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 89.56 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 89.56 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 88.8 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 87.91 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 87.76 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 81.94 |
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
Probab=99.98 E-value=2.6e-32 Score=314.37 Aligned_cols=205 Identities=20% Similarity=0.288 Sum_probs=160.2
Q ss_pred CChHHHHHHHHHHHhccCCCceEEEEECCCCCccEEEEEecCchhhHHHHHhhcceEEEeCCCCCchhhHHHHhhccCCC
Q psy1221 449 RNPMLSVVTFLESLVNKNEDGRILVTKNPELSKSHIKYILLNPANHFTDIVQDARSIIVAGGTMEPVSEFKDQLFGSLGV 528 (690)
Q Consensus 449 ~s~l~~l~~fl~~l~~~~~~~~i~~~~~~~~~~~~l~~~~ldp~~~~~~~~~~~~svil~SgTLsP~~~f~~~l~~~~Gl 528 (690)
.+.+.++.+|+..+...+.+++++|.... .+..|+++|+||+..|+ ++ .++++|||||||+|+++|.+.+ |+
T Consensus 326 ~~~~~~~~~fl~~~~~~~~~~~~~~~~~~--~~~~l~~~~l~~~~~l~-~~-~~~~~il~SaTL~p~~~~~~~l----Gl 397 (620)
T 4a15_A 326 FSYCSSVASRIIAFSDQDEEKYAAILSPE--DGGYMQAACLDPSGILE-VL-KESKTIHMSGTLDPFDFYSDIT----GF 397 (620)
T ss_dssp CCHHHHHHHHHHHHHTSCTTTEEEEEECG--GGCEEEEEECCTHHHHG-GG-GGSEEEEEESSCCSHHHHHHHH----CC
T ss_pred ccHHHHHHHHHHHHhhcCCCCEEEEEEeC--CCcEEEEEECCHHHHHH-HH-hCCeEEEEccCCCcHHHHHHHh----CC
Confidence 46788999999988433334777786543 24799999999999999 88 9999999999999999999988 77
Q ss_pred CCCceEEEEeCCCccCCCeeEEEeecCCCCcceeeeccccCChHHHHHHHHHHHHhhhcccCcEEEEeccHHHHHHHHHH
Q psy1221 529 PESRIHHFSCGHVIPKENILPLILCSGPTNRKFDLTFENRTKGDTLKEIAMTITNLCTIVPKGMVCFFPSYDYEAIVYNY 608 (690)
Q Consensus 529 ~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~l~~~I~~l~~~~~gg~lVfF~Sy~~l~~v~~~ 608 (690)
+ ...++++|||+++|..++++++ +.++|++|+ +++++++++.|.++++.+|||+|||||||.+|+++++.
T Consensus 398 ~---~~~~~~~spf~~~~~~~~~~~~------~~~~~~~r~-~~~~~~~~~~i~~l~~~~~g~~lvlF~Sy~~l~~v~~~ 467 (620)
T 4a15_A 398 E---IPFKKIGEIFPPENRYIAYYDG------VSSKYDTLD-EKELDRMATVIEDIILKVKKNTIVYFPSYSLMDRVENR 467 (620)
T ss_dssp C---CCEEECCCCSCGGGEEEEEECC------C-------C-HHHHHHHHHHHHHHHHHHCSCEEEEESCHHHHHHHTSS
T ss_pred C---ceeeecCCCCCHHHeEEEEeCC------CCCcCCCCC-HHHHHHHHHHHHHHHHhCCCCEEEEeCCHHHHHHHHHH
Confidence 5 5678999999999988877633 344677776 56789999999999999999999999999999999998
Q ss_pred HHhcCchhHHHHHhcCceEEEcCCCc--hhHHHHHHHhhhcccCCceEEEEeeCcccccccccCCCcceEEEEEcCCCCC
Q psy1221 609 MRDNHFIERIARIAKKKVVFREPKKT--SEVDKVLSDYGTSVEKGGALMLSVIGGKLSEGLNFSDDLGRCVVVMCNSNPL 686 (690)
Q Consensus 609 ~~~~~~~~~~~~~~~~~~i~~E~~~~--~~~~~~l~~f~~~~~~~~aiLfaV~gG~~sEGIDf~g~~~r~ViivgLPfp~ 686 (690)
|+ . .. .+ |.++. .+++.++++|+ . +++|||||+||+|||||||+|+.+|+|||+|||||+
T Consensus 468 l~-~-~~---------~~---~~q~~~~~~~~~ll~~f~-~---~~~vL~~v~~gsf~EGiD~~g~~l~~viI~~lPfp~ 529 (620)
T 4a15_A 468 VS-F-EH---------MK---EYRGIDQKELYSMLKKFR-R---DHGTIFAVSGGRLSEGINFPGNELEMIILAGLPFPR 529 (620)
T ss_dssp CC-S-CC---------EE---CCTTCCSHHHHHHHHHHT-T---SCCEEEEETTSCC--------CCCCEEEESSCCCCC
T ss_pred HH-h-cc---------hh---ccCCCChhHHHHHHHHhc-c---CCcEEEEEecCceeccccCCCCceEEEEEEcCCCCC
Confidence 87 1 11 12 55543 37899999999 3 799999999999999999999999999999999999
Q ss_pred CCC
Q psy1221 687 RVP 689 (690)
Q Consensus 687 p~d 689 (690)
|++
T Consensus 530 ~~p 532 (620)
T 4a15_A 530 PDA 532 (620)
T ss_dssp CCH
T ss_pred CCH
Confidence 964
|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A | Back alignment and structure |
|---|
| >4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} | Back alignment and structure |
|---|
| >4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A | Back alignment and structure |
|---|
| >1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* | Back alignment and structure |
|---|
| >1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* | Back alignment and structure |
|---|
| >1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* | Back alignment and structure |
|---|
| >2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 | Back alignment and structure |
|---|
| >1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 690 | ||||
| d1usya_ | 275 | d.104.1.1 (A:) ATP phosphoribosyltransferase regul | 5e-17 | |
| d1h4vb2 | 324 | d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisR | 1e-16 | |
| d1wu7a2 | 327 | d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisR | 1e-16 | |
| d1z7ma1 | 318 | d.104.1.1 (A:6-323) ATP phosphoribosyltransferase | 1e-15 | |
| d1kmma2 | 322 | d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisR | 3e-15 | |
| d1qe0a2 | 325 | d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisR | 2e-14 |
| >d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Length = 275 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: ATP phosphoribosyltransferase regulatory subunit HisZ species: Thermotoga maritima [TaxId: 2336]
Score = 79.4 bits (195), Expect = 5e-17
Identities = 17/82 (20%), Positives = 30/82 (36%), Gaps = 1/82 (1%)
Query: 25 VDLVENLLADEFLAKSKQAKEGLEAIKLLFHYCQIYGLKDTIVFDLSLARGLDYYTGVIY 84
++ + E L E + + Q ++ DL+LAR ++ Y G+I+
Sbjct: 180 IEDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIF 239
Query: 85 EAVLKDQAVGSVAGGGRYDNLV 106
+ VA GG Y
Sbjct: 240 TIYDTSSS-RLVAAGGEYTVNG 260
|
| >d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Length = 324 | Back information, alignment and structure |
|---|
| >d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 327 | Back information, alignment and structure |
|---|
| >d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Length = 318 | Back information, alignment and structure |
|---|
| >d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Length = 322 | Back information, alignment and structure |
|---|
| >d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Length = 325 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 690 | |||
| d1kmma2 | 322 | Histidyl-tRNA synthetase (HisRS) {Escherichia coli | 99.72 | |
| d1wu7a2 | 327 | Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop | 99.72 | |
| d1h4vb2 | 324 | Histidyl-tRNA synthetase (HisRS) {Thermus thermoph | 99.68 | |
| d1z7ma1 | 318 | ATP phosphoribosyltransferase regulatory subunit H | 99.68 | |
| d1qe0a2 | 325 | Histidyl-tRNA synthetase (HisRS) {Staphylococcus a | 99.65 | |
| d1usya_ | 275 | ATP phosphoribosyltransferase regulatory subunit H | 99.47 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 97.64 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 97.62 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 97.33 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 97.2 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 97.16 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 97.04 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 96.98 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 96.86 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 96.42 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 96.32 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 95.79 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 95.77 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 94.68 | |
| d1wu7a1 | 97 | Histidyl-tRNA synthetase (HisRS), C-terminal domai | 93.2 | |
| d1h4vb1 | 96 | Histidyl-tRNA synthetase (HisRS), C-terminal domai | 93.06 | |
| d1kmma1 | 99 | Histidyl-tRNA synthetase (HisRS), C-terminal domai | 92.37 | |
| d1qe0a1 | 95 | Histidyl-tRNA synthetase (HisRS), C-terminal domai | 91.71 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 90.43 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 89.02 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 88.88 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 86.61 |
| >d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Histidyl-tRNA synthetase (HisRS) species: Escherichia coli [TaxId: 562]
Probab=99.72 E-value=3.4e-18 Score=179.17 Aligned_cols=92 Identities=32% Similarity=0.523 Sum_probs=80.7
Q ss_pred HHHHHHHHHHHHHHHHHHHhCCCceEEEecCCCCCCCCcceeEEEEEEcCC-CcceEeeccchhhhhhhcCCCCCCCCcc
Q psy1221 41 KQAKEGLEAIKLLFHYCQIYGLKDTIVFDLSLARGLDYYTGVIYEAVLKDQ-AVGSVAGGGRYDNLVGMFDPKNKTTPCV 119 (690)
Q Consensus 41 ~~~~~~l~~l~~~~~~l~~~g~~~~i~~d~~~~r~~~YYtG~vFe~~~~~~-~~~~i~~GGRYD~L~~~f~~~~~~~~~~ 119 (690)
.....+++++..+...+...++. +.+|++++||++||||+|||+|+++. ..++||+|||||+|+++||+ +.+||
T Consensus 225 ~~~~~~~~~l~~~~~~l~~~~i~--~~id~~~~r~~~YYtGivFe~~~~~~g~~~~i~~GGRYD~L~~~f~g--~~~pA- 299 (322)
T d1kmma2 225 YLDEESREHFAGLCKLLESAGIA--YTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGG--RATPA- 299 (322)
T ss_dssp TCCHHHHHHHHHHHHHHHHHTCC--EEECTTCCCSSSCCCSEEEEEECTTCSSSSEEEEEEECTTHHHHTTS--CCCCE-
T ss_pred hhhhHHHHHHHHHHHHhhhccee--eeeecccccCCCCCCCcEEEEEeCCCCCcCeeecccchHHHHHhcCC--CCCCe-
Confidence 34467889999999999999987 99999999999999999999999873 35689999999999999985 45675
Q ss_pred chhhhhhhhcccccccCcceeeeeHHHHHHHHHhhh
Q psy1221 120 AAKLLHEVQGLLETSCRSCREDIGVERLFSIIENRN 155 (690)
Q Consensus 120 g~~~~~~~~~~~~~~~~~~g~~~~~~~l~~~~~~~~ 155 (690)
|||||++|||+.++++.+
T Consensus 300 ------------------vGfsi~ld~l~~~l~~~~ 317 (322)
T d1kmma2 300 ------------------VGFAMGLERLVLLVQAVN 317 (322)
T ss_dssp ------------------EEEEEEHHHHHHHHHHHS
T ss_pred ------------------EEEEecHHHHHHHHHhhC
Confidence 559999999999999864
|
| >d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kmma1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|