Psyllid ID: psy12810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MIWDHQLEKRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATSLRQ
ccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEcccHHHHHHHHHHHcccEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccEEEccccccccccHHHHHHcccEEEEcccccccccccccccccccccHHccccHHHHHHHcccccccccccccccEEEEcccccHHHHHHHHccc
cHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHcccEEEEEEccccccHHHHcccccccccHHHHHHHHHHHHHcccEEEEccEEcccccHHHHHHHccEEEcccccHHHHHHHcccEEEEEEccccccHHHHcccccccccHHHHHHHHHHHHHcccEEEEccEEcccccHHHHHHHccEEEEEccccccccccccccccccHHHHHHHHHHHccHHccccccccEEccccEEEEEEccccccccHHccccc
MIWDHQLEKRLDntliqecepvlsgkvpridleytINNECRAFTATLSYHISIQHLVGhsvtvferndrvggllqygiptmkLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAkvtnhtpqsdnqtkhcpplivnIVGHSVTvferndrvggllqygiptmkLSKEVVQRRVKLLAAEGiefktninvgkdIAAKELYEEFDALLLCtgatwprdlpipgrqlsGIYFAMSFLESWQKkqmgnenvspisakdknvivigggdtgcdCIATSLRQ
miwdhqlekrldntliqecepvlsgkvpriDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQygiptmklskEVVQRRVKLLAaegiefktninvGKDIAAKVTNhtpqsdnqtkhcpPLIVNIVGHSVTVFERNDRVGGLLQygiptmklskEVVQRRVKLLaaegiefktninvgkDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATSLRQ
MIWDHQLEKRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATSLRQ
********KRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVT**********KHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKK***********AKDKNVIVIGGGDTGCDCIA*****
MIWDHQLEKRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATSLR*
MIWDHQLEKRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTN********TKHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATSLRQ
MIWDHQLEKRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIWDHQLEKRLDNTLIQECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTGCDCIATSLRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query276 2.2.26 [Sep-21-2011]
O34399 493 Glutamate synthase [NADPH yes N/A 0.514 0.288 0.576 1e-39
Q03460 2194 Glutamate synthase [NADH] N/A N/A 0.514 0.064 0.551 3e-38
Q9LV03 2208 Glutamate synthase 1 [NAD yes N/A 0.514 0.064 0.551 4e-38
Q9C102 2111 Putative glutamate syntha yes N/A 0.514 0.067 0.547 8e-38
Q0JKD0 2167 Glutamate synthase 1 [NAD yes N/A 0.514 0.065 0.564 1e-37
Q0DG35 2188 Glutamate synthase 2 [NAD no N/A 0.514 0.064 0.537 1e-37
Q12680 2145 Glutamate synthase [NADH] yes N/A 0.514 0.066 0.537 2e-36
P96219 488 Glutamate synthase [NADPH yes N/A 0.503 0.284 0.506 7e-36
O08340 413 Putative glutamate syntha yes N/A 0.5 0.334 0.446 3e-27
Q05756 482 Glutamate synthase [NADPH yes N/A 0.496 0.284 0.447 5e-26
>sp|O34399|GLTB_BACSU Glutamate synthase [NADPH] small chain OS=Bacillus subtilis (strain 168) GN=gltB PE=2 SV=2 Back     alignment and function desciption
 Score =  163 bits (413), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/144 (57%), Positives = 103/144 (71%), Gaps = 2/144 (1%)

Query: 135 VNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIA 194
           +N  GHSVTVFER DR GGLL YGIP MKL K +V+RR+KLL  EGI+F TN  +G DI 
Sbjct: 171 LNQAGHSVTVFERADRAGGLLTYGIPNMKLEKGIVERRIKLLTQEGIDFVTNTEIGVDIT 230

Query: 195 AKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGN--ENVSPISA 252
           A EL E+FDA++LCTGA   RDL I GR   G+++AM +L    K  + +  ++   I A
Sbjct: 231 ADELKEQFDAVILCTGAQKQRDLLIEGRDSKGVHYAMDYLTLATKSYLDSNFKDKQFIDA 290

Query: 253 KDKNVIVIGGGDTGCDCIATSLRQ 276
           K K+VIVIGGGDTG DC+AT+LRQ
Sbjct: 291 KGKDVIVIGGGDTGADCVATALRQ 314

Bacillus subtilis (strain 168) (taxid: 224308)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 3
>sp|Q03460|GLSN_MEDSA Glutamate synthase [NADH], amyloplastic OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|Q9LV03|GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana GN=GLT1 PE=1 SV=2 Back     alignment and function description
>sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 Back     alignment and function description
>sp|Q0JKD0|GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0681900 PE=2 SV=1 Back     alignment and function description
>sp|Q0DG35|GLT2_ORYSJ Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0555600 PE=2 SV=2 Back     alignment and function description
>sp|Q12680|GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLT1 PE=1 SV=2 Back     alignment and function description
>sp|P96219|GLTD_MYCTU Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis GN=gltD PE=3 SV=1 Back     alignment and function description
>sp|O08340|GLTD_RHOSH Putative glutamate synthase [NADPH] small chain OS=Rhodobacter sphaeroides GN=gltD PE=3 SV=1 Back     alignment and function description
>sp|Q05756|GLTD_AZOBR Glutamate synthase [NADPH] small chain OS=Azospirillum brasilense GN=gltD PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
242015925 2068 ferredoxin-dependent glutamate synthase 0.514 0.068 0.832 2e-65
443428884 445 putative glutamate synthase, partial [La 0.514 0.319 0.816 6e-63
91084143 2029 PREDICTED: similar to glutamate synthase 0.510 0.069 0.809 3e-62
322792674 2065 hypothetical protein SINV_12348 [Solenop 0.514 0.068 0.770 2e-59
383865379 2063 PREDICTED: putative glutamate synthase [ 0.507 0.067 0.767 3e-59
383865377 2063 PREDICTED: putative glutamate synthase [ 0.507 0.067 0.767 3e-59
332030526 2061 Putative glutamate synthase [Acromyrmex 0.507 0.067 0.746 1e-58
328721168 2080 PREDICTED: putative glutamate synthase [ 0.514 0.068 0.746 3e-57
340711712 2066 PREDICTED: putative glutamate synthase [ 0.507 0.067 0.739 3e-57
380019061 2066 PREDICTED: putative glutamate synthase [ 0.514 0.068 0.75 1e-56
>gi|242015925|ref|XP_002428593.1| ferredoxin-dependent glutamate synthase 2, putative [Pediculus humanus corporis] gi|212513237|gb|EEB15855.1| ferredoxin-dependent glutamate synthase 2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 134/143 (93%), Gaps = 1/143 (0%)

Query: 135  VNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIA 194
            +N VGH   VFERNDR+GGLLQYGIP+MKLSK+VVQRRV+LLA EGIEFKTNINVGKDI+
Sbjct: 1732 LNKVGHQTVVFERNDRIGGLLQYGIPSMKLSKQVVQRRVQLLAQEGIEFKTNINVGKDIS 1791

Query: 195  AKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNE-NVSPISAK 253
            AKELY+EFDA+LLCTGATWPRDLPIPGRQL GIY+A+SFLE+WQKKQMGNE ++S + AK
Sbjct: 1792 AKELYDEFDAVLLCTGATWPRDLPIPGRQLQGIYYAVSFLETWQKKQMGNEVDLSNMLAK 1851

