Psyllid ID: psy12860


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MQKPKSLKKKKKKKKKRKKKKKKKKKKKKKIRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRGCT
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEccccccccccccEEEEEEccccccccccccccccEEEEEEccccccccEEEEcccEEEEEccHHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHcccccccEEEcccEcccccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEcccccccccccEEEEEccccccccccccccccEEEEEEccccccccccEEEccccEEEcccHHHHHHHHHHHHHccc
mqkpkslkkKKKKKKKRKKKKKKKKKKKKKIRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVstvdfgsggwrfefKSTIVGKISEKINLKEWVRFTMNIQSMykrapdsklkkGAVYLWIHnkdlqckcpkiklnkpylilgkekegnqpsgltmnAKSIVVEWKDELHDRMRQFQRRGCT
mqkpkslkkkkkkkkkrkkkkkkkkkkkkkirnkqklvFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTvdfgsggwrFEFKstivgkisekinlkEWVRFTMNIQSMykrapdskLKKGAVYLWIHnkdlqckcpkiKLNKPYLILGKekegnqpsgltmnAKSIVVEWKDELHDRMRQFQRRGCT
MQKPKSLkkkkkkkkkrkkkkkkkkkkkkkIRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRGCT
***********************************KLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILG****************SIVVEWK****************
*************************************VFEQLCINYANEHLQYYFNQHRAIVG**********************GGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKR********GAVYLWIHNKDLQCKCPKIKLNKPYLI****************AKSIVVEWKDELHDRMRQFQR****
********************************NKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRGCT
****KSLKKKKKKKKKRKKKKKKKKKKKKKIRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKPKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKSTIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRGCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q90923581 Netrin-3 (Fragment) OS=Ga yes N/A 0.479 0.163 0.427 2e-17
Q24567726 Netrin-A OS=Drosophila me yes N/A 0.454 0.123 0.390 3e-16
Q2HXW4600 Netrin-1 OS=Sus scrofa GN yes N/A 0.439 0.145 0.420 4e-16
Q90922606 Netrin-1 OS=Gallus gallus no N/A 0.439 0.143 0.420 4e-16
Q24568793 Netrin-B OS=Drosophila me no N/A 0.479 0.119 0.423 5e-16
O95631604 Netrin-1 OS=Homo sapiens yes N/A 0.439 0.144 0.420 7e-16
O09118604 Netrin-1 OS=Mus musculus yes N/A 0.439 0.144 0.420 7e-16
Q924Z9604 Netrin-1 OS=Rattus norveg yes N/A 0.439 0.144 0.397 9e-14
P34710612 Netrin unc-6 OS=Caenorhab yes N/A 0.434 0.140 0.310 4e-13
Q8WXR4 1341 Myosin-IIIb OS=Homo sapie no N/A 0.131 0.019 0.730 0.0002
>sp|Q90923|NET3_CHICK Netrin-3 (Fragment) OS=Gallus gallus GN=NTN3 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 100 ISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILG 159
           I E   +  W +FT+NI S+YK   D ++K+G  +LWIH KDL CKCPKI+++K YL++G
Sbjct: 478 ILEMETVANWAKFTINILSVYK-CRDERVKRGDNFLWIHLKDLSCKCPKIQISKKYLVMG 536

Query: 160 KEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRR 195
             +      GL  +  S+V++W+D    R+R+ QRR
Sbjct: 537 ISENSTDRPGLMADKNSLVIQWRDAWTRRLRKLQRR 572




