Psyllid ID: psy12860
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 328721582 | 242 | PREDICTED: netrin-1-like [Acyrthosiphon | 0.515 | 0.421 | 0.549 | 5e-28 | |
| 242021734 | 732 | Netrin-1 precursor, putative [Pediculus | 0.484 | 0.131 | 0.597 | 3e-26 | |
| 110766241 | 140 | PREDICTED: netrin-B-like, partial [Apis | 0.575 | 0.814 | 0.372 | 1e-21 | |
| 380026860 | 673 | PREDICTED: netrin-A-like [Apis florea] | 0.575 | 0.169 | 0.372 | 1e-21 | |
| 321464154 | 603 | hypothetical protein DAPPUDRAFT_56315 [D | 0.505 | 0.165 | 0.446 | 4e-21 | |
| 332028078 | 236 | Netrin-1 [Acromyrmex echinatior] | 0.489 | 0.411 | 0.403 | 4e-21 | |
| 307200587 | 252 | Netrin-1 [Harpegnathos saltator] | 0.464 | 0.365 | 0.423 | 5e-21 | |
| 307183131 | 297 | Netrin-1 [Camponotus floridanus] | 0.464 | 0.309 | 0.413 | 3e-20 | |
| 350399310 | 652 | PREDICTED: LOW QUALITY PROTEIN: netrin-B | 0.393 | 0.119 | 0.5 | 3e-20 | |
| 340727831 | 678 | PREDICTED: netrin-B-like [Bombus terrest | 0.393 | 0.115 | 0.5 | 3e-20 |
| >gi|328721582|ref|XP_001947857.2| PREDICTED: netrin-1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 129 bits (325), Expect = 5e-28, Method: Compositional matrix adjust.
Identities = 56/102 (54%), Positives = 77/102 (75%)
Query: 95 TIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKP 154
I+GK+SE I K W +FTMN+QS+YKR+ S+L++G WIH+ DL+CKCPKIK +
Sbjct: 137 AILGKMSEPIVSKNWAKFTMNVQSVYKRSQGSRLRRGPTTFWIHDNDLKCKCPKIKPGRL 196
Query: 155 YLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRG 196
YLILGKE +G + GL + +SIV+EW++E H+RMR+FQRR
Sbjct: 197 YLILGKENDGERRDGLVLTQRSIVIEWREEWHNRMRRFQRRA 238
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242021734|ref|XP_002431298.1| Netrin-1 precursor, putative [Pediculus humanus corporis] gi|212516566|gb|EEB18560.1| Netrin-1 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|110766241|ref|XP_001120123.1| PREDICTED: netrin-B-like, partial [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380026860|ref|XP_003697158.1| PREDICTED: netrin-A-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|321464154|gb|EFX75164.1| hypothetical protein DAPPUDRAFT_56315 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|332028078|gb|EGI68129.1| Netrin-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307200587|gb|EFN80728.1| Netrin-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307183131|gb|EFN70048.1| Netrin-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|350399310|ref|XP_003485486.1| PREDICTED: LOW QUALITY PROTEIN: netrin-B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340727831|ref|XP_003402238.1| PREDICTED: netrin-B-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| UNIPROTKB|Q90923 | 581 | NTN3 "Netrin-3" [Gallus gallus | 0.479 | 0.163 | 0.427 | 6e-20 | |
| UNIPROTKB|F1NK85 | 330 | NTN1 "Netrin-1" [Gallus gallus | 0.707 | 0.424 | 0.350 | 1.2e-19 | |
| UNIPROTKB|F1NEW2 | 336 | NTN1 "Netrin-1" [Gallus gallus | 0.479 | 0.282 | 0.427 | 5.1e-19 | |
| UNIPROTKB|Q90922 | 606 | NTN1 "Netrin-1" [Gallus gallus | 0.439 | 0.143 | 0.420 | 3.6e-18 | |
| ZFIN|ZDB-GENE-990415-169 | 603 | ntn1a "netrin 1a" [Danio rerio | 0.439 | 0.144 | 0.431 | 1.2e-17 | |
| UNIPROTKB|Q2HXW4 | 600 | NTN1 "Netrin-1" [Sus scrofa (t | 0.439 | 0.145 | 0.420 | 2.4e-16 | |
| UNIPROTKB|F1N0C7 | 603 | NTN1 "Uncharacterized protein" | 0.439 | 0.144 | 0.420 | 2.4e-16 | |
| UNIPROTKB|O95631 | 604 | NTN1 "Netrin-1" [Homo sapiens | 0.439 | 0.144 | 0.420 | 2.4e-16 | |
| MGI|MGI:105088 | 604 | Ntn1 "netrin 1" [Mus musculus | 0.439 | 0.144 | 0.420 | 2.4e-16 | |
| UNIPROTKB|F1LPC8 | 604 | Ntn1 "Netrin-1" [Rattus norveg | 0.439 | 0.144 | 0.420 | 2.4e-16 |
| UNIPROTKB|Q90923 NTN3 "Netrin-3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 228 (85.3 bits), Expect = 6.0e-20, Sum P(2) = 6.0e-20
Identities = 41/96 (42%), Positives = 62/96 (64%)
Query: 100 ISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILG 159
I E + W +FT+NI S+YK D ++K+G +LWIH KDL CKCPKI+++K YL++G
Sbjct: 478 ILEMETVANWAKFTINILSVYK-CRDERVKRGDNFLWIHLKDLSCKCPKIQISKKYLVMG 536
Query: 160 KEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRR 195
+ GL + S+V++W+D R+R+ QRR
Sbjct: 537 ISENSTDRPGLMADKNSLVIQWRDAWTRRLRKLQRR 572
|
|
| UNIPROTKB|F1NK85 NTN1 "Netrin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEW2 NTN1 "Netrin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q90922 NTN1 "Netrin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990415-169 ntn1a "netrin 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2HXW4 NTN1 "Netrin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N0C7 NTN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95631 NTN1 "Netrin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105088 Ntn1 "netrin 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LPC8 Ntn1 "Netrin-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| cd03579 | 115 | cd03579, NTR_netrin-1_like, NTR domain, Netrin-1-l | 2e-33 | |
| smart00643 | 114 | smart00643, C345C, Netrin C-terminal Domain | 3e-13 | |
| pfam01759 | 108 | pfam01759, NTR, UNC-6/NTR/C345C module | 5e-13 | |
| cd01385 | 692 | cd01385, MYSc_type_IX, Myosin motor domain, type I | 2e-08 | |
| smart00242 | 677 | smart00242, MYSc, Myosin | 2e-08 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 1e-07 | |
| cd03523 | 105 | cd03523, NTR_like, NTR_like domain; a beta barrel | 1e-07 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 3e-07 | |
| cd01387 | 677 | cd01387, MYSc_type_XV, Myosin motor domain, type X | 4e-07 | |
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 2e-06 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 2e-06 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 3e-06 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 4e-06 | |
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 1e-05 | |
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 3e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-05 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 3e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 8e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 9e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 3e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.001 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.002 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 0.002 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 0.002 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.003 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.003 |
| >gnl|CDD|239634 cd03579, NTR_netrin-1_like, NTR domain, Netrin-1-like subfamily; The C-terminal NTR domain of netrins is also called domain C in the context of C | Back alignment and domain information |
|---|
Score = 115 bits (289), Expect = 2e-33
Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
Query: 96 IVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPY 155
+ ++ + EW +FT+N+Q++YKR S+L++G LW+ KDL CKCPK+K+ K Y
Sbjct: 11 VQAQVLSRETAGEWAKFTVNVQTVYKRGT-SRLRRGDQPLWVPRKDLACKCPKLKVGKSY 69
Query: 156 LILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRR 195
L+LGK+++ + GL ++ +S+V+EW+DE R+R+FQRR
Sbjct: 70 LLLGKDEDSPERGGLILDKRSLVIEWRDEWARRLRRFQRR 109
|
elegans netrin UNC-6. Netrins are secreted proteins that function as tropic cues in the direction of axon growth and cell migration during neural development. These proteins may be chemoattractive to some neurons and chemorepellant for others. In the case of netrin-1, attraction and repulsion responses are mediated by the DCC and UNC-5 receptor families. The biological activities of C. elegans UNC-6, which may either attract or repel migrating cells or axons, are mediated by its different domains. The C-terminal NTR domain of UNC-6 has been shown to inhibit axon branching activity. Length = 115 |
| >gnl|CDD|214759 smart00643, C345C, Netrin C-terminal Domain | Back alignment and domain information |
|---|
| >gnl|CDD|216684 pfam01759, NTR, UNC-6/NTR/C345C module | Back alignment and domain information |
|---|
| >gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|239600 cd03523, NTR_like, NTR_like domain; a beta barrel with an oligosaccharide/oligonucleotide-binding fold found in netrins, complement proteins, tissue inhibitors of metalloproteases (TIMP), and procollagen C-proteinase enhancers (PCOLCE), amongst others | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 100.0 | |
| PTZ00014 | 821 | myosin-A; Provisional | 99.97 | |
| KOG0164|consensus | 1001 | 99.97 | ||
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 99.97 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 99.97 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 99.97 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 99.97 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 99.97 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 99.97 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 99.97 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 99.96 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 99.96 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 99.96 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 99.96 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 99.96 | |
| KOG0163|consensus | 1259 | 99.94 | ||
| KOG0162|consensus | 1106 | 99.94 | ||
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 99.94 | |
| KOG0160|consensus | 862 | 99.93 | ||
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 99.92 | |
| KOG0161|consensus | 1930 | 99.91 | ||
| cd03578 | 111 | NTR_netrin-4_like NTR domain, Netrin-4-like subfam | 99.88 | |
| cd03579 | 115 | NTR_netrin-1_like NTR domain, Netrin-1-like subfam | 99.78 | |
| KOG4229|consensus | 1062 | 99.74 | ||
| cd03581 | 111 | NTR_Sfrp3_like NTR domain, Secreted frizzled-relat | 99.72 | |
| cd03576 | 124 | NTR_PCOLCE NTR domain, PCOLCE subfamily; Procollag | 99.71 | |
| KOG3512|consensus | 592 | 99.7 | ||
| smart00643 | 114 | C345C Netrin C-terminal Domain. | 99.45 | |
| PF01759 | 111 | NTR: UNC-6/NTR/C345C module; InterPro: IPR018933 T | 99.39 | |
| cd03523 | 105 | NTR_like NTR_like domain; a beta barrel with an ol | 99.05 | |
| cd03582 | 150 | NTR_complement_C5 NTR/C345C domain, complement C5 | 99.01 | |
| cd03574 | 147 | NTR_complement_C345C NTR/C345C domain; The NTR dom | 98.96 | |
| cd03584 | 153 | NTR_complement_C4 NTR/C345C domain, complement C4 | 98.87 | |
| cd03577 | 116 | NTR_TIMP_like NTR domain, TIMP-like subfamily; TIM | 98.3 | |
| cd03580 | 126 | NTR_Sfrp1_like NTR domain, Secreted frizzled-relat | 98.26 | |
| cd03583 | 149 | NTR_complement_C3 NTR/C345C domain, complement C3 | 98.24 | |
| cd03575 | 109 | NTR_WFIKKN NTR domain, WFIKKN subfamily; WFIKKN pr | 96.77 | |
| PF00965 | 181 | TIMP: Tissue inhibitor of metalloproteinase; Inter | 91.85 |
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-35 Score=287.70 Aligned_cols=160 Identities=21% Similarity=0.263 Sum_probs=129.8
Q ss_pred cccccccchhhhcccccccccchhhhhhhhhhhhhhhhhhhhhcCceeeeeeeccCccccceee-----cccccccc--c
Q psy12860 31 IRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKS-----TIVGKISE--K 103 (198)
Q Consensus 31 ~e~F~~Ns~eqlcin~~ne~lq~~f~~~vf~~e~~~e~~~y~~Egi~w~~i~f~dN~~cidLde-----gi~~~V~~--~ 103 (198)
.|+|+.||||||||||+||+|||.|++|+|++|| +||.+|||+|++|+|.|||+||||+| ||++.+++ +
T Consensus 438 FEiFEkNSFEQlCINYtNEKLQQ~Fn~h~FklEQ----EeY~kE~IeW~~Idy~DnQ~~IDLIE~~~p~GIlslLDEE~~ 513 (1463)
T COG5022 438 FEIFEKNSFEQLCINYTNEKLQQFFNQHMFKLEQ----EEYVKEGIEWSFIDYFDNQPCIDLIEKKNPLGILSLLDEECV 513 (1463)
T ss_pred hhhhccCcHHHHHHhhhhHHHHHHHHHHHHHHHH----HHHHHhcCcccccccccCcchhHHHhccCCCchHhhhcHHhc
Confidence 5999999999999999999999999999999965 99999999999999999999999987 68888877 3
Q ss_pred ccchhHHHHHHHHHHhhcc--CC---CCCCCCCceEEEEecCccccCCCCcc-cCccee------eecccCCC------C
Q psy12860 104 INLKEWVRFTMNIQSMYKR--AP---DSKLKKGAVYLWIHNKDLQCKCPKIK-LNKPYL------ILGKEKEG------N 165 (198)
Q Consensus 104 ~~~g~~~~f~~kv~~v~K~--~p---~~ri~rg~F~I~H~AgdV~Y~cp~L~-~~r~yL------Ilg~~~~~------~ 165 (198)
-+.+++.+|+.++...+.. +| .+|++.+.|.|.||||||+|++.|+. .|+|-| +++.+... +
T Consensus 514 ~p~atd~s~~sKL~~~l~~~~~~~f~~~rf~~~~FvvkHYAgDVeY~veg~ldKNkD~l~~~ll~Ll~~StNe~vs~Lf~ 593 (1463)
T COG5022 514 MPHATDESFTSKLAQRLNKNSNPKFKKSRFRDNKFVVKHYAGDVEYDVEGFLDKNKDPLNDDLLELLKASTNEFVSTLFD 593 (1463)
T ss_pred CCCCCchHHHHHHHHHhccccCccccccccCCCceEEEeecccceeeccchhhhCcchhhHHHHHHHhhccchHHHHhhh
Confidence 4556678999999888872 12 35677779999999999999999964 478776 23322110 0
Q ss_pred --CCCCcccCcceeEEechHHHHHHHHHHHH
Q psy12860 166 --QPSGLTMNAKSIVVEWKDELHDRMRQFQR 194 (198)
Q Consensus 166 --~~~~l~~~~~Svv~~wk~sl~~lm~~l~r 194 (198)
....--..++|++..|+.|+.+||..|.+
T Consensus 594 ~~~~~~~K~~~pT~gs~~K~sl~~Lm~tl~s 624 (1463)
T COG5022 594 DEENIESKGRFPTLGSRFKESLNSLMSTLNS 624 (1463)
T ss_pred hhhhccccCCCCcHHHHHHHHHHHHHHHHHh
Confidence 00011245689999999999999999875
|
|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >KOG0164|consensus | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >KOG0160|consensus | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >cd03578 NTR_netrin-4_like NTR domain, Netrin-4-like subfamily; composed of the C-terminal NTR domains of netrin-4 (beta netrin) and similar proteins | Back alignment and domain information |
|---|
| >cd03579 NTR_netrin-1_like NTR domain, Netrin-1-like subfamily; The C-terminal NTR domain of netrins is also called domain C in the context of C | Back alignment and domain information |
|---|
| >KOG4229|consensus | Back alignment and domain information |
|---|
| >cd03581 NTR_Sfrp3_like NTR domain, Secreted frizzled-related protein (Sfrp) 3-like subfamily; composed of proteins similar to human Sfrp3 and Sfrp4 | Back alignment and domain information |
|---|
| >cd03576 NTR_PCOLCE NTR domain, PCOLCE subfamily; Procollagen C-endopeptidase enhancers (PCOLCEs) are extracellular matrix proteins that enhance the activity of procollagen C-proteases, by binding to the procollagen I C-peptide | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >smart00643 C345C Netrin C-terminal Domain | Back alignment and domain information |
|---|
| >PF01759 NTR: UNC-6/NTR/C345C module; InterPro: IPR018933 The netrin (NTR) module is an about 130-residue domain found in the C-terminal parts of netrins, complement proteins C3, C4, and C5, secreted frizzled-related proteins, and type I procollagen C-proteinase enhancer proteins (PCOLCEs), as well as in the N-terminal parts of tissue inhibitors of metalloproteinases (TIMPs) | Back alignment and domain information |
|---|
| >cd03523 NTR_like NTR_like domain; a beta barrel with an oligosaccharide/oligonucleotide-binding fold found in netrins, complement proteins, tissue inhibitors of metalloproteases (TIMP), and procollagen C-proteinase enhancers (PCOLCE), amongst others | Back alignment and domain information |
|---|
| >cd03582 NTR_complement_C5 NTR/C345C domain, complement C5 subfamily; The NTR domain found in complement C5 is also known as C345C because it occurs at the C-terminus of complement C3, C4 and C5 | Back alignment and domain information |
|---|
| >cd03574 NTR_complement_C345C NTR/C345C domain; The NTR domains that are found in the C-termini of complement C3, C4 and C5, are also called C345C domains | Back alignment and domain information |
|---|
| >cd03584 NTR_complement_C4 NTR/C345C domain, complement C4 subfamily; The NTR domain found in complement C4 is also known as the C345C domain because it occurs at the C-terminus of complement C3, C4 and C5 | Back alignment and domain information |
|---|
| >cd03577 NTR_TIMP_like NTR domain, TIMP-like subfamily; TIMPs, or tissue inibitors of metalloproteases, are essential regulators of extracellular matrix turnover and remodeling | Back alignment and domain information |
|---|
| >cd03580 NTR_Sfrp1_like NTR domain, Secreted frizzled-related protein (Sfrp) 1-like subfamily; composed of proteins similar to human Sfrp1, Sfrp2 and Sfrp5 | Back alignment and domain information |
|---|
| >cd03583 NTR_complement_C3 NTR/C345C domain, complement C3 subfamily; The NTR domain found in complement C3 is also known as the C345C domain because it occurs at the C-terminus of complement C3, C4 and C5 | Back alignment and domain information |
|---|
| >cd03575 NTR_WFIKKN NTR domain, WFIKKN subfamily; WFIKKN proteins contain a C-terminal NTR domain and are putative secreted proteins which may be multivalent protease inhibitors that act on serine proteases as well as metalloproteases | Back alignment and domain information |
|---|
| >PF00965 TIMP: Tissue inhibitor of metalloproteinase; InterPro: IPR001820 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 198 | ||||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 2e-04 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 4e-04 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 4e-04 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 4e-04 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 4e-04 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 4e-04 |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
|
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 2e-09 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 3e-09 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 3e-09 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 3e-09 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 4e-09 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 7e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-08 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 1e-08 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-08 | |
| 1uap_A | 154 | Procollagen C-proteinase enhancer protein; beta ba | 6e-07 | |
| 3hrz_C | 379 | Cobra venom factor; serine protease, glycosilated, | 5e-06 | |
| 3cki_B | 121 | Metalloproteinase inhibitor 3; extra-cellular matr | 8e-04 |
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 | Back alignment and structure |
|---|
Score = 55.0 bits (133), Expect = 2e-09
Identities = 13/20 (65%), Positives = 15/20 (75%)
Query: 39 FEQLCINYANEHLQYYFNQH 58
FEQ CINY NE LQ +FN+
Sbjct: 464 FEQFCINYCNEKLQQFFNER 483
|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3hrz_C Cobra venom factor; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_B* 3hs0_C* Length = 379 | Back alignment and structure |
|---|
| >3cki_B Metalloproteinase inhibitor 3; extra-cellular matrix, catalytic zinc, SA-SB loop, alternative splicing, cleavage on PAIR of basic residues; 2.30A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 99.97 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 99.97 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.97 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 99.97 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 99.97 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 99.97 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 99.97 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 99.96 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 99.96 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.96 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 99.96 | |
| 1uap_A | 154 | Procollagen C-proteinase enhancer protein; beta ba | 99.57 | |
| 3hrz_C | 379 | Cobra venom factor; serine protease, glycosilated, | 98.67 | |
| 2hr0_B | 915 | Complement C3 alpha' chain; complement component C | 98.34 | |
| 3cu7_A | 1676 | Complement C5; Mg domain, inflammation, anaphylato | 98.21 | |
| 3prx_B | 1642 | Cobra venom factor; immune system, complement, imm | 98.18 | |
| 4fxk_C | 291 | Complement C4 gamma chain; immune system, proteoly | 98.16 | |
| 3v96_A | 184 | Metalloproteinase inhibitor 1; metzincin, OB-fold, | 97.56 | |
| 2b39_A | 1661 | C3; thioester, immune defense, immune system; HET: | 96.05 | |
| 3cki_B | 121 | Metalloproteinase inhibitor 3; extra-cellular matr | 95.56 | |
| 2e2d_C | 180 | TIMP-2, metalloproteinase inhibitor 2; matrix meta | 90.9 |
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
Probab=99.97 E-value=1.6e-33 Score=269.50 Aligned_cols=160 Identities=19% Similarity=0.240 Sum_probs=126.5
Q ss_pred cccccccchhhhcccccccccchhhhhhhhhhhhhhhhhhhhhcCceeeeeeeccCccccceee---cccccccc--ccc
Q psy12860 31 IRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKS---TIVGKISE--KIN 105 (198)
Q Consensus 31 ~e~F~~Ns~eqlcin~~ne~lq~~f~~~vf~~e~~~e~~~y~~Egi~w~~i~f~dN~~cidLde---gi~~~V~~--~~~ 105 (198)
.|+|+.|||||||||||||+|||+|++++|..|| +||.+|||+|.+|+|.||++||||++ ||+++|++ +-+
T Consensus 441 FE~f~~NsFEQlcINyaNEkLQq~Fn~~~F~~Eq----eeY~~EgI~w~~i~f~DN~~~idLie~~~GIlslLDEec~~p 516 (795)
T 1w7j_A 441 FETFEINSFEQFCINYANEKLQQQFNMHVFKLEQ----EEYMKEQIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMP 516 (795)
T ss_dssp CCCCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHTTCCGGGCCCCCCHHHHHHHHSTTSHHHHHHHHHTST
T ss_pred ccccCcCCHHHHHHHhhhHHHHHHHHHHHHHHHH----HHHHhcCCcccccCccccHHHHHHHHhcCCHHHhhhhhccCC
Confidence 4899999999999999999999999999999965 99999999999999999999999987 67777776 344
Q ss_pred chhHHHHHHHHHHhh-ccCC---CCCCCCCceEEEEecCccccCCCCccc-Cccee------eecccC-CC-------C-
Q psy12860 106 LKEWVRFTMNIQSMY-KRAP---DSKLKKGAVYLWIHNKDLQCKCPKIKL-NKPYL------ILGKEK-EG-------N- 165 (198)
Q Consensus 106 ~g~~~~f~~kv~~v~-K~~p---~~ri~rg~F~I~H~AgdV~Y~cp~L~~-~r~yL------Ilg~~~-~~-------~- 165 (198)
.+++.+|+.+++..+ +.+| .|+.....|+|.||||+|+|++.|+.. |+|.| +|..+. .. .
T Consensus 517 ~~tD~~f~~kl~~~~~~~~~~f~~p~~~~~~F~I~HyAG~V~Y~~~gfleKNkD~l~~~~~~ll~~S~~~~~v~~lf~~~ 596 (795)
T 1w7j_A 517 KGSDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDE 596 (795)
T ss_dssp TCCHHHHHHHHHHHHTTTCTTEECCTTCSSEEEEECSSCEEEEECTTHHHHHHCCCCHHHHHHHHTCSSCSHHHHTTC--
T ss_pred CCChHHHHHHHHHHhhccCCccccCCCCCCceEEEecceEEEEechhHHhhccccccHHHHHHHHhccccHHHHHHhccc
Confidence 566899999998887 6654 456667799999999999999999654 67765 232222 10 0
Q ss_pred ------CC----------------------CCcccCcceeEEechHHHHHHHHHHHH
Q psy12860 166 ------QP----------------------SGLTMNAKSIVVEWKDELHDRMRQFQR 194 (198)
Q Consensus 166 ------~~----------------------~~l~~~~~Svv~~wk~sl~~lm~~l~r 194 (198)
.. ..-...+.||+.+|+.||..||..|.+
T Consensus 597 ~~~~~~~~~~~s~~~~~s~~~~~~~~~~~~~~~~~~~~Tv~~~fk~sL~~Lm~~L~~ 653 (795)
T 1w7j_A 597 EKAISPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNA 653 (795)
T ss_dssp -------------------------------------CCHHHHHHHHHHHHHHHHHT
T ss_pred cccccccccccccccccccccccccccccccccCCCCCcHHHHHHHHHHHHHHHHhc
Confidence 00 001234579999999999999999975
|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >3hrz_C Cobra venom factor; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_B* 3hs0_C* | Back alignment and structure |
|---|
| >2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... | Back alignment and structure |
|---|
| >3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A | Back alignment and structure |
|---|
| >3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* | Back alignment and structure |
|---|
| >4fxk_C Complement C4 gamma chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_C* | Back alignment and structure |
|---|
| >3v96_A Metalloproteinase inhibitor 1; metzincin, OB-fold, metalloproteinase, protease inhibitor, H inhibitor-hydrolase complex; 1.90A {Homo sapiens} PDB: 1uea_B 1d2b_A 1oo9_B 2j0t_D 3ma2_B | Back alignment and structure |
|---|
| >2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3cki_B Metalloproteinase inhibitor 3; extra-cellular matrix, catalytic zinc, SA-SB loop, alternative splicing, cleavage on PAIR of basic residues; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2e2d_C TIMP-2, metalloproteinase inhibitor 2; matrix metalloproteinase/MMP, collagenase, tissue inhibitor of metalloproteinases/TIMP, complex, flexibility; 2.00A {Bos taurus} SCOP: b.40.3.1 PDB: 1bqq_T 1buv_T 1br9_A 1gxd_C 2tmp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 198 | ||||
| d1uapa_ | 131 | b.40.3.3 (A:) Procollagen c-proteinase enhancer pr | 3e-16 | |
| d2j0td1 | 124 | b.40.3.1 (D:1-124) TIMP-1 {Human (Homo sapiens) [T | 1e-11 | |
| d1xwea_ | 151 | b.40.3.3 (A:) Complement C5 domain {Human (Homo sa | 2e-06 | |
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 0.004 |
| >d1uapa_ b.40.3.3 (A:) Procollagen c-proteinase enhancer protein PCOLCE {Human (Homo sapiens) [TaxId: 9606]} Length = 131 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: TIMP-like family: Netrin-like domain (NTR/C345C module) domain: Procollagen c-proteinase enhancer protein PCOLCE species: Human (Homo sapiens) [TaxId: 9606]
Score = 69.6 bits (170), Expect = 3e-16
Identities = 18/103 (17%), Positives = 37/103 (35%), Gaps = 5/103 (4%)
Query: 96 IVGKISEKINLK-EWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKP 154
+ + + E + T+++ YK L + +CP +K
Sbjct: 28 VTATVKSMVREPGEGLAVTVSLIGAYKTGG-LDLPSPPTGASLKFYVPCKQCPPMKKGVS 86
Query: 155 YLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRGC 197
YL++G+ +E G + +S VV + + +R C
Sbjct: 87 YLLMGQVEEN---RGPVLPPESFVVLHRPNQDQILTNLSKRKC 126
|
| >d2j0td1 b.40.3.1 (D:1-124) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1xwea_ b.40.3.3 (A:) Complement C5 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 99.95 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 99.95 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.94 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.94 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 99.93 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.92 | |
| d1uapa_ | 131 | Procollagen c-proteinase enhancer protein PCOLCE { | 99.63 | |
| d1xwea_ | 151 | Complement C5 domain {Human (Homo sapiens) [TaxId: | 98.98 | |
| d2j0td1 | 124 | TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.88 |
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.95 E-value=2.3e-30 Score=243.48 Aligned_cols=162 Identities=18% Similarity=0.240 Sum_probs=119.3
Q ss_pred cccccccchhhhcccccccccchhhhhhhhhhhhhhhhhhhhhcCceeeeeeec-cCccccceee-----ccccccccc-
Q psy12860 31 IRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFG-SGGWRFEFKS-----TIVGKISEK- 103 (198)
Q Consensus 31 ~e~F~~Ns~eqlcin~~ne~lq~~f~~~vf~~e~~~e~~~y~~Egi~w~~i~f~-dN~~cidLde-----gi~~~V~~~- 103 (198)
.|+|+.|||||||||||||+||++|++++|..|+ ++|.+|||+|..|+|. ||++|++|++ |++++|++.
T Consensus 411 FE~f~~NsfEQLcINyaNEkLQ~~f~~~~f~~eq----~eY~~EgI~~~~i~~~~dn~~~~~Li~~k~p~Gll~lLdee~ 486 (712)
T d1d0xa2 411 FEIFKVNSFEQLCINYTNEKLQQFFNHHMFKLEQ----EEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQS 486 (712)
T ss_dssp CCCCSSBCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHTCC--------CHHHHHHHHHCTTTTCHHHHHHHHH
T ss_pred ccccccCcHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHhhccCCCcccccCCCcHHHHHHHhccCCCcHHHHhHHHh
Confidence 4899999999999999999999999999999865 9999999999999996 9999999975 677777763
Q ss_pred -ccchhHHHHHHHHHHhhccC-C---CCCCCCCceEEEEecCccccCCCCccc-Cccee------eecccCCC-------
Q psy12860 104 -INLKEWVRFTMNIQSMYKRA-P---DSKLKKGAVYLWIHNKDLQCKCPKIKL-NKPYL------ILGKEKEG------- 164 (198)
Q Consensus 104 -~~~g~~~~f~~kv~~v~K~~-p---~~ri~rg~F~I~H~AgdV~Y~cp~L~~-~r~yL------Ilg~~~~~------- 164 (198)
-+.+++..|+.+++..+..+ + .++.....|+|.||||+|+|++.+|.. |+|.| +|..+...
T Consensus 487 ~~~~~td~~~l~kl~~~~~~~~~~~~~~~~~~~~F~I~HyAG~V~Y~v~gfl~KNrD~l~~~~~~ll~~S~n~~i~~lf~ 566 (712)
T d1d0xa2 487 VFPNATDNTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFN 566 (712)
T ss_dssp TCTTCCHHHHHHHHHHHHTTTSTTEECCSSCSSEEEEEETTEEEEEECTTHHHHHHCCCCHHHHHHHHTCSCTTHHHHHH
T ss_pred cCCCCChHHHHHHHHHHhccCCcccccccCCCCceeeEecccceeEecchHHHhccchhHHHHHHHHHHCCcHHHHHHhc
Confidence 34556789999998888543 2 344556689999999999999999655 77766 22222110
Q ss_pred ----CCCCCcccCcceeEEechHHHHHHHHHHHHhc
Q psy12860 165 ----NQPSGLTMNAKSIVVEWKDELHDRMRQFQRRG 196 (198)
Q Consensus 165 ----~~~~~l~~~~~Svv~~wk~sl~~lm~~l~r~~ 196 (198)
....+-.....||+.+|+.+|..||..|.+-.
T Consensus 567 ~~~~~~~~~~~~~~~Tv~~~Fk~sL~~Lm~~L~~t~ 602 (712)
T d1d0xa2 567 DPNIASRAKKGANFITVAAQYKEQLASLMATLETTN 602 (712)
T ss_dssp CHHHHCCC-----CCCHHHHHHHHHHHHHHHHHTSE
T ss_pred CCcccccccCCCCCccHHHHHHHHHHHHHHHHcCCC
Confidence 01222334557999999999999999998643
|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1uapa_ b.40.3.3 (A:) Procollagen c-proteinase enhancer protein PCOLCE {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwea_ b.40.3.3 (A:) Complement C5 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0td1 b.40.3.1 (D:1-124) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|