Query: 254  DKNVIVIGGGDTGCDCIATSLRQ 276
            DKNVI+IGGGDTGCDCIATSLRQ
Sbjct: 1852 DKNVIIIGGGDTGCDCIATSLRQ 1874

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|443428884|gb|AGC92241.1| putative glutamate synthase, partial [Laodelphax striatella] Back     alignment and taxonomy information
>gi|91084143|ref|XP_970053.1| PREDICTED: similar to glutamate synthase [Tribolium castaneum] gi|270006644|gb|EFA03092.1| hypothetical protein TcasGA2_TC013000 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322792674|gb|EFZ16548.1| hypothetical protein SINV_12348 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383865379|ref|XP_003708151.1| PREDICTED: putative glutamate synthase [NADPH]-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383865377|ref|XP_003708150.1| PREDICTED: putative glutamate synthase [NADPH]-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332030526|gb|EGI70214.1| Putative glutamate synthase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328721168|ref|XP_001948786.2| PREDICTED: putative glutamate synthase [NADPH]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340711712|ref|XP_003394415.1| PREDICTED: putative glutamate synthase [NADPH]-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380019061|ref|XP_003693435.1| PREDICTED: putative glutamate synthase [NADPH]-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
FB|FBgn0036663 2114 CG9674 [Drosophila melanogaste 0.510 0.066 0.725 3e-59
ASPGD|ASPL0000027159 2126 gltA [Emericella nidulans (tax 0.510 0.066 0.572 6e-43
TIGR_CMR|CPS_0762 496 CPS_0762 "glutamate synthase, 0.510 0.284 0.594 1.7e-41
POMBASE|SPAPB1E7.07 2111 glt1 "glutamate synthase Glt1 0.510 0.066 0.551 1.2e-40
SGD|S000002330 2145 GLT1 "NAD(+)-dependent glutama 0.510 0.065 0.541 2.7e-40
CGD|CAL0000516 2126 GLT1 [Candida albicans (taxid: 0.507 0.065 0.552 1.3e-38
UNIPROTKB|Q0JKD0 2167 LOC_Os01g48960 "Glutamate synt 0.510 0.065 0.568 1.3e-38
TAIR|locus:2178461 2208 GLT1 "NADH-dependent glutamate 0.510 0.063 0.554 2.2e-38
UNIPROTKB|Q9KPJ3 489 VC_2374 "Glutamate synthase, s 0.510 0.288 0.521 9.2e-36
TIGR_CMR|VC_2374 489 VC_2374 "glutamate synthase, s 0.510 0.288 0.521 9.2e-36
FB|FBgn0036663 CG9674 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 538 (194.4 bits), Expect = 3.0e-59, Sum P(2) = 3.0e-59
 Identities = 103/142 (72%), Positives = 122/142 (85%)

Query:   135 VNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIA 194
             +N  GH VTVFERNDRVGGLLQYGIPTMKLSKEVV+RRV L+A EGIEF+TN++VGKD+ 
Sbjct:  1785 LNRAGHFVTVFERNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKDLK 1844

Query:   195 AKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKD 254
             A++L +E+DA+LL TG+TWPRDLP+  R L GI+FAM FLE+ QKKQ+G +N   ISA  
Sbjct:  1845 AEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKN-DIISAAG 1903

Query:   255 KNVIVIGGGDTGCDCIATSLRQ 276
             KNVI+IGGGDTGCDCIATSLRQ
Sbjct:  1904 KNVIIIGGGDTGCDCIATSLRQ 1925
GO:0004355 "glutamate synthase (NADPH) activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0016040 "glutamate synthase (NADH) activity" evidence=IEA
GO:0010181 "FMN binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0006537 "glutamate biosynthetic process" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
ASPGD|ASPL0000027159 gltA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0762 CPS_0762 "glutamate synthase, NADH/NADPH, small subunit" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
POMBASE|SPAPB1E7.07 glt1 "glutamate synthase Glt1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000002330 GLT1 "NAD(+)-dependent glutamate synthase (GOGAT)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0000516 GLT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JKD0 LOC_Os01g48960 "Glutamate synthase 1 [NADH], chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2178461 GLT1 "NADH-dependent glutamate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPJ3 VC_2374 "Glutamate synthase, small subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2374 VC_2374 "glutamate synthase, small subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O34399GLTB_BACSU1, ., 4, ., 1, ., 1, 30.57630.51440.2880yesN/A
Q9C102GLT1_SCHPO1, ., 4, ., 1, ., 1, 30.54790.51440.0672yesN/A
P96219GLTD_MYCTU1, ., 4, ., 1, ., 1, 30.50690.50360.2848yesN/A
Q9LV03GLUT1_ARATH1, ., 4, ., 1, ., 1, 40.55100.51440.0643yesN/A
Q12680GLT1_YEAST1, ., 4, ., 1, ., 1, 40.53790.51440.0662yesN/A
Q0JKD0GLT1_ORYSJ1, ., 4, ., 1, ., 1, 40.56460.51440.0655yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
PRK12810 471 PRK12810, gltD, glutamate synthase subunit beta; R 6e-81
TIGR01317 485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 3e-66
COG0493 457 COG0493, GltD, NADPH-dependent glutamate synthase 1e-56
PRK11749 457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 4e-48
TIGR01318 467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 2e-35
PRK12769 654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 7e-31
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 2e-29
PRK12771 564 PRK12771, PRK12771, putative glutamate synthase (N 3e-29
TIGR01316 449 TIGR01316, gltA, glutamate synthase (NADPH), homot 3e-28
PRK12814 652 PRK12814, PRK12814, putative NADPH-dependent gluta 1e-25
PRK12809 639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 2e-25
PRK12831 464 PRK12831, PRK12831, putative oxidoreductase; Provi 6e-25
TIGR01317 485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 1e-24
PRK12778 752 PRK12778, PRK12778, putative bifunctional 2-polypr 1e-23
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 3e-22
PRK12770 352 PRK12770, PRK12770, putative glutamate synthase su 7e-22
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 3e-21
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 3e-21
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 2e-20
PRK13984 604 PRK13984, PRK13984, putative oxidoreductase; Provi 2e-20
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, Y 5e-16
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 6e-16
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 3e-14
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 3e-12
PRK12771 564 PRK12771, PRK12771, putative glutamate synthase (N 8e-12
PLN02852 491 PLN02852, PLN02852, ferredoxin-NADP+ reductase 3e-11
PRK12814 652 PRK12814, PRK12814, putative NADPH-dependent gluta 5e-10
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 1e-09
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 4e-09
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 4e-09
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 4e-09
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 6e-09
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 1e-08
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, Y 3e-08
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 1e-07
pfam07992 283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-07
COG0446 415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 1e-06
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 2e-05
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 3e-05
cd00982251 cd00982, gltB_C, gltb_C 4e-05
COG0446 415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 7e-05
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 5e-04
PRK09564 444 PRK09564, PRK09564, coenzyme A disulfide reductase 0.001
COG0070301 COG0070, GltB, Glutamate synthase domain 3 [Amino 0.002
PRK06292 460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.003
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information 
 Score =  251 bits (643), Expect = 6e-81
 Identities = 85/138 (61%), Positives = 107/138 (77%)

Query: 139 GHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKEL 198
           GH VTVFER DR+GGLL+YGIP  KL KEV+ RR++L+ AEGIEF+TN+ VGKDI A+EL
Sbjct: 166 GHKVTVFERADRIGGLLRYGIPDFKLEKEVIDRRIELMEAEGIEFRTNVEVGKDITAEEL 225