Netrins control guidance of CNS commissural axons and peripheral motor axons.
Gallus gallus (taxid: 9031)
>sp|Q24567|NETA_DROME Netrin-A OS=Drosophila melanogaster GN=NetA PE=2 SV=2 Back     alignment and function description
>sp|Q2HXW4|NET1_PIG Netrin-1 OS=Sus scrofa GN=NTN1 PE=2 SV=1 Back     alignment and function description
>sp|Q90922|NET1_CHICK Netrin-1 OS=Gallus gallus GN=NTN1 PE=1 SV=1 Back     alignment and function description
>sp|Q24568|NETB_DROME Netrin-B OS=Drosophila melanogaster GN=NetB PE=1 SV=1 Back     alignment and function description
>sp|O95631|NET1_HUMAN Netrin-1 OS=Homo sapiens GN=NTN1 PE=1 SV=2 Back     alignment and function description
>sp|O09118|NET1_MOUSE Netrin-1 OS=Mus musculus GN=Ntn1 PE=1 SV=3 Back     alignment and function description
>sp|Q924Z9|NET1_RAT Netrin-1 OS=Rattus norvegicus GN=Ntn1 PE=1 SV=1 Back     alignment and function description
>sp|P34710|UNC6_CAEEL Netrin unc-6 OS=Caenorhabditis elegans GN=unc-6 PE=1 SV=1 Back     alignment and function description
>sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
328721582242 PREDICTED: netrin-1-like [Acyrthosiphon 0.515 0.421 0.549 5e-28
242021734 732 Netrin-1 precursor, putative [Pediculus 0.484 0.131 0.597 3e-26
110766241140 PREDICTED: netrin-B-like, partial [Apis 0.575 0.814 0.372 1e-21
380026860 673 PREDICTED: netrin-A-like [Apis florea] 0.575 0.169 0.372 1e-21
321464154 603 hypothetical protein DAPPUDRAFT_56315 [D 0.505 0.165 0.446 4e-21
332028078236 Netrin-1 [Acromyrmex echinatior] 0.489 0.411 0.403 4e-21
307200587252 Netrin-1 [Harpegnathos saltator] 0.464 0.365 0.423 5e-21
307183131297 Netrin-1 [Camponotus floridanus] 0.464 0.309 0.413 3e-20
350399310 652 PREDICTED: LOW QUALITY PROTEIN: netrin-B 0.393 0.119 0.5 3e-20
340727831 678 PREDICTED: netrin-B-like [Bombus terrest 0.393 0.115 0.5 3e-20
>gi|328721582|ref|XP_001947857.2| PREDICTED: netrin-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 77/102 (75%)

Query: 95  TIVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKP 154
            I+GK+SE I  K W +FTMN+QS+YKR+  S+L++G    WIH+ DL+CKCPKIK  + 
Sbjct: 137 AILGKMSEPIVSKNWAKFTMNVQSVYKRSQGSRLRRGPTTFWIHDNDLKCKCPKIKPGRL 196

Query: 155 YLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRG 196
           YLILGKE +G +  GL +  +SIV+EW++E H+RMR+FQRR 
Sbjct: 197 YLILGKENDGERRDGLVLTQRSIVIEWREEWHNRMRRFQRRA 238




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242021734|ref|XP_002431298.1| Netrin-1 precursor, putative [Pediculus humanus corporis] gi|212516566|gb|EEB18560.1| Netrin-1 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|110766241|ref|XP_001120123.1| PREDICTED: netrin-B-like, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|380026860|ref|XP_003697158.1| PREDICTED: netrin-A-like [Apis florea] Back     alignment and taxonomy information
>gi|321464154|gb|EFX75164.1| hypothetical protein DAPPUDRAFT_56315 [Daphnia pulex] Back     alignment and taxonomy information
>gi|332028078|gb|EGI68129.1| Netrin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307200587|gb|EFN80728.1| Netrin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307183131|gb|EFN70048.1| Netrin-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350399310|ref|XP_003485486.1| PREDICTED: LOW QUALITY PROTEIN: netrin-B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727831|ref|XP_003402238.1| PREDICTED: netrin-B-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
UNIPROTKB|Q90923581 NTN3 "Netrin-3" [Gallus gallus 0.479 0.163 0.427 6e-20
UNIPROTKB|F1NK85330 NTN1 "Netrin-1" [Gallus gallus 0.707 0.424 0.350 1.2e-19
UNIPROTKB|F1NEW2336 NTN1 "Netrin-1" [Gallus gallus 0.479 0.282 0.427 5.1e-19
UNIPROTKB|Q90922606 NTN1 "Netrin-1" [Gallus gallus 0.439 0.143 0.420 3.6e-18
ZFIN|ZDB-GENE-990415-169603 ntn1a "netrin 1a" [Danio rerio 0.439 0.144 0.431 1.2e-17
UNIPROTKB|Q2HXW4600 NTN1 "Netrin-1" [Sus scrofa (t 0.439 0.145 0.420 2.4e-16
UNIPROTKB|F1N0C7603 NTN1 "Uncharacterized protein" 0.439 0.144 0.420 2.4e-16
UNIPROTKB|O95631604 NTN1 "Netrin-1" [Homo sapiens 0.439 0.144 0.420 2.4e-16
MGI|MGI:105088604 Ntn1 "netrin 1" [Mus musculus 0.439 0.144 0.420 2.4e-16
UNIPROTKB|F1LPC8604 Ntn1 "Netrin-1" [Rattus norveg 0.439 0.144 0.420 2.4e-16
UNIPROTKB|Q90923 NTN3 "Netrin-3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 6.0e-20, Sum P(2) = 6.0e-20
 Identities = 41/96 (42%), Positives = 62/96 (64%)

