TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. Pongo abelii (taxid: 9601)
>sp|Q9UNL2|SSRG_HUMAN Translocon-associated protein subunit gamma OS=Homo sapiens GN=SSR3 PE=1 SV=1
Score = 53.9 bits (128), Expect = 3e-07, Method: Compositional matrix adjust.
Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 5/81 (6%)
Query: 4 KLSDDKKMSKKEKDERILWKKNEVADFEATTFSIFYNNALFLAIVIFLSFYILKSFTPTF 63
K+ D KK + +K+ + L V EA SI YNNA+FL V SF I K+ +
Sbjct: 94 KVGDKKKFAAAQKEVQAL-----VTSHEAIAASIMYNNAVFLICVSIFSFIIFKNVPLVY 148
Query: 64 NYIFSLWISAGFLALLSTGTK 84
NYI S+ + AG + LST +K
Sbjct: 149 NYIISISLGAGLTSFLSTSSK 169
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.325 0.136 0.397
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28,912,331
Number of Sequences: 539616
Number of extensions: 930339
Number of successful extensions: 4529
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 4516
Number of HSP's gapped (non-prelim): 18
length of query: 84
length of database: 191,569,459
effective HSP length: 55
effective length of query: 29
effective length of database: 161,890,579
effective search space: 4694826791
effective search space used: 4694826791
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)
TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.
Dictyostelium discoideum (taxid: 44689)
Close Homologs in the Non-Redundant Database Detected by BLAST
This family consists of several eukaryotic translocon-associated protein, gamma subunit (TRAP-gamma) sequences. The translocation site (translocon), at which nascent polypeptides pass through the endoplasmic reticulum membrane, contains a component previously called 'signal sequence receptor' that is now renamed as 'translocon-associated protein' (TRAP). The TRAP complex is comprised of four membrane proteins alpha, beta, gamma and delta which are present in a stoichiometric relation, and are genuine neighbors in intact microsomes. The gamma subunit is predicted to span the membrane four times. Length = 170
Probab=100.00 E-value=8.7e-48 Score=282.14 Aligned_cols=82 Identities=78% Similarity=1.204 Sum_probs=80.8
Q ss_pred CccccccccccchHHHHHHHHHHhhhhhcccceeeehhhhhHHHHHHHHHHHHHHhccCCccchhhhHHHHHHHHHHHHh
Q psy12747 1 MAKKLSDDKKMSKKEKDERILWKKNEVADFEATTFSIFYNNALFLAIVIFLSFYILKSFTPTFNYIFSLWISAGFLALLS 80 (84)
Q Consensus 1 ~~~~~~~dkKmskKekderil~kkneVad~Eat~fSIFYnNalFl~l~i~~SF~llk~~~p~~NYi~S~~~aagl~a~lS 80 (84)
||+|++|||||++||||||||||||||||||||+|||||||||||++++++|||+|||++|++||++|+++|||++||||
T Consensus 89 v~~k~~~dKK~~~kekderil~kkneVad~Ea~~~SifynNalFl~l~i~~SF~~lk~~~p~~Nyi~S~~~asgl~allS 168 (170)
T PF07074_consen 89 VNKKLADDKKMSKKEKDERILWKKNEVADYEATTFSIFYNNALFLALVIVFSFYLLKNFSPVFNYIFSMSGASGLVALLS 168 (170)
T ss_pred HHHhhccccccchHHHHHHHHHHhhhhhhhhheeeehhhhchHHHHHHHHHHHHHHccCCccceeeehHHHHHHHHHHHh
Confidence 57899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cc
Q psy12747 81 TG 82 (84)
Q Consensus 81 T~ 82 (84)
||
T Consensus 169 Tg 170 (170)
T PF07074_consen 169 TG 170 (170)
T ss_pred CC
Confidence 98
The translocation site (translocon), at which nascent polypeptides pass through the endoplasmic reticulum membrane, contains a component previously called 'signal sequence receptor' that is now renamed as 'translocon-associated protein' (TRAP). The TRAP complex is comprised of four membrane proteins alpha, beta, gamma and delta, which are present in a stoichiometric relation, and are genuine neighbours in intact microsomes. The gamma subunit is predicted to span the membrane four times [].; GO: 0006613 cotranslational protein targeting to membrane, 0005784 Sec61 translocon complex, 0030176 integral to endoplasmic reticulum membrane
>PF11674 DUF3270: Protein of unknown function (DUF3270); InterPro: IPR021688 This family of proteins with unknown function appears to be restricted to Streptococcus
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This predicted integral membrane protein is designated stage II sporulation protein M.
>PF15012 DUF4519: Domain of unknown function (DUF4519)
