Psyllid ID: psy12987


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAKSSNPDDYK
cccEEEcEEEEEEcccccccccccccccccccEEEEcccccEEEEEEEEcccEEEEEEEEccccEEEEEEEEEccccccccc
cccEEEEEEEEEccccccccHHHHcccccccccccccccccEEEEEEEEcccEEEEEEEEcccccEEEEEEEcccccccccc
MAPIKFARVVsyssedpvhkadnllnpestkkwkcksMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVakssnpddyk
mapikfarvvsyssedpvhkadnllnpestkkWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFvakssnpddyk
MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAKSSNPDDYK
**********************************C****EKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVA*********
***IKFARVVSYS***P**KADNLLNPESTKKW*******K*AVAILQLSSQVQINGIDIGNEFSAFVEVFVAK********
MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAK********
*APIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAKSSNPDDYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
Q9ESZ0 631 DNA repair protein XRCC1 yes N/A 0.939 0.122 0.454 6e-13
P18887 633 DNA repair protein XRCC1 yes N/A 0.939 0.121 0.454 9e-13
Q60596 631 DNA repair protein XRCC1 yes N/A 0.939 0.122 0.454 2e-12
O54935 633 DNA repair protein XRCC1 yes N/A 0.926 0.120 0.473 4e-12
Q6ZNB5142 Putative short transient no N/A 0.975 0.563 0.426 1e-09
>sp|Q9ESZ0|XRCC1_RAT DNA repair protein XRCC1 OS=Rattus norvegicus GN=Xrcc1 PE=2 SV=2 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%)

Query: 1  MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60
          M  I    VVS SS+D  H+A+NLL  ++ +KW+    GEK    +LQL  + QI+ +DI
Sbjct: 1  MPEISLRHVVSCSSQDSTHRAENLLKADTYRKWRSAKAGEKTISVVLQLEKEEQIHSVDI 60

Query: 61 GNEFSAFVEVFVAKSSN 77
          GN+ SAFVEV V  S+ 
Sbjct: 61 GNDGSAFVEVLVGSSAG 77




Corrects defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.
Rattus norvegicus (taxid: 10116)
>sp|P18887|XRCC1_HUMAN DNA repair protein XRCC1 OS=Homo sapiens GN=XRCC1 PE=1 SV=2 Back     alignment and function description
>sp|Q60596|XRCC1_MOUSE DNA repair protein XRCC1 OS=Mus musculus GN=Xrcc1 PE=1 SV=2 Back     alignment and function description
>sp|O54935|XRCC1_CRIGR DNA repair protein XRCC1 OS=Cricetulus griseus GN=XRCC1 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZNB5|TRC2L_HUMAN Putative short transient receptor potential channel 2-like protein OS=Homo sapiens PE=5 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
241570173 235 DNA-repair protein xrcc1, putative [Ixod 0.939 0.327 0.610 1e-17
91080991 533 PREDICTED: similar to DNA-repair protein 1.0 0.153 0.524 1e-16
270005349 556 hypothetical protein TcasGA2_TC007398 [T 1.0 0.147 0.524 1e-16
312381959 619 hypothetical protein AND_05657 [Anophele 0.939 0.124 0.525 1e-15
260836947 644 hypothetical protein BRAFLDRAFT_277469 [ 0.975 0.124 0.537 3e-15
337743301102 XRCC1 [Kryptolebias marmoratus] 0.975 0.784 0.537 4e-15
340375016 555 PREDICTED: DNA repair protein XRCC1-like 1.0 0.147 0.5 8e-15
51571935 615 DNA repair protein XRCC1 [Danio rerio] g 0.975 0.130 0.537 1e-14
410904431 620 PREDICTED: DNA repair protein XRCC1-like 0.926 0.122 0.526 3e-14
348527426 622 PREDICTED: DNA repair protein XRCC1-like 0.926 0.122 0.539 3e-14
>gi|241570173|ref|XP_002402668.1| DNA-repair protein xrcc1, putative [Ixodes scapularis] gi|215502056|gb|EEC11550.1| DNA-repair protein xrcc1, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 55/77 (71%)

Query: 1  MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60
          M  IK   VVS+SSED VHKA+NLL  E  +KWKC + GEKQA  ILQL     I+ IDI
Sbjct: 1  MPVIKLQHVVSFSSEDKVHKAENLLKSERYRKWKCATAGEKQASVILQLEKASVISSIDI 60

Query: 61 GNEFSAFVEVFVAKSSN 77
          GNE SAF+EV VA+SS+
Sbjct: 61 GNESSAFIEVLVARSSD 77




Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91080991|ref|XP_975029.1| PREDICTED: similar to DNA-repair protein XRCC1 (X-ray repair cross-complementing protein 1) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270005349|gb|EFA01797.1| hypothetical protein TcasGA2_TC007398 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312381959|gb|EFR27566.1| hypothetical protein AND_05657 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|260836947|ref|XP_002613467.1| hypothetical protein BRAFLDRAFT_277469 [Branchiostoma floridae] gi|229298852|gb|EEN69476.1| hypothetical protein BRAFLDRAFT_277469 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|337743301|gb|AEI73147.1| XRCC1 [Kryptolebias marmoratus] Back     alignment and taxonomy information
>gi|340375016|ref|XP_003386033.1| PREDICTED: DNA repair protein XRCC1-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|51571935|ref|NP_001003988.1| DNA repair protein XRCC1 [Danio rerio] gi|51330093|gb|AAH80268.1| Zgc:91996 [Danio rerio] gi|182890918|gb|AAI65774.1| Zgc:91996 protein [Danio rerio] Back     alignment and taxonomy information
>gi|410904431|ref|XP_003965695.1| PREDICTED: DNA repair protein XRCC1-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|348527426|ref|XP_003451220.1| PREDICTED: DNA repair protein XRCC1-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
ZFIN|ZDB-GENE-040822-30 617 xrcc1 "X-ray repair complement 0.975 0.129 0.537 1.4e-15
FB|FBgn0026751 614 XRCC1 "XRCC1" [Drosophila mela 0.975 0.130 0.475 5.4e-13
RGD|619823 631 Xrcc1 "X-ray repair complement 0.926 0.120 0.460 1.9e-12
UNIPROTKB|Q9ESZ0 631 Xrcc1 "DNA repair protein XRCC 0.926 0.120 0.460 1.9e-12
UNIPROTKB|F1PEQ7 629 XRCC1 "Uncharacterized protein 0.926 0.120 0.460 3.2e-12
UNIPROTKB|P18887 633 XRCC1 "DNA repair protein XRCC 0.926 0.120 0.460 3.2e-12
UNIPROTKB|F1RMW4 652 XRCC1 "Uncharacterized protein 0.926 0.116 0.460 3.4e-12
MGI|MGI:99137 631 Xrcc1 "X-ray repair complement 0.926 0.120 0.460 5.2e-12
UNIPROTKB|F1N2F9 646 XRCC1 "Uncharacterized protein 0.926 0.117 0.447 1.5e-11
UNIPROTKB|E9PJ8289 E9PJ82 "Uncharacterized protei 0.975 0.898 0.426 2e-10
ZFIN|ZDB-GENE-040822-30 xrcc1 "X-ray repair complementing defective repair in Chinese hamster cells 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 1.4e-15, P = 1.4e-15
 Identities = 43/80 (53%), Positives = 53/80 (66%)

Query:     1 MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60
             M  +K   VVS SSED  HKADNLL+ ++ +KWK    GEKQ   ILQL  + QI+ IDI
Sbjct:     1 MPELKLKHVVSCSSEDNTHKADNLLSSDTYRKWKAARPGEKQVSVILQLEKEEQIHSIDI 60

Query:    61 GNEFSAFVEVFVAKSSNPDD 80
             GNE SAF+EV V  S++  D
Sbjct:    61 GNEGSAFIEVLVGHSTSVKD 80




GO:0000012 "single strand break repair" evidence=IEA
GO:0003684 "damaged DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
FB|FBgn0026751 XRCC1 "XRCC1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|619823 Xrcc1 "X-ray repair complementing defective repair in Chinese hamster cells 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ESZ0 Xrcc1 "DNA repair protein XRCC1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEQ7 XRCC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P18887 XRCC1 "DNA repair protein XRCC1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMW4 XRCC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:99137 Xrcc1 "X-ray repair complementing defective repair in Chinese hamster cells 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2F9 XRCC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PJ82 E9PJ82 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
pfam01834153 pfam01834, XRCC1_N, XRCC1 N terminal domain 3e-17
>gnl|CDD|202000 pfam01834, XRCC1_N, XRCC1 N terminal domain Back     alignment and domain information
 Score = 70.6 bits (172), Expect = 3e-17
 Identities = 35/76 (46%), Positives = 47/76 (61%)

Query: 1  MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60
          M  I    VVS SS+D  H A+NLL  ++ +KW+    GEK    +LQL  + QI+ +DI
Sbjct: 1  MPEISLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI 60

Query: 61 GNEFSAFVEVFVAKSS 76
          GN+ SAFVEV V  S+
Sbjct: 61 GNDGSAFVEVLVGSSA 76


Length = 153

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
PF01834153 XRCC1_N: XRCC1 N terminal domain; InterPro: IPR002 100.0
KOG3226|consensus 508 100.0
cd08366139 APC10 APC10 subunit of the anaphase-promoting comp 97.36
PF00754129 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 97.08
cd00057143 FA58C Substituted updates: Jan 31, 2002 96.79
PF03561152 Allantoicase: Allantoicase repeat; InterPro: IPR01 96.78
cd08666134 APC10-HECTD3 APC10-like DOC1 domain of HECTD3, a H 96.64
PF06588 199 Muskelin_N: Muskelin N-terminus; InterPro: IPR0105 95.72
PF03256193 APC10: Anaphase-promoting complex, subunit 10 (APC 95.71
cd08159129 APC10-like APC10-like DOC1 domains in E3 ubiquitin 95.71
KOG3437|consensus184 95.2
cd08667131 APC10-ZZEF1 APC10/DOC1-like domain of uncharacteri 95.01
cd08365131 APC10-like1 APC10-like DOC1 domains of E3 ubiquiti 95.0
cd08665131 APC10-CUL7 APC10-like DOC1 domain of CUL7, subunit 93.91
cd08664152 APC10-HERC2 APC10-like DOC1 domain present in HERC 93.22
TIGR02961322 allantoicase allantoicase. A different but similar 92.72
PRK13257336 allantoicase; Provisional 92.09
PRK13797 516 putative bifunctional allantoicase/OHCU decarboxyl 90.62
TIGR02961 322 allantoicase allantoicase. A different but similar 88.49
PRK13797 516 putative bifunctional allantoicase/OHCU decarboxyl 86.31
PRK13257 336 allantoicase; Provisional 84.28
PF00055 237 Laminin_N: Laminin N-terminal (Domain VI); InterPr 83.53
PF07738135 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: I 81.03
>PF01834 XRCC1_N: XRCC1 N terminal domain; InterPro: IPR002706 DNA-repair protein Xrcc1 functions in the repair of single-strand DNA breaks in mammalian cells and forms a repair complex with beta-Pol, ligase III and PARP [] Back     alignment and domain information
Probab=100.00  E-value=3.4e-47  Score=270.42  Aligned_cols=78  Identities=58%  Similarity=0.838  Sum_probs=69.2

Q ss_pred             CCcceeceEEEeecCCCCCccccccCCCCCCCeeecCCCceeEEEEEecCCcceeeEEEeCCCCeEEEEEEeeccCCC
Q psy12987          1 MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAKSSNP   78 (82)
Q Consensus         1 Mp~i~~~~Vvs~SSEd~~hpaeNLL~~~~~r~W~~~~~Ge~~~~V~lql~~~~~I~~IDIGN~gSAfiEvlVg~s~~~   78 (82)
                      ||+|||+|||||||||+.|||||||++|+||+|+|+++||++++|||||+||++|++|||||+||||||||||||+|+
T Consensus         1 Mp~ik~k~VvS~SSed~~~~A~NLL~~d~~r~W~~~~~gek~~~V~lQl~~~~~I~~IDIGN~gSAfiEVlVg~S~~~   78 (153)
T PF01834_consen    1 MPEIKLKHVVSFSSEDPVHPAENLLKSDTYRKWKCAKAGEKQASVELQLEKASQITSIDIGNEGSAFIEVLVGRSSWS   78 (153)
T ss_dssp             --BCGEEEEEEESSS-SSSHGGGGSCGGGCHHEEHSSTT-SEEEEEEEEEEEE--SEEEEEEEB-SEEEEEEE-STTS
T ss_pred             CCcceeeEEEEEeCCCCCCchhhccCcccCCcccccCCCCceEEEEEEecCceEEEEEeccCCCeEEEEEEeeccccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999996



The NMR solution structure of the Xrcc1 N-terminal domain (Xrcc1 NTD) shows