Query:   100 ISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPYLILG 159
             I E   +  W +FT+NI S+YK   D ++K+G  +LWIH KDL CKCPKI+++K YL++G
Sbjct:   478 ILEMETVANWAKFTINILSVYK-CRDERVKRGDNFLWIHLKDLSCKCPKIQISKKYLVMG 536

Query:   160 KEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRR 195
               +      GL  +  S+V++W+D    R+R+ QRR
Sbjct:   537 ISENSTDRPGLMADKNSLVIQWRDAWTRRLRKLQRR 572


GO:0005102 "receptor binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IDA
GO:0007520 "myoblast fusion" evidence=IDA
UNIPROTKB|F1NK85 NTN1 "Netrin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEW2 NTN1 "Netrin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90922 NTN1 "Netrin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-169 ntn1a "netrin 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HXW4 NTN1 "Netrin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0C7 NTN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O95631 NTN1 "Netrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105088 Ntn1 "netrin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPC8 Ntn1 "Netrin-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
cd03579115 cd03579, NTR_netrin-1_like, NTR domain, Netrin-1-l 2e-33
smart00643114 smart00643, C345C, Netrin C-terminal Domain 3e-13
pfam01759108 pfam01759, NTR, UNC-6/NTR/C345C module 5e-13
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 2e-08
smart00242 677 smart00242, MYSc, Myosin 2e-08
cd00124 679 cd00124, MYSc, Myosin motor domain 1e-07
cd03523105 cd03523, NTR_like, NTR_like domain; a beta barrel 1e-07
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 3e-07
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 4e-07
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 2e-06
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 2e-06
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 3e-06
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 4e-06
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 1e-05
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 3e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-05
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 3e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 9e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 3e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 5e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 0.002
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 0.002
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.003
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
>gnl|CDD|239634 cd03579, NTR_netrin-1_like, NTR domain, Netrin-1-like subfamily; The C-terminal NTR domain of netrins is also called domain C in the context of C Back     alignment and domain information
 Score =  115 bits (289), Expect = 2e-33
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 96  IVGKISEKINLKEWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKPY 155
           +  ++  +    EW +FT+N+Q++YKR   S+L++G   LW+  KDL CKCPK+K+ K Y
Sbjct: 11  VQAQVLSRETAGEWAKFTVNVQTVYKRGT-SRLRRGDQPLWVPRKDLACKCPKLKVGKSY 69

Query: 156 LILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRR 195
           L+LGK+++  +  GL ++ +S+V+EW+DE   R+R+FQRR
Sbjct: 70  LLLGKDEDSPERGGLILDKRSLVIEWRDEWARRLRRFQRR 109


elegans netrin UNC-6. Netrins are secreted proteins that function as tropic cues in the direction of axon growth and cell migration during neural development. These proteins may be chemoattractive to some neurons and chemorepellant for others. In the case of netrin-1, attraction and repulsion responses are mediated by the DCC and UNC-5 receptor families. The biological activities of C. elegans UNC-6, which may either attract or repel migrating cells or axons, are mediated by its different domains. The C-terminal NTR domain of UNC-6 has been shown to inhibit axon branching activity. Length = 115