Query: 199 YEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVI 258
             E+DA+ L TGA  PRDL IPGR L G++FAM FL    ++ +G+E    ISAK K+V+
Sbjct: 226 LAEYDAVFLGTGAYKPRDLGIPGRDLDGVHFAMDFLIQNTRRVLGDETEPFISAKGKHVV 285

Query: 259 VIGGGDTGCDCIATSLRQ 276
           VIGGGDTG DC+ T++RQ
Sbjct: 286 VIGGGDTGMDCVGTAIRQ 303

Length = 471
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|215457 PLN02852, PLN02852, ferredoxin-NADP+ reductase Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|238482 cd00982, gltB_C, gltb_C Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|223148 COG0070, GltB, Glutamate synthase domain 3 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 276
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.97
PRK12831 464 putative oxidoreductase; Provisional 99.96
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 99.96
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.95
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.95
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.95
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 99.95
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.94
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 99.94
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.94
PRK13984 604 putative oxidoreductase; Provisional 99.94
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 99.94
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 99.93
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 99.93
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.93
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 99.93
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.93
KOG0399|consensus 2142 99.92
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 99.9
PLN02852 491 ferredoxin-NADP+ reductase 99.85
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 99.72
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.72
PRK12770 352 putative glutamate synthase subunit beta; Provisio 99.72
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.69
KOG1800|consensus 468 99.69
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.67
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.66
PTZ00188 506 adrenodoxin reductase; Provisional 99.66
KOG1335|consensus 506 99.64
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 99.64
KOG1399|consensus 448 99.62
PRK06370 463 mercuric reductase; Validated 99.62
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 99.61
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 99.61
PLN02546 558 glutathione reductase 99.61
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 99.6
PRK12831464 putative oxidoreductase; Provisional 99.6
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.6
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.6
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.59
PRK09564 444 coenzyme A disulfide reductase; Reviewed 99.59
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.58
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.58
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 99.58
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.57
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.56
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.56
PRK10262 321 thioredoxin reductase; Provisional 99.56
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.56
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 99.56
PRK07845 466 flavoprotein disulfide reductase; Reviewed 99.56
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.55
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.55
PRK06370 463 mercuric reductase; Validated 99.55
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.55
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.55
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 99.55
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 99.54
TIGR02053 463 MerA mercuric reductase. This model represents the 99.54
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.54
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 99.53
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 99.53
PRK06116 450 glutathione reductase; Validated 99.53
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.53
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.52
PRK13748 561 putative mercuric reductase; Provisional 99.52
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.52
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.52
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.52
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 99.51
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.51
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.51
PRK06116 450 glutathione reductase; Validated 99.51
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.51
PTZ00058 561 glutathione reductase; Provisional 99.51
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.51
TIGR02053 463 MerA mercuric reductase. This model represents the 99.51
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 99.51
PLN02507 499 glutathione reductase 99.5
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.5
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.5
PRK14727 479 putative mercuric reductase; Provisional 99.49
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 99.49
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 99.49
PTZ00058 561 glutathione reductase; Provisional 99.48
PRK14694 468 putative mercuric reductase; Provisional 99.48
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.47
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 99.47
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 99.46
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.46
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.46
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 99.46
PRK13512 438 coenzyme A disulfide reductase; Provisional 99.45
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.44
KOG0399|consensus2142 99.41
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.41
PRK13748 561 putative mercuric reductase; Provisional 99.41
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 99.4
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 99.39
PRK07846 451 mycothione reductase; Reviewed 99.39
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 99.39
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.39
PRK14727 479 putative mercuric reductase; Provisional 99.38
PTZ00052 499 thioredoxin reductase; Provisional 99.38
PTZ00052 499 thioredoxin reductase; Provisional 99.37
PRK10262321 thioredoxin reductase; Provisional 99.37
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.35
PRK14694 468 putative mercuric reductase; Provisional 99.34
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 99.34
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.34
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.34
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 99.31
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.28
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.28
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.27
KOG1336|consensus 478 99.27
KOG0405|consensus 478 99.26
PRK13984604 putative oxidoreductase; Provisional 99.26
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 99.25
PRK07846 451 mycothione reductase; Reviewed 99.24
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.24
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.24
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 99.19
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.19
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.17
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.17
PRK09564 444 coenzyme A disulfide reductase; Reviewed 99.17
PRK13512 438 coenzyme A disulfide reductase; Provisional 99.16
KOG0405|consensus 478 99.15
KOG0404|consensus 322 99.15
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.13
KOG1335|consensus 506 99.13
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.07
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 99.06
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.05
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.03
KOG2495|consensus 491 98.99
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.97
KOG4716|consensus 503 98.97
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.92
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.92
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.88
COG2081 408 Predicted flavoproteins [General function predicti 98.88
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.86
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.77
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.73
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.72
PLN02852 491 ferredoxin-NADP+ reductase 98.72
PTZ00188 506 adrenodoxin reductase; Provisional 98.66
KOG4716|consensus 503 98.64
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.64
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.62
KOG0404|consensus322 98.56
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.52
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.42
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 98.32
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.29
PRK09897 534 hypothetical protein; Provisional 98.23
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.22
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.21
PLN02507 499 glutathione reductase 98.21
PLN02546 558 glutathione reductase 98.21
COG3486 436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.19
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.19
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 98.15
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 98.15
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 98.14
TIGR00275 400 flavoprotein, HI0933 family. The model when search 98.14
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.14
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.14
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.13
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 98.11
PTZ00153 659 lipoamide dehydrogenase; Provisional 98.09
KOG1336|consensus 478 98.07
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.04
PF14691111 Fer4_20: Dihydroprymidine dehydrogenase domain II, 97.99
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.98
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 97.94
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 97.93
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.91
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.81
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.79
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.78
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 97.77
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.73
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.71
KOG1346|consensus 659 97.71
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.7
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 97.68
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.68
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.62
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.62
KOG2755|consensus 334 97.59
KOG1800|consensus 468 97.59
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.57
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.56
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.52
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 97.51
PRK11728 393 hydroxyglutarate oxidase; Provisional 97.51
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.5
PRK08274 466 tricarballylate dehydrogenase; Validated 97.5
PRK06847 375 hypothetical protein; Provisional 97.49
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 97.49
PRK10157 428 putative oxidoreductase FixC; Provisional 97.48
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.47
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.45
PLN02661 357 Putative thiazole synthesis 97.41
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 97.4
PLN02529 738 lysine-specific histone demethylase 1 97.4
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.38
KOG2495|consensus491 97.36
PRK06834 488 hypothetical protein; Provisional 97.35
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 97.33
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.33
PRK10015 429 oxidoreductase; Provisional 97.3
COG3349 485 Uncharacterized conserved protein [Function unknow 97.3
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.28
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.26
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.26
PRK07121 492 hypothetical protein; Validated 97.25
PRK07804 541 L-aspartate oxidase; Provisional 97.25
PRK06184 502 hypothetical protein; Provisional 97.24
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.22
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.21
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.19
PLN02463 447 lycopene beta cyclase 97.18
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.17
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 97.14
KOG1399|consensus 448 97.14
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 97.13
PRK08244 493 hypothetical protein; Provisional 97.13
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 97.11
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.11
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.11
PRK06175 433 L-aspartate oxidase; Provisional 97.11
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 97.09
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.06
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.06
PRK11445 351 putative oxidoreductase; Provisional 97.04
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.01
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.01
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.01
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.98
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 96.98
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.96
PRK08071 510 L-aspartate oxidase; Provisional 96.95
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.93
PRK08163 396 salicylate hydroxylase; Provisional 96.93
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 96.92
PLN02697 529 lycopene epsilon cyclase 96.91
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.89
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 96.88
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.88
PRK11883 451 protoporphyrinogen oxidase; Reviewed 96.88
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.88
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.87
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.86
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 96.85
PRK08401 466 L-aspartate oxidase; Provisional 96.84
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 96.84
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.83
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.81
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.8
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 96.78
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.78
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.74
PRK07395 553 L-aspartate oxidase; Provisional 96.74
PRK07233 434 hypothetical protein; Provisional 96.72
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 96.71
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.7
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.7
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 96.67
PLN02815 594 L-aspartate oxidase 96.67
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 96.66
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.65
PRK07588 391 hypothetical protein; Provisional 96.65
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.65
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.63
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.61
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 96.6
PRK07208 479 hypothetical protein; Provisional 96.6
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.59
PRK06185 407 hypothetical protein; Provisional 96.57
KOG0029|consensus 501 96.57
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 96.56
PLN02487 569 zeta-carotene desaturase 96.55
PRK07190 487 hypothetical protein; Provisional 96.53
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 96.52
PRK07512 513 L-aspartate oxidase; Provisional 96.49
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 96.47
PLN02576 496 protoporphyrinogen oxidase 96.45
KOG0029|consensus 501 96.45
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 96.44
PRK06126 545 hypothetical protein; Provisional 96.42
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 96.39
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 96.37
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 96.35
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 96.35
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.32
PLN02576 496 protoporphyrinogen oxidase 96.3
PLN02268 435 probable polyamine oxidase 96.28
PRK11883 451 protoporphyrinogen oxidase; Reviewed 96.24
PRK08275 554 putative oxidoreductase; Provisional 96.19
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 96.17
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.17
PRK07208 479 hypothetical protein; Provisional 96.15
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.14
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 96.11
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 96.1
COG3349 485 Uncharacterized conserved protein [Function unknow 96.08
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.05
PRK09077 536 L-aspartate oxidase; Provisional 96.02
PRK07233 434 hypothetical protein; Provisional 96.01
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.01
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 95.96
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.94
TIGR03197 381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 95.93
COG2081 408 Predicted flavoproteins [General function predicti 95.91
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 95.87
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 95.82
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 95.77
PLN02268 435 probable polyamine oxidase 95.75
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.68
PRK12416 463 protoporphyrinogen oxidase; Provisional 95.67
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 95.62
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.6
PRK13977 576 myosin-cross-reactive antigen; Provisional 95.54
COG2907 447 Predicted NAD/FAD-binding protein [General functio 95.53
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 95.5
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 95.49
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.48
PRK10015 429 oxidoreductase; Provisional 95.38
PLN02328 808 lysine-specific histone demethylase 1 homolog 95.38
KOG2820|consensus 399 95.27
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 95.23
PLN02612 567 phytoene desaturase 95.23
PRK10157 428 putative oxidoreductase FixC; Provisional 95.23
PLN02568 539 polyamine oxidase 95.22
PLN02487 569 zeta-carotene desaturase 95.19
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 95.19
PRK07045 388 putative monooxygenase; Reviewed 95.18
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 95.18
PRK06753 373 hypothetical protein; Provisional 95.15
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 95.13
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 95.12
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 94.98
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.96
COG0579 429 Predicted dehydrogenase [General function predicti 94.94
PRK12416 463 protoporphyrinogen oxidase; Provisional 94.93
TIGR03467 419 HpnE squalene-associated FAD-dependent desaturase. 94.92
KOG2415|consensus 621 94.92
PLN02661357 Putative thiazole synthesis 94.9
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 94.86
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 94.81
PRK08163 396 salicylate hydroxylase; Provisional 94.8
PRK09126 392 hypothetical protein; Provisional 94.78
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 94.73
PLN02676 487 polyamine oxidase 94.72
PRK08013 400 oxidoreductase; Provisional 94.71
COG3573 552 Predicted oxidoreductase [General function predict 94.68
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 94.67
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.67
PRK07236 386 hypothetical protein; Provisional 94.67
PLN02612 567 phytoene desaturase 94.67
PRK06753 373 hypothetical protein; Provisional 94.63
PLN02568 539 polyamine oxidase 94.62
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.61
PLN02529 738 lysine-specific histone demethylase 1 94.61
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 94.61
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 94.59
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 94.55
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 94.54
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 94.49
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 94.49
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 94.48
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.48
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 94.37
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 94.33
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 94.31
PRK07538 413 hypothetical protein; Provisional 94.27
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 94.27
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.24
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 94.23
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.19
PRK07045 388 putative monooxygenase; Reviewed 94.17
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 94.13
PRK06126 545 hypothetical protein; Provisional 94.11
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.11
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 94.06
PRK09126 392 hypothetical protein; Provisional 94.05
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 94.04
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 93.96
PRK05868 372 hypothetical protein; Validated 93.95
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 93.92
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.88
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.87
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 93.86
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 93.84
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 93.83
PRK06475 400 salicylate hydroxylase; Provisional 93.81
PRK05868 372 hypothetical protein; Validated 93.77
PRK07538 413 hypothetical protein; Provisional 93.76
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 93.75
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.72
PRK07588 391 hypothetical protein; Provisional 93.69
PLN03000 881 amine oxidase 93.69
KOG1346|consensus 659 93.68
PRK06847 375 hypothetical protein; Provisional 93.65
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 93.65
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 93.64
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.63
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.62
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 93.55
PRK08013 400 oxidoreductase; Provisional 93.55
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 93.52
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 93.51
KOG2404|consensus 477 93.49
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.48
PRK06475 400 salicylate hydroxylase; Provisional 93.47
TIGR00275 400 flavoprotein, HI0933 family. The model when search 93.47
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 93.47
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 93.45
PLN02676 487 polyamine oxidase 93.43
PRK12839 572 hypothetical protein; Provisional 93.43
PTZ00383 497 malate:quinone oxidoreductase; Provisional 93.41
PRK07236 386 hypothetical protein; Provisional 93.3
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 93.29
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 93.21
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 93.18
PRK06184 502 hypothetical protein; Provisional 93.17
PLN02328 808 lysine-specific histone demethylase 1 homolog 93.15
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 93.14
PLN02976 1713 amine oxidase 93.13
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 93.11
PRK07121 492 hypothetical protein; Validated 93.05
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 93.04
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.03
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 93.02
PRK13977 576 myosin-cross-reactive antigen; Provisional 92.96
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 92.95
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 92.92
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 92.88
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 92.86
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 92.73
KOG0685|consensus 498 92.7
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 92.69
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 92.68
PLN02985 514 squalene monooxygenase 92.6
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 92.52
PRK08244 493 hypothetical protein; Provisional 92.51
PRK12842 574 putative succinate dehydrogenase; Reviewed 92.5
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.5
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 92.48
KOG1276|consensus 491 92.46
PRK08274 466 tricarballylate dehydrogenase; Validated 92.39
PTZ00367 567 squalene epoxidase; Provisional 92.38
KOG1276|consensus 491 92.34
KOG2853|consensus 509 92.29
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 92.23
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 92.21
PRK08294 634 phenol 2-monooxygenase; Provisional 92.14
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 92.14
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 92.03
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 91.99
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 91.86
PRK11728 393 hydroxyglutarate oxidase; Provisional 91.85
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.79
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 91.78
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 91.7
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 91.63
PLN03000 881 amine oxidase 91.58
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 91.58
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.57
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 91.54
COG2907 447 Predicted NAD/FAD-binding protein [General functio 91.48
PRK08132 547 FAD-dependent oxidoreductase; Provisional 91.38
KOG3851|consensus 446 91.32
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.32
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 91.29
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 91.26
PRK06185 407 hypothetical protein; Provisional 91.25
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 91.15
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 91.1
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 91.08
PLN02463 447 lycopene beta cyclase 91.02
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 91.02
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 91.0
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 90.94
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 90.79
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 90.76
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 90.64
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 90.58
PLN02464 627 glycerol-3-phosphate dehydrogenase 90.55
PLN02976 1713 amine oxidase 90.53
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 90.35
PRK11445 351 putative oxidoreductase; Provisional 90.33
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 90.31
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 90.22
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 90.16
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.14
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information 
Probab=99.97  E-value=5.7e-30  Score=250.22  Aligned_cols=191  Identities=27%  Similarity=0.354  Sum_probs=152.0

Q ss_pred             Ccchh--HHHhhhhhhccccccceeeccccchhcccccc-------------------ccccc-----ccchhchHHHHH
Q psy12810          1 MIWDH--QLEKRLDNTLIQECEPVLSGKVPRIDLEYTIN-------------------NECRA-----FTATLSYHISIQ   54 (276)
Q Consensus         1 ~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------~~~~~-----~paGl~aA~~~a   54 (276)
                      .||||  |||.+|.+.  +  +||.|+.||||..|+.+.                   ++...     +||||+||.. |
T Consensus       251 rVCp~~~~CE~~C~~~--~--~pV~I~~ler~i~d~~~~~~~~~~~~~~~~~~~~~~~~gkkVaVIGsGPAGLsaA~~-L  325 (944)
T PRK12779        251 RVCPQELQCQGVCTHT--K--RPIEIGQLEWYLPQHEKLVNPNANERFAGRISPWAAAVKPPIAVVGSGPSGLINAYL-L  325 (944)
T ss_pred             CcCCCccCHHHhccCC--C--cCcchhHHHHHHHHHHHhhchhhhhcccccccccccCCCCeEEEECCCHHHHHHHHH-H
Confidence            48999  799999998  6  799999999999887321                   11111     6999999999 8


Q ss_pred             hhCCCeEEEeccCCCCCceeeecCCCCCCCHHHHHHHHHHHHhCCCeEEeccccCccchhhhccCCCCCCCCCCCCcchh
Q psy12810         55 HLVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLI  134 (276)
Q Consensus        55 a~~G~~V~l~Ek~~~lGG~~~~~~~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~~v~v~iiG~gp~~~g~~Gl~~A~~  134 (276)
                      +++||+|||||+.+.+||+++||+|.+++++++++++.++++++||+|++|+.+++++.+                    
T Consensus       326 ar~G~~VtVfE~~~~~GG~l~yGIP~~rlp~~vi~~~i~~l~~~Gv~f~~n~~vG~dit~--------------------  385 (944)
T PRK12779        326 AVEGFPVTVFEAFHDLGGVLRYGIPEFRLPNQLIDDVVEKIKLLGGRFVKNFVVGKTATL--------------------  385 (944)
T ss_pred             HHCCCeEEEEeeCCCCCceEEccCCCCcChHHHHHHHHHHHHhhcCeEEEeEEeccEEeH--------------------
Confidence            999999999999999999999999999999999999999999999999988754332211                    


Q ss_pred             hhhCCcEEEEEcCCCccceeeeecCCCCCCcHHHHHHHHHHHHhcCcEEEeeeeeccccchhhhhcccCEEEEcCCCCCC
Q psy12810        135 VNIVGHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWP  214 (276)
Q Consensus       135 l~~~G~~Vtvie~~~~~gg~~~~~~~~~~~~~~~~~~~~~~l~~~gv~i~~~~~v~~~~~~~~~~~~~D~vVlAtG~~~p  214 (276)
                                                                                  .+-....||+||+|||++.|
T Consensus       386 ------------------------------------------------------------~~l~~~~yDAV~LAtGA~~p  405 (944)
T PRK12779        386 ------------------------------------------------------------EDLKAAGFWKIFVGTGAGLP  405 (944)
T ss_pred             ------------------------------------------------------------HHhccccCCEEEEeCCCCCC
Confidence                                                                        00011359999999999558


Q ss_pred             CCCCCCCcCCCCeeehHHHHHHHHHhhcCCCCCC-C-CCCCCCeEEEEcCChHHHHHHHHhhcC
Q psy12810        215 RDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVS-P-ISAKDKNVIVIGGGDTGCDCIATSLRQ  276 (276)
Q Consensus       215 ~~~~i~g~~~~gv~~~~~~l~~~~~~~~~~~~~~-~-~~~~~k~vvVIGgG~~G~E~A~~~~r~  276 (276)
                      +.+++||.+.+||+++.+|+...+.......... . ....+|+|+|||||++|+|+|..+.|+
T Consensus       406 r~l~IpG~dl~GV~~a~dfL~~~~~~~~~~~~~~~~~~~~~Gk~VvVIGGG~tA~D~A~ta~R~  469 (944)
T PRK12779        406 TFMNVPGEHLLGVMSANEFLTRVNLMRGLDDDYETPLPEVKGKEVFVIGGGNTAMDAARTAKRL  469 (944)
T ss_pred             CcCCCCCCcCcCcEEHHHHHHHHHhhccccccccccccccCCCEEEEECCCHHHHHHHHHHHHc
Confidence            9999999999999999999987554321110000 0 013689999999999999999999875

>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
2vdc_G 456 The 9.5 A Resolution Structure Of Glutamate Synthas 4e-27
1cjc_A 460 Structure Of Adrenodoxin Reductase Of Mitochondrial 5e-08
1h7x_A 1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ter 1e-07
1h7w_A 1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig Leng 1e-07
2c7g_A 456 Fpra From Mycobacterium Tuberculosis: His57gln Muta 3e-06
1lqt_A 456 A Covalent Modification Of Nadp+ Revealed By The At 4e-06
>pdb|2VDC|G Chain G, The 9.5 A Resolution Structure Of Glutamate Synthase From Cryo-Electron Microscopy And Its Oligomerization Behavior In Solution: Functional Implications. Length = 456 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 90/143 (62%), Gaps = 6/143 (4%)
Query: 139 GHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKEL 198
           G+ V V++R DR+GGLL YGIP  KL K VV+RRVKLLA  G+ +  N  VG+D +  EL
Sbjct: 145 GYEVHVYDRYDRMGGLLVYGIPGFKLEKSVVERRVKLLADAGVIYHPNFEVGRDASLPEL 204
Query: 199 YEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGN-----ENVSPISAK 253
             +  A+L+ TG    RD+  PG  L  I  A+ +L +  K  +G+     EN S ++A 
Sbjct: 205 RRKHVAVLVATGVYKARDIKAPGSGLGNIVAALDYLTTSNKVSLGDTVEAYENGS-LNAA 263
Query: 254 DKNVIVIGGGDTGCDCIATSLRQ 276
            K+V+V+GGGDT  DC+ T++RQ
Sbjct: 264 GKHVVVLGGGDTAMDCVRTAIRQ 286
>pdb|1CJC|A Chain A, Structure Of Adrenodoxin Reductase Of Mitochondrial P450 Systems Length = 460 Back     alignment and structure
>pdb|1H7X|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ternary Complex Of A Mutant Enzyme (C671a), Nadph And 5- Fluorouracil Length = 1025 Back     alignment and structure
>pdb|1H7W|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig Length = 1025 Back     alignment and structure
>pdb|2C7G|A Chain A, Fpra From Mycobacterium Tuberculosis: His57gln Mutant Length = 456 Back     alignment and structure
>pdb|1LQT|A Chain A, A Covalent Modification Of Nadp+ Revealed By The Atomic Resolution Structure Of Fpra, A Mycobacterium Tuberculosis Oxidoreductase Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 4e-82
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 2e-30
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 1e-42
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 4e-14
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 9e-42
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 4e-18
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 3e-35
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 1e-10
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 3e-15
1ea0_A1479 Glutamate synthase [NADPH] large chain; oxidoreduc 3e-10
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 7e-10
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 1e-04
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 1e-08
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 2e-08
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 4e-08
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 5e-08
1ofd_A1520 Ferredoxin-dependent glutamate synthase 2; oxidore 8e-08
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 9e-08
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 1e-07
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 1e-07
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 2e-07
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 2e-07
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 3e-07
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 5e-07
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 8e-07
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1yqz_A 438 Coenzyme A disulfide reductase; oxidoreductase; HE 4e-06
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 5e-06
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 9e-06
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 3e-05
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 1e-04
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-04
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 4e-04
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
 Score =  253 bits (648), Expect = 4e-82
 Identities = 61/142 (42%), Positives = 87/142 (61%), Gaps = 4/142 (2%)

Query: 139 GHSVTVFERNDRVGGLLQYGIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKEL 198
           G+ V V++R DR+GGLL YGIP  KL K VV+RRVKLLA  G+ +  N  VG+D +  EL
Sbjct: 145 GYEVHVYDRYDRMGGLLVYGIPGFKLEKSVVERRVKLLADAGVIYHPNFEVGRDASLPEL 204

Query: 199 YEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNE----NVSPISAKD 254
             +  A+L+ TG    RD+  PG  L  I  A+ +L +  K  +G+         ++A  
Sbjct: 205 RRKHVAVLVATGVYKARDIKAPGSGLGNIVAALDYLTTSNKVSLGDTVEAYENGSLNAAG 264

Query: 255 KNVIVIGGGDTGCDCIATSLRQ 276
           K+V+V+GGGDT  DC+ T++RQ
Sbjct: 265 KHVVVLGGGDTAMDCVRTAIRQ 286
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Length = 1479 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Length = 1520 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.95
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.88
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.77
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 99.76
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.7
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 99.68
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.66
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.66
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.63
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.61
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.61
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.6
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.59
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.58
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.58
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 99.58
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.57
3r9u_A 315 Thioredoxin reductase; structural genomics, center 99.57
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 99.57
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.57
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.57
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.56
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.56
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.56
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.56
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.56
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.55
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.55
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.54
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.54
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.54
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.54
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.54
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 99.54
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.53
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.53
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.53
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 99.53
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 99.53
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.53
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.52
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.52
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.52
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.52
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.52
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.52
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 99.52
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 99.52
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.51
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.5
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 99.5
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.5
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.49
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 99.49
4fk1_A 304 Putative thioredoxin reductase; structural genomic 99.49
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.49
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.49
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.49
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.49
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.49
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 99.48
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.48
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.48
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.47
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 99.47
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.47
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.47
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.47
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 99.46
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 99.46
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.46
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.46
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 99.45
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.45
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.45
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.45
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.45
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.45
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.44
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.44
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.44
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.44
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.43
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.43
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.43
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.42
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.41
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.41
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.4
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.39
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 99.39
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.39
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.39
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.39
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.38
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 99.38
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.38
4dna_A 463 Probable glutathione reductase; structural genomic 99.38
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.38
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.38
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.38
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.37
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.37
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.37
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.37
4dna_A 463 Probable glutathione reductase; structural genomic 99.37
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 99.37
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.37
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.37
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.37
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.36
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.36
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.36
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.36
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.35
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.34
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.33
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.33
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.33
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.33
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.33
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.32
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 99.31
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.31
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.3
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.3
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.3
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.29
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.29
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.29
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.28
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 99.28
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 99.26
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.26
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.26
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.25
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.25
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.25
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.25
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.23
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.22
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.21
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 99.21
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.21
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.19
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 99.19
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.17
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.16
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.15
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.15
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.15
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.14
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.14
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.13
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 99.13
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.12
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 99.12
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.12
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.12
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.11
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.1
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.06
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.03
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.02
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 99.01
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 98.98
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.97
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.96
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.94
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.92
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.9
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.79
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.78
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.78
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.77
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.75
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.75
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.73
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.72
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.63
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.62
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.61
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 98.58
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.57
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.54
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.46
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 98.45
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.41
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.32
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.27
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.25
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 98.21
2cul_A232 Glucose-inhibited division protein A-related PROT 98.2
3dme_A369 Conserved exported protein; structural genomics, P 98.13
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.09
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.06
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 98.04
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.02
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.94
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 97.94
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.92
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.91
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.91
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 97.9
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.9
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.88
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 97.88
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.86
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.82
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.77
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.75
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.75
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.75
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 97.74
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.67
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.67
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.65
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.61
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 97.56
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.55
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.5
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.48
3atr_A 453 Conserved archaeal protein; saturating double bond 97.47
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 97.45
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.45
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.43
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.43
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.43
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.42
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 97.42
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.4
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.38
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.36
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.36
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.36
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 97.3
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.28
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.25
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.22
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.21
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.13
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 97.12
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 97.11
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.11
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.1
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.07
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.06
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.0
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 96.97
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.97
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 96.96
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 96.96
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 96.93
2ywl_A180 Thioredoxin reductase related protein; uncharacter 96.93
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.92
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.9
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 96.88
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.84
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 96.82
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.79
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.78
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 96.74
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 96.73
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 96.71
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 96.7
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 96.68
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 96.65
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 96.53
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.52
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 96.51
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 96.51
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 96.5
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.5
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.4
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 96.38
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 96.34
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 96.31
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 96.3
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 96.27
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.27
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.27
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.24
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.21
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 96.16
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 96.16
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 96.07
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.06
4hb9_A 412 Similarities with probable monooxygenase; flavin, 96.0
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 95.98
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 95.98
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 95.98
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 95.92
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 95.92
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 95.91
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 95.91
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 95.9
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.87
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.85
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 95.84
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 95.79
2cul_A232 Glucose-inhibited division protein A-related PROT 95.74
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 95.74
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 95.72
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 95.67
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 95.66
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 95.6
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 95.58
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 95.57
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 95.52
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 95.48
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 95.47
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.45
3dme_A 369 Conserved exported protein; structural genomics, P 95.43
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 95.34
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 95.33
4hb9_A 412 Similarities with probable monooxygenase; flavin, 95.28
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 95.21
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 95.04
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.01
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 94.99
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.98
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 94.97
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 94.95
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 94.86
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 94.84
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 94.82
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 94.7
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 94.67
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 94.56
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 94.48
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 94.46
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 94.45
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 94.42
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 94.28
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 94.28
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 94.21
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 94.14
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 94.07
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 94.05
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 94.04
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 94.02
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.94
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 93.94
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 93.86
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 93.84
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 93.82
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 93.75
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 93.67
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 93.66
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 93.58
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 93.55
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 93.46
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 93.45
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.41
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 93.39
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 93.39
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.33
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.26
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 93.16
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 93.1
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 93.1
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 93.1
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 93.08
3atr_A 453 Conserved archaeal protein; saturating double bond 93.05
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 92.97
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 92.92
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.9
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 92.86
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 92.85
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 92.83
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 92.81
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 92.69
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 92.56
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 92.3
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 92.29
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 92.27
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 92.18
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 92.06
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.03
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 92.01
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 91.92
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 91.91
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.87
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 91.86
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 91.5
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 91.45
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 91.25
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 91.21
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 90.91
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 90.87
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 90.85
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 90.85
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 90.79
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 90.78
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 90.68
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 90.67
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.57
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 90.48
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 90.47
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 90.46
3c85_A183 Putative glutathione-regulated potassium-efflux S 90.31
4g65_A 461 TRK system potassium uptake protein TRKA; structur 90.15
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 89.85
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 89.82
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.79
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 89.76
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 89.73
1id1_A153 Putative potassium channel protein; RCK domain, E. 89.58
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 89.52
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 89.11
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 88.61
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 88.6
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 88.57
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 88.14
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 87.75
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 87.57
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 87.43
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 87.32
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 87.17
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 86.96
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 86.94
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 85.78
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 85.31
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 84.96
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 84.78
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 83.96
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 83.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 83.65
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 83.56
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 82.97
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 82.74
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 82.49
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 82.24
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 81.69
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 80.67
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 80.5
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 80.37
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 80.04
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
Probab=99.95  E-value=4.2e-28  Score=221.32  Aligned_cols=209  Identities=33%  Similarity=0.515  Sum_probs=163.3

Q ss_pred             Ccchh--HHHhhhhhhcc-ccccceeeccccchhcccccccccccccchhchHHHHHhhCCCeEEEeccCCCCCceeeec
Q psy12810          1 MIWDH--QLEKRLDNTLI-QECEPVLSGKVPRIDLEYTINNECRAFTATLSYHISIQHLVGHSVTVFERNDRVGGLLQYG   77 (276)
Q Consensus         1 ~~~~~--~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~paGl~aA~~~aa~~G~~V~l~Ek~~~lGG~~~~~   77 (276)
                      +||||  |||.+|.|... +  +||.|+.|+||..|....+                   |+.     + .         
T Consensus        71 rvCp~~~~Ce~~C~~~~~~~--~~v~I~~le~~~~~~~~~~-------------------~~~-----~-~---------  114 (456)
T 2vdc_G           71 RICPQDRLCEGNCVIEQSTH--GAVTIGSVEKYINDTAWDQ-------------------GWV-----K-P---------  114 (456)
T ss_dssp             HHCCGGGSGGGGCGGGGSSS--CSCCHHHHHHHHHHHHHHH-------------------TCC-----C-C---------
T ss_pred             ccCCCCcchHHhcccCCCCC--CCccHHHHHHHHHHHHHHc-------------------CCC-----C-C---------
Confidence            48999  99999999998 8  9999999999998764431                   110     0 0         


Q ss_pred             CCCCCCCHHHHHHHHHHHHhCCCeEEeccccCccchhhhccCCCCCCCCCCCCcchhhhhCCcEEEEEcCCCccceeeee
Q psy12810         78 IPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQY  157 (276)
Q Consensus        78 ~~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~~v~v~iiG~gp~~~g~~Gl~~A~~l~~~G~~Vtvie~~~~~gg~~~~  157 (276)
                         .. +                    ....++++.|  ||+||+     |+++|..|++.|++|+|||+.+.+||.+++
T Consensus       115 ---~~-~--------------------~~~~~~~V~I--IGgGpA-----Gl~aA~~L~~~G~~V~v~e~~~~~GG~l~~  163 (456)
T 2vdc_G          115 ---RT-P--------------------SRELGLSVGV--IGAGPA-----GLAAAEELRAKGYEVHVYDRYDRMGGLLVY  163 (456)
T ss_dssp             ---CC-S--------------------CSSCCCCEEE--ECCSHH-----HHHHHHHHHHHTCCEEEECSSSSCSTHHHH
T ss_pred             ---CC-C--------------------cCCCCCEEEE--ECCCHH-----HHHHHHHHHHCCCeEEEEeccCCCCCeeee
Confidence               00 0                    0011244555  999999     999999999999999999999999999999


Q ss_pred             cCCCCCCcHHHHHHHHHHHHhcCcEEEeeeeeccccchhhhhcccCEEEEcCCCCCCCCCCCCCcCCCCeeehHHHHHHH
Q psy12810        158 GIPTMKLSKEVVQRRVKLLAAEGIEFKTNINVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESW  237 (276)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~l~~~gv~i~~~~~v~~~~~~~~~~~~~D~vVlAtG~~~p~~~~i~g~~~~gv~~~~~~l~~~  237 (276)
                      ++|.+..++++..+..+.+++.|++|++++.+..++..+...+.||+||+|||++.|+.+++||.+.++++++.+|+...
T Consensus       164 gip~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~~v~~~~~~~~~d~vvlAtG~~~~~~~~ipG~~~~gv~~a~~~l~~~  243 (456)
T 2vdc_G          164 GIPGFKLEKSVVERRVKLLADAGVIYHPNFEVGRDASLPELRRKHVAVLVATGVYKARDIKAPGSGLGNIVAALDYLTTS  243 (456)
T ss_dssp             TSCTTTSCHHHHHHHHHHHHHTTCEEETTCCBTTTBCHHHHHSSCSEEEECCCCCEECCTTCSCCTTTTEEEHHHHHHHH
T ss_pred             cCCCccCCHHHHHHHHHHHHHCCcEEEeCCEeccEEEhhHhHhhCCEEEEecCCCCCCCCCCCCCcCCCcEEHHHHHHHh
Confidence            99988888888888889999999999999988655444445578999999999964778899998889999998988765


Q ss_pred             HHhhcCCCCC-C---CCCCCCCeEEEEcCChHHHHHHHHhhcC
Q psy12810        238 QKKQMGNENV-S---PISAKDKNVIVIGGGDTGCDCIATSLRQ  276 (276)
Q Consensus       238 ~~~~~~~~~~-~---~~~~~~k~vvVIGgG~~G~E~A~~~~r~  276 (276)
                      .......... .   .....+|+|+|||||++|+|+|..+.|+
T Consensus       244 ~~~~~~~~~~~~~~g~~~~~gk~VvVIGgG~~a~d~A~~~~r~  286 (456)
T 2vdc_G          244 NKVSLGDTVEAYENGSLNAAGKHVVVLGGGDTAMDCVRTAIRQ  286 (456)
T ss_dssp             HHHHCTTTCSSCCTTCSCCCCSEEEEECSSHHHHHHHHHHHHT
T ss_pred             hhhhcccccccccccccccCCCEEEEECCChhHHHHHHHHHHc
Confidence            5432211000 0   0125789999999999999999988764
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 276
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 1e-19
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 6e-09
d1cjca1 225 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitoc 3e-13
d1lqta1 216 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA 2e-12
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 6e-11
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 1e-10
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 1e-04
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-09
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-04
d1ps9a2 162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 2e-09
d2gjca1 311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 5e-08
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.001
d1ea0a1270 b.80.4.1 (A:1203-1472) Alpha subunit of glutamate 9e-07
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 5e-06
d1ofda1268 b.80.4.1 (A:1240-1507) Alpha subunit of glutamate 1e-05
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 2e-04
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 0.002
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-binding domain
superfamily: Nucleotide-binding domain
family: N-terminal domain of adrenodoxin reductase-like
domain: Adrenodoxin reductase of mitochondrial p450 systems
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 82.7 bits (203), Expect = 1e-19
 Identities = 23/144 (15%), Positives = 50/144 (34%), Gaps = 2/144 (1%)

Query: 133 LIVNIVGHSVTVFERNDRVGGLLQYGIPTM-KLSKEVVQRRVKLLAAEGIEFKTNINVGK 191
           L+ +     V ++E+     GL+++G+       K V+    +   ++   F  N+ VG+
Sbjct: 20  LLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGR 79

Query: 192 DIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPIS 251
           D+  +EL + + A++L  GA        P          +  +E            S   
Sbjct: 80  DVTVQELQDAYHAVVLSYGAEDKSRPIDPSVPFDPKLGVVPNMEGRVVDVP-GLYCSGWV 138

Query: 252 AKDKNVIVIGGGDTGCDCIATSLR 275
            +    ++              L+
Sbjct: 139 KRGPTGVITTTMTDSFLTGQILLQ 162
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 216 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1ea0a1 b.80.4.1 (A:1203-1472) Alpha subunit of glutamate synthase, C-terminal domain {Azospirillum brasilense [TaxId: 192]} Length = 270 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1ofda1 b.80.4.1 (A:1240-1507) Alpha subunit of glutamate synthase, C-terminal domain {Synechocystis sp. [TaxId: 1143]} Length = 268 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.74
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.58
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.56
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.54
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.31
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.2
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.17
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.15
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.12
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.06
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.05
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.03
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.03
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.03
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.01
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.01
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.01
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.98
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.98
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.98
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.95
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.95
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.94
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.92
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.91
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.89
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.84
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.83
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.81
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.66
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.65
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.63
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.63
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.61
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.5
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 98.48
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.45
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.45
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.45
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.44
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.43
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.39
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.36
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.33
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.28
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.26
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.22
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.22
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.2
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.18
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.11
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.09
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.06
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.05
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.02
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.02
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.01
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.01
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.98
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.97
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.95
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.92
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.91
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.91
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.9
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.9
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.89
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.88
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.86
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.83
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.82
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.82
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.82
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 97.79
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.78
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.78
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.77
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.75
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.75
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.75
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.74
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.73
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.73
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.71
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.71
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.7
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.7
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.7
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.69
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.69
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.66
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.63
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.63
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.63
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.62
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.62
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.61
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.61
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.6
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.59
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.58
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.56
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.5
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.47
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.47
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.46
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.45
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.45
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.44
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.44
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.44
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.37
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.37
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.37
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.33
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.31
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.31
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.3
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.29
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.29
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.28
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.27
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.27
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.26
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.25
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.24
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.23
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.21
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.14
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.13
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.1
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.06
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.96
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.88
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.88
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 96.8
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.79
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.77
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.75
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 96.57
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.53
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.51
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.35
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 96.32
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 96.22
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.21
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.96
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 95.94
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.71
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 95.66
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 95.55
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.55
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 95.49
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 95.45
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.45
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 95.42
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 95.34
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 95.3
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.2
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 95.12
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 95.06
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.01
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 94.93
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.91
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.66
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 94.59
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 94.58
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.52
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 94.47
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 94.26
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 94.06
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 93.94
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.42
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.0
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 92.45
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 92.39
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.29
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.14
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.68
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 91.67
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 91.14
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.91
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.79
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 90.7
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 90.43
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 90.3
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 90.24
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 90.22
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 90.17
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 89.68
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.92
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 88.83
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 88.33
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 87.96
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.31
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 87.27
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 86.5
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 85.37
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 85.02
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 84.25
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 81.55
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 81.31
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 80.83
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 80.62
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-binding domain
superfamily: Nucleotide-binding domain
family: N-terminal domain of adrenodoxin reductase-like
domain: 2,4-dienoyl-CoA reductase, middle domain
species: Escherichia coli [TaxId: 562]

Probab=99.74  E-value=6.7e-20  Score=143.98  Aligned_cols=123  Identities=25%  Similarity=0.404  Sum_probs=101.6

Q ss_pred             CccchhhhccCCCCCCCCCCCCcchhhhhCCcEEEEEcCCCccceeeeec--CCCCCCcHHHHHHHHHHHHhcCcEEEee
Q psy12810        109 GKDIAAKVTNHTPQSDNQTKHCPPLIVNIVGHSVTVFERNDRVGGLLQYG--IPTMKLSKEVVQRRVKLLAAEGIEFKTN  186 (276)
Q Consensus       109 ~~~v~v~iiG~gp~~~g~~Gl~~A~~l~~~G~~Vtvie~~~~~gg~~~~~--~~~~~~~~~~~~~~~~~l~~~gv~i~~~  186 (276)
                      ++++.|  ||+||+     |+++|..|+++|++|+|||+.+.+||.+++.  +|.+....++.+++.+++++.||++++|
T Consensus        43 ~k~V~I--IGaGPA-----GL~AA~~la~~G~~Vtl~E~~~~~GG~l~~~~~~p~~~~~~~~~~~~~~~~~~~gV~i~l~  115 (179)
T d1ps9a3          43 KKNLAV--VGAGPA-----GLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLN  115 (179)
T ss_dssp             CCEEEE--ECCSHH-----HHHHHHHHHTTTCEEEEEESSSSSCTTHHHHTTSTTCTTHHHHHHHHHHHHHHHTCEEEES
T ss_pred             CcEEEE--ECccHH-----HHHHHHHHHhhccceEEEeccCccCceEEEEEeCcccchHHHHHHHHHHhhhcCCeEEEeC
Confidence            455555  999999     9999999999999999999999999988754  6666777889999999999999999999


Q ss_pred             eeeccccchhhhhcccCEEEEcCCCCCCCCCCCCCcCCCCeeehHHHHHHHHHhhcCCCCCCCCCCCCCeEEEEcCChHH
Q psy12810        187 INVGKDIAAKELYEEFDALLLCTGATWPRDLPIPGRQLSGIYFAMSFLESWQKKQMGNENVSPISAKDKNVIVIGGGDTG  266 (276)
Q Consensus       187 ~~v~~~~~~~~~~~~~D~vVlAtG~~~p~~~~i~g~~~~gv~~~~~~l~~~~~~~~~~~~~~~~~~~~k~vvVIGgG~~G  266 (276)
                      +.|+.+     ....||.||+|||.. |+.+++|+.                             ..+++++|||+|+++
T Consensus       116 ~~Vt~~-----~~~~~d~vilAtG~~-~~~~~~pg~-----------------------------~~g~~v~vigggd~a  160 (179)
T d1ps9a3         116 HTVTAD-----QLQAFDETILASGIP-NRALAQPLI-----------------------------DSGKTVHLIGGCDVA  160 (179)
T ss_dssp             CCCCSS-----SSCCSSEEEECCCEE-CCTTHHHHH-----------------------------TTTCCEEECGGGTCC
T ss_pred             CEEccc-----ccccceeEEEeecCC-Ccccccchh-----------------------------ccCCEEEEECCcHhh
Confidence            988643     245799999999997 776655431                             468899999999999


Q ss_pred             HHH-HHHh
Q psy12810        267 CDC-IATS  273 (276)
Q Consensus       267 ~E~-A~~~  273 (276)
                      +|+ +..+
T Consensus       161 ~~~~~~~A  168 (179)
T d1ps9a3         161 MELDARRA  168 (179)
T ss_dssp             SSCCHHHH
T ss_pred             hhccchhh
Confidence            885 4433
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure