Psyllid ID: psy12663
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 242022400 | 259 | protein twisted gastrulation precursor, | 0.654 | 0.270 | 0.633 | 1e-18 | |
| 321459837 | 266 | hypothetical protein DAPPUDRAFT_202071 [ | 0.635 | 0.255 | 0.652 | 2e-17 | |
| 312379619 | 273 | hypothetical protein AND_08472 [Anophele | 0.672 | 0.263 | 0.583 | 2e-16 | |
| 357631164 | 240 | hypothetical protein KGM_18788 [Danaus p | 0.588 | 0.262 | 0.632 | 5e-16 | |
| 193671723 | 234 | PREDICTED: protein twisted gastrulation- | 0.598 | 0.273 | 0.656 | 7e-16 | |
| 383865192 | 244 | PREDICTED: protein twisted gastrulation- | 0.626 | 0.274 | 0.602 | 8e-16 | |
| 156538991 | 248 | PREDICTED: protein twisted gastrulation- | 0.672 | 0.290 | 0.592 | 8e-16 | |
| 322795178 | 278 | hypothetical protein SINV_00211 [Solenop | 0.644 | 0.248 | 0.565 | 1e-15 | |
| 307200071 | 248 | Protein twisted gastrulation [Harpegnath | 0.626 | 0.270 | 0.623 | 1e-15 | |
| 189235436 | 239 | PREDICTED: similar to conserved hypothet | 0.616 | 0.276 | 0.617 | 1e-15 |
| >gi|242022400|ref|XP_002431628.1| protein twisted gastrulation precursor, putative [Pediculus humanus corporis] gi|212516936|gb|EEB18890.1| protein twisted gastrulation precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 97.4 bits (241), Expect = 1e-18, Method: Compositional matrix adjust.
Identities = 45/71 (63%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
Query: 28 LRLILLSLSSLVLAIVLFSSTSKGCNEAVCASIVSKCMITQSCKCDMKNCTCCKDCLNCL 87
+R+IL +++ + AI++F+S + CNEAVCAS+VSKCM+TQSCKCD+KNC+CC++C CL
Sbjct: 4 IRIILFTVTISISAILIFNSV-ESCNEAVCASVVSKCMLTQSCKCDLKNCSCCQECFTCL 62
Query: 88 SYLWTECCSCV 98
SYL+TECCSCV
Sbjct: 63 SYLYTECCSCV 73
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321459837|gb|EFX70886.1| hypothetical protein DAPPUDRAFT_202071 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|312379619|gb|EFR25835.1| hypothetical protein AND_08472 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|357631164|gb|EHJ78812.1| hypothetical protein KGM_18788 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|193671723|ref|XP_001948538.1| PREDICTED: protein twisted gastrulation-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383865192|ref|XP_003708059.1| PREDICTED: protein twisted gastrulation-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|156538991|ref|XP_001600362.1| PREDICTED: protein twisted gastrulation-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|322795178|gb|EFZ18000.1| hypothetical protein SINV_00211 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307200071|gb|EFN80417.1| Protein twisted gastrulation [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|189235436|ref|XP_001812776.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270004290|gb|EFA00738.1| hypothetical protein TcasGA2_TC003620 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| FB|FBgn0000394 | 257 | cv "crossveinless" [Drosophila | 0.476 | 0.198 | 0.705 | 6.5e-19 | |
| FB|FBgn0003865 | 249 | tsg "twisted gastrulation" [Dr | 0.448 | 0.192 | 0.666 | 2e-17 | |
| UNIPROTKB|Q98T89 | 224 | TWSG1 "Twisted gastrulation pr | 0.476 | 0.227 | 0.566 | 2.3e-14 | |
| ZFIN|ZDB-GENE-010509-2 | 217 | twsg1a "twisted gastrulation h | 0.448 | 0.221 | 0.58 | 4.9e-14 | |
| MGI|MGI:2137520 | 222 | Twsg1 "twisted gastrulation ho | 0.467 | 0.225 | 0.557 | 1e-13 | |
| RGD|1311215 | 222 | Twsg1 "twisted gastrulation ho | 0.467 | 0.225 | 0.557 | 1e-13 | |
| UNIPROTKB|Q0VD44 | 223 | TWSG1 "Uncharacterized protein | 0.467 | 0.224 | 0.557 | 1.3e-13 | |
| UNIPROTKB|Q9GZX9 | 223 | TWSG1 "Twisted gastrulation pr | 0.467 | 0.224 | 0.557 | 1.3e-13 | |
| UNIPROTKB|F1SMA0 | 223 | TWSG1 "Uncharacterized protein | 0.467 | 0.224 | 0.557 | 1.3e-13 | |
| ZFIN|ZDB-GENE-020812-3 | 222 | twsg1b "twisted gastrulation h | 0.439 | 0.211 | 0.571 | 2.1e-13 |
| FB|FBgn0000394 cv "crossveinless" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 227 (85.0 bits), Expect = 6.5e-19, P = 6.5e-19
Identities = 36/51 (70%), Positives = 43/51 (84%)
Query: 48 TSKGCNEAVCASIVSKCMITQSCKCDMKNCTCCKDCLNCLSYLWTECCSCV 98
T + CNE VCASIVSKCM+TQSCKC++KNC+CCK+CL CL + ECCSCV
Sbjct: 23 TVESCNEVVCASIVSKCMLTQSCKCELKNCSCCKECLKCLGKNYEECCSCV 73
|
|
| FB|FBgn0003865 tsg "twisted gastrulation" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q98T89 TWSG1 "Twisted gastrulation protein homolog 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010509-2 twsg1a "twisted gastrulation homolog 1a (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2137520 Twsg1 "twisted gastrulation homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1311215 Twsg1 "twisted gastrulation homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VD44 TWSG1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GZX9 TWSG1 "Twisted gastrulation protein homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SMA0 TWSG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020812-3 twsg1b "twisted gastrulation homolog 1b (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
No hit with probability above 80.00
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00