>gnl|CDD|214759 smart00643, C345C, Netrin C-terminal Domain Back     alignment and domain information
>gnl|CDD|216684 pfam01759, NTR, UNC-6/NTR/C345C module Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|239600 cd03523, NTR_like, NTR_like domain; a beta barrel with an oligosaccharide/oligonucleotide-binding fold found in netrins, complement proteins, tissue inhibitors of metalloproteases (TIMP), and procollagen C-proteinase enhancers (PCOLCE), amongst others Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
PTZ00014 821 myosin-A; Provisional 99.97
KOG0164|consensus 1001 99.97
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 99.97
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 99.97
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 99.97
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 99.97
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 99.97
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 99.97
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 99.97
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 99.96
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 99.96
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 99.96
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 99.96
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 99.96
KOG0163|consensus 1259 99.94
KOG0162|consensus 1106 99.94
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 99.94
KOG0160|consensus 862 99.93
PF00063689 Myosin_head: Myosin head (motor domain); InterPro: 99.92
KOG0161|consensus 1930 99.91
cd03578111 NTR_netrin-4_like NTR domain, Netrin-4-like subfam 99.88
cd03579115 NTR_netrin-1_like NTR domain, Netrin-1-like subfam 99.78
KOG4229|consensus 1062 99.74
cd03581111 NTR_Sfrp3_like NTR domain, Secreted frizzled-relat 99.72
cd03576124 NTR_PCOLCE NTR domain, PCOLCE subfamily; Procollag 99.71
KOG3512|consensus592 99.7
smart00643114 C345C Netrin C-terminal Domain. 99.45
PF01759111 NTR: UNC-6/NTR/C345C module; InterPro: IPR018933 T 99.39
cd03523105 NTR_like NTR_like domain; a beta barrel with an ol 99.05
cd03582150 NTR_complement_C5 NTR/C345C domain, complement C5 99.01
cd03574147 NTR_complement_C345C NTR/C345C domain; The NTR dom 98.96
cd03584153 NTR_complement_C4 NTR/C345C domain, complement C4 98.87
cd03577116 NTR_TIMP_like NTR domain, TIMP-like subfamily; TIM 98.3
cd03580126 NTR_Sfrp1_like NTR domain, Secreted frizzled-relat 98.26
cd03583149 NTR_complement_C3 NTR/C345C domain, complement C3 98.24
cd03575109 NTR_WFIKKN NTR domain, WFIKKN subfamily; WFIKKN pr 96.77
PF00965181 TIMP: Tissue inhibitor of metalloproteinase; Inter 91.85
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
Probab=100.00  E-value=2.7e-35  Score=287.70  Aligned_cols=160  Identities=21%  Similarity=0.263  Sum_probs=129.8

Q ss_pred             cccccccchhhhcccccccccchhhhhhhhhhhhhhhhhhhhhcCceeeeeeeccCccccceee-----cccccccc--c
Q psy12860         31 IRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKS-----TIVGKISE--K  103 (198)
Q Consensus        31 ~e~F~~Ns~eqlcin~~ne~lq~~f~~~vf~~e~~~e~~~y~~Egi~w~~i~f~dN~~cidLde-----gi~~~V~~--~  103 (198)
                      .|+|+.||||||||||+||+|||.|++|+|++||    +||.+|||+|++|+|.|||+||||+|     ||++.+++  +
T Consensus       438 FEiFEkNSFEQlCINYtNEKLQQ~Fn~h~FklEQ----EeY~kE~IeW~~Idy~DnQ~~IDLIE~~~p~GIlslLDEE~~  513 (1463)
T COG5022         438 FEIFEKNSFEQLCINYTNEKLQQFFNQHMFKLEQ----EEYVKEGIEWSFIDYFDNQPCIDLIEKKNPLGILSLLDEECV  513 (1463)
T ss_pred             hhhhccCcHHHHHHhhhhHHHHHHHHHHHHHHHH----HHHHHhcCcccccccccCcchhHHHhccCCCchHhhhcHHhc
Confidence            5999999999999999999999999999999965    99999999999999999999999987     68888877  3


Q ss_pred             ccchhHHHHHHHHHHhhcc--CC---CCCCCCCceEEEEecCccccCCCCcc-cCccee------eecccCCC------C
Q psy12860        104 INLKEWVRFTMNIQSMYKR--AP---DSKLKKGAVYLWIHNKDLQCKCPKIK-LNKPYL------ILGKEKEG------N  165 (198)
Q Consensus       104 ~~~g~~~~f~~kv~~v~K~--~p---~~ri~rg~F~I~H~AgdV~Y~cp~L~-~~r~yL------Ilg~~~~~------~  165 (198)
                      -+.+++.+|+.++...+..  +|   .+|++.+.|.|.||||||+|++.|+. .|+|-|      +++.+...      +
T Consensus       514 ~p~atd~s~~sKL~~~l~~~~~~~f~~~rf~~~~FvvkHYAgDVeY~veg~ldKNkD~l~~~ll~Ll~~StNe~vs~Lf~  593 (1463)
T COG5022         514 MPHATDESFTSKLAQRLNKNSNPKFKKSRFRDNKFVVKHYAGDVEYDVEGFLDKNKDPLNDDLLELLKASTNEFVSTLFD  593 (1463)
T ss_pred             CCCCCchHHHHHHHHHhccccCccccccccCCCceEEEeecccceeeccchhhhCcchhhHHHHHHHhhccchHHHHhhh
Confidence            4556678999999888872  12   35677779999999999999999964 478776      23322110      0


Q ss_pred             --CCCCcccCcceeEEechHHHHHHHHHHHH
Q psy12860        166 --QPSGLTMNAKSIVVEWKDELHDRMRQFQR  194 (198)
Q Consensus       166 --~~~~l~~~~~Svv~~wk~sl~~lm~~l~r  194 (198)
                        ....--..++|++..|+.|+.+||..|.+
T Consensus       594 ~~~~~~~K~~~pT~gs~~K~sl~~Lm~tl~s  624 (1463)
T COG5022         594 DEENIESKGRFPTLGSRFKESLNSLMSTLNS  624 (1463)
T ss_pred             hhhhccccCCCCcHHHHHHHHHHHHHHHHHh
Confidence              00011245689999999999999999875



>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>cd03578 NTR_netrin-4_like NTR domain, Netrin-4-like subfamily; composed of the C-terminal NTR domains of netrin-4 (beta netrin) and similar proteins Back     alignment and domain information
>cd03579 NTR_netrin-1_like NTR domain, Netrin-1-like subfamily; The C-terminal NTR domain of netrins is also called domain C in the context of C Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>cd03581 NTR_Sfrp3_like NTR domain, Secreted frizzled-related protein (Sfrp) 3-like subfamily; composed of proteins similar to human Sfrp3 and Sfrp4 Back     alignment and domain information
>cd03576 NTR_PCOLCE NTR domain, PCOLCE subfamily; Procollagen C-endopeptidase enhancers (PCOLCEs) are extracellular matrix proteins that enhance the activity of procollagen C-proteases, by binding to the procollagen I C-peptide Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>smart00643 C345C Netrin C-terminal Domain Back     alignment and domain information
>PF01759 NTR: UNC-6/NTR/C345C module; InterPro: IPR018933 The netrin (NTR) module is an about 130-residue domain found in the C-terminal parts of netrins, complement proteins C3, C4, and C5, secreted frizzled-related proteins, and type I procollagen C-proteinase enhancer proteins (PCOLCEs), as well as in the N-terminal parts of tissue inhibitors of metalloproteinases (TIMPs) Back     alignment and domain information
>cd03523 NTR_like NTR_like domain; a beta barrel with an oligosaccharide/oligonucleotide-binding fold found in netrins, complement proteins, tissue inhibitors of metalloproteases (TIMP), and procollagen C-proteinase enhancers (PCOLCE), amongst others Back     alignment and domain information
>cd03582 NTR_complement_C5 NTR/C345C domain, complement C5 subfamily; The NTR domain found in complement C5 is also known as C345C because it occurs at the C-terminus of complement C3, C4 and C5 Back     alignment and domain information
>cd03574 NTR_complement_C345C NTR/C345C domain; The NTR domains that are found in the C-termini of complement C3, C4 and C5, are also called C345C domains Back     alignment and domain information
>cd03584 NTR_complement_C4 NTR/C345C domain, complement C4 subfamily; The NTR domain found in complement C4 is also known as the C345C domain because it occurs at the C-terminus of complement C3, C4 and C5 Back     alignment and domain information
>cd03577 NTR_TIMP_like NTR domain, TIMP-like subfamily; TIMPs, or tissue inibitors of metalloproteases, are essential regulators of extracellular matrix turnover and remodeling Back     alignment and domain information
>cd03580 NTR_Sfrp1_like NTR domain, Secreted frizzled-related protein (Sfrp) 1-like subfamily; composed of proteins similar to human Sfrp1, Sfrp2 and Sfrp5 Back     alignment and domain information
>cd03583 NTR_complement_C3 NTR/C345C domain, complement C3 subfamily; The NTR domain found in complement C3 is also known as the C345C domain because it occurs at the C-terminus of complement C3, C4 and C5 Back     alignment and domain information
>cd03575 NTR_WFIKKN NTR domain, WFIKKN subfamily; WFIKKN proteins contain a C-terminal NTR domain and are putative secreted proteins which may be multivalent protease inhibitors that act on serine proteases as well as metalloproteases Back     alignment and domain information
>PF00965 TIMP: Tissue inhibitor of metalloproteinase; InterPro: IPR001820 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 2e-04
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 4e-04
1b7t_A 835 Myosin Digested By Papain Length = 835 4e-04
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 4e-04
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 4e-04
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 4e-04
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Query: 39 FEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFG 84 FEQLCINY NE LQ +FN H ++ + K G+V +DFG Sbjct: 475 FEQLCINYTNERLQQFFNHHMFVLEQEEYKKE----GIVWEFIDFG 516
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 2e-09
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 3e-09
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 3e-09
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 3e-09
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 4e-09
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 7e-09
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-08
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 1e-08
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-08
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 8e-08
1uap_A154 Procollagen C-proteinase enhancer protein; beta ba 6e-07
3hrz_C379 Cobra venom factor; serine protease, glycosilated, 5e-06
3cki_B121 Metalloproteinase inhibitor 3; extra-cellular matr 8e-04
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
 Score = 55.0 bits (133), Expect = 2e-09
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query: 39  FEQLCINYANEHLQYYFNQH 58
           FEQ CINY NE LQ +FN+ 
Sbjct: 464 FEQFCINYCNEKLQQFFNER 483


>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3hrz_C Cobra venom factor; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_B* 3hs0_C* Length = 379 Back     alignment and structure
>3cki_B Metalloproteinase inhibitor 3; extra-cellular matrix, catalytic zinc, SA-SB loop, alternative splicing, cleavage on PAIR of basic residues; 2.30A {Homo sapiens} Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 99.97
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 99.97
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.97
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 99.97
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 99.97
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 99.97
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 99.97
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 99.96
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.96
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.96
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 99.96
1uap_A154 Procollagen C-proteinase enhancer protein; beta ba 99.57
3hrz_C379 Cobra venom factor; serine protease, glycosilated, 98.67
2hr0_B915 Complement C3 alpha' chain; complement component C 98.34
3cu7_A1676 Complement C5; Mg domain, inflammation, anaphylato 98.21
3prx_B1642 Cobra venom factor; immune system, complement, imm 98.18
4fxk_C291 Complement C4 gamma chain; immune system, proteoly 98.16
3v96_A184 Metalloproteinase inhibitor 1; metzincin, OB-fold, 97.56
2b39_A1661 C3; thioester, immune defense, immune system; HET: 96.05
3cki_B121 Metalloproteinase inhibitor 3; extra-cellular matr 95.56
2e2d_C180 TIMP-2, metalloproteinase inhibitor 2; matrix meta 90.9
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
Probab=99.97  E-value=1.6e-33  Score=269.50  Aligned_cols=160  Identities=19%  Similarity=0.240  Sum_probs=126.5

Q ss_pred             cccccccchhhhcccccccccchhhhhhhhhhhhhhhhhhhhhcCceeeeeeeccCccccceee---cccccccc--ccc
Q psy12860         31 IRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFGSGGWRFEFKS---TIVGKISE--KIN  105 (198)
Q Consensus        31 ~e~F~~Ns~eqlcin~~ne~lq~~f~~~vf~~e~~~e~~~y~~Egi~w~~i~f~dN~~cidLde---gi~~~V~~--~~~  105 (198)
                      .|+|+.|||||||||||||+|||+|++++|..||    +||.+|||+|.+|+|.||++||||++   ||+++|++  +-+
T Consensus       441 FE~f~~NsFEQlcINyaNEkLQq~Fn~~~F~~Eq----eeY~~EgI~w~~i~f~DN~~~idLie~~~GIlslLDEec~~p  516 (795)
T 1w7j_A          441 FETFEINSFEQFCINYANEKLQQQFNMHVFKLEQ----EEYMKEQIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMP  516 (795)
T ss_dssp             CCCCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHTTCCGGGCCCCCCHHHHHHHHSTTSHHHHHHHHHTST
T ss_pred             ccccCcCCHHHHHHHhhhHHHHHHHHHHHHHHHH----HHHHhcCCcccccCccccHHHHHHHHhcCCHHHhhhhhccCC
Confidence            4899999999999999999999999999999965    99999999999999999999999987   67777776  344


Q ss_pred             chhHHHHHHHHHHhh-ccCC---CCCCCCCceEEEEecCccccCCCCccc-Cccee------eecccC-CC-------C-
Q psy12860        106 LKEWVRFTMNIQSMY-KRAP---DSKLKKGAVYLWIHNKDLQCKCPKIKL-NKPYL------ILGKEK-EG-------N-  165 (198)
Q Consensus       106 ~g~~~~f~~kv~~v~-K~~p---~~ri~rg~F~I~H~AgdV~Y~cp~L~~-~r~yL------Ilg~~~-~~-------~-  165 (198)
                      .+++.+|+.+++..+ +.+|   .|+.....|+|.||||+|+|++.|+.. |+|.|      +|..+. ..       . 
T Consensus       517 ~~tD~~f~~kl~~~~~~~~~~f~~p~~~~~~F~I~HyAG~V~Y~~~gfleKNkD~l~~~~~~ll~~S~~~~~v~~lf~~~  596 (795)
T 1w7j_A          517 KGSDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDE  596 (795)
T ss_dssp             TCCHHHHHHHHHHHHTTTCTTEECCTTCSSEEEEECSSCEEEEECTTHHHHHHCCCCHHHHHHHHTCSSCSHHHHTTC--
T ss_pred             CCChHHHHHHHHHHhhccCCccccCCCCCCceEEEecceEEEEechhHHhhccccccHHHHHHHHhccccHHHHHHhccc
Confidence            566899999998887 6654   456667799999999999999999654 67765      232222 10       0 


Q ss_pred             ------CC----------------------CCcccCcceeEEechHHHHHHHHHHHH
Q psy12860        166 ------QP----------------------SGLTMNAKSIVVEWKDELHDRMRQFQR  194 (198)
Q Consensus       166 ------~~----------------------~~l~~~~~Svv~~wk~sl~~lm~~l~r  194 (198)
                            ..                      ..-...+.||+.+|+.||..||..|.+
T Consensus       597 ~~~~~~~~~~~s~~~~~s~~~~~~~~~~~~~~~~~~~~Tv~~~fk~sL~~Lm~~L~~  653 (795)
T 1w7j_A          597 EKAISPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNA  653 (795)
T ss_dssp             -------------------------------------CCHHHHHHHHHHHHHHHHHT
T ss_pred             cccccccccccccccccccccccccccccccccCCCCCcHHHHHHHHHHHHHHHHhc
Confidence                  00                      001234579999999999999999975



>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>3hrz_C Cobra venom factor; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_B* 3hs0_C* Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>4fxk_C Complement C4 gamma chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_C* Back     alignment and structure
>3v96_A Metalloproteinase inhibitor 1; metzincin, OB-fold, metalloproteinase, protease inhibitor, H inhibitor-hydrolase complex; 1.90A {Homo sapiens} PDB: 1uea_B 1d2b_A 1oo9_B 2j0t_D 3ma2_B Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>3cki_B Metalloproteinase inhibitor 3; extra-cellular matrix, catalytic zinc, SA-SB loop, alternative splicing, cleavage on PAIR of basic residues; 2.30A {Homo sapiens} Back     alignment and structure
>2e2d_C TIMP-2, metalloproteinase inhibitor 2; matrix metalloproteinase/MMP, collagenase, tissue inhibitor of metalloproteinases/TIMP, complex, flexibility; 2.00A {Bos taurus} SCOP: b.40.3.1 PDB: 1bqq_T 1buv_T 1br9_A 1gxd_C 2tmp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1uapa_131 b.40.3.3 (A:) Procollagen c-proteinase enhancer pr 3e-16
d2j0td1124 b.40.3.1 (D:1-124) TIMP-1 {Human (Homo sapiens) [T 1e-11
d1xwea_151 b.40.3.3 (A:) Complement C5 domain {Human (Homo sa 2e-06
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 0.004
>d1uapa_ b.40.3.3 (A:) Procollagen c-proteinase enhancer protein PCOLCE {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: TIMP-like
family: Netrin-like domain (NTR/C345C module)
domain: Procollagen c-proteinase enhancer protein PCOLCE
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 69.6 bits (170), Expect = 3e-16
 Identities = 18/103 (17%), Positives = 37/103 (35%), Gaps = 5/103 (4%)

Query: 96  IVGKISEKINLK-EWVRFTMNIQSMYKRAPDSKLKKGAVYLWIHNKDLQCKCPKIKLNKP 154
           +   +   +    E +  T+++   YK      L        +       +CP +K    
Sbjct: 28  VTATVKSMVREPGEGLAVTVSLIGAYKTGG-LDLPSPPTGASLKFYVPCKQCPPMKKGVS 86

Query: 155 YLILGKEKEGNQPSGLTMNAKSIVVEWKDELHDRMRQFQRRGC 197
           YL++G+ +E     G  +  +S VV  +      +    +R C
Sbjct: 87  YLLMGQVEEN---RGPVLPPESFVVLHRPNQDQILTNLSKRKC 126


>d2j0td1 b.40.3.1 (D:1-124) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1xwea_ b.40.3.3 (A:) Complement C5 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 99.95
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 99.95
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 99.94
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 99.94
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 99.93
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 99.92
d1uapa_131 Procollagen c-proteinase enhancer protein PCOLCE { 99.63
d1xwea_151 Complement C5 domain {Human (Homo sapiens) [TaxId: 98.98
d2j0td1124 TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} 98.88
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.95  E-value=2.3e-30  Score=243.48  Aligned_cols=162  Identities=18%  Similarity=0.240  Sum_probs=119.3

Q ss_pred             cccccccchhhhcccccccccchhhhhhhhhhhhhhhhhhhhhcCceeeeeeec-cCccccceee-----ccccccccc-
Q psy12860         31 IRNKQKLVFEQLCINYANEHLQYYFNQHRAIVGKISEKINTNLCGVVVSTVDFG-SGGWRFEFKS-----TIVGKISEK-  103 (198)
Q Consensus        31 ~e~F~~Ns~eqlcin~~ne~lq~~f~~~vf~~e~~~e~~~y~~Egi~w~~i~f~-dN~~cidLde-----gi~~~V~~~-  103 (198)
                      .|+|+.|||||||||||||+||++|++++|..|+    ++|.+|||+|..|+|. ||++|++|++     |++++|++. 
T Consensus       411 FE~f~~NsfEQLcINyaNEkLQ~~f~~~~f~~eq----~eY~~EgI~~~~i~~~~dn~~~~~Li~~k~p~Gll~lLdee~  486 (712)
T d1d0xa2         411 FEIFKVNSFEQLCINYTNEKLQQFFNHHMFKLEQ----EEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQS  486 (712)
T ss_dssp             CCCCSSBCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHTCC--------CHHHHHHHHHCTTTTCHHHHHHHHH
T ss_pred             ccccccCcHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHhhccCCCcccccCCCcHHHHHHHhccCCCcHHHHhHHHh
Confidence            4899999999999999999999999999999865    9999999999999996 9999999975     677777763 


Q ss_pred             -ccchhHHHHHHHHHHhhccC-C---CCCCCCCceEEEEecCccccCCCCccc-Cccee------eecccCCC-------
Q psy12860        104 -INLKEWVRFTMNIQSMYKRA-P---DSKLKKGAVYLWIHNKDLQCKCPKIKL-NKPYL------ILGKEKEG-------  164 (198)
Q Consensus       104 -~~~g~~~~f~~kv~~v~K~~-p---~~ri~rg~F~I~H~AgdV~Y~cp~L~~-~r~yL------Ilg~~~~~-------  164 (198)
                       -+.+++..|+.+++..+..+ +   .++.....|+|.||||+|+|++.+|.. |+|.|      +|..+...       
T Consensus       487 ~~~~~td~~~l~kl~~~~~~~~~~~~~~~~~~~~F~I~HyAG~V~Y~v~gfl~KNrD~l~~~~~~ll~~S~n~~i~~lf~  566 (712)
T d1d0xa2         487 VFPNATDNTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFN  566 (712)
T ss_dssp             TCTTCCHHHHHHHHHHHHTTTSTTEECCSSCSSEEEEEETTEEEEEECTTHHHHHHCCCCHHHHHHHHTCSCTTHHHHHH
T ss_pred             cCCCCChHHHHHHHHHHhccCCcccccccCCCCceeeEecccceeEecchHHHhccchhHHHHHHHHHHCCcHHHHHHhc
Confidence             34556789999998888543 2   344556689999999999999999655 77766      22222110       


Q ss_pred             ----CCCCCcccCcceeEEechHHHHHHHHHHHHhc
Q psy12860        165 ----NQPSGLTMNAKSIVVEWKDELHDRMRQFQRRG  196 (198)
Q Consensus       165 ----~~~~~l~~~~~Svv~~wk~sl~~lm~~l~r~~  196 (198)
                          ....+-.....||+.+|+.+|..||..|.+-.
T Consensus       567 ~~~~~~~~~~~~~~~Tv~~~Fk~sL~~Lm~~L~~t~  602 (712)
T d1d0xa2         567 DPNIASRAKKGANFITVAAQYKEQLASLMATLETTN  602 (712)
T ss_dssp             CHHHHCCC-----CCCHHHHHHHHHHHHHHHHHTSE
T ss_pred             CCcccccccCCCCCccHHHHHHHHHHHHHHHHcCCC
Confidence                01222334557999999999999999998643



>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1uapa_ b.40.3.3 (A:) Procollagen c-proteinase enhancer protein PCOLCE {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwea_ b.40.3.3 (A:) Complement C5 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0td1 b.40.3.1 (D:1-124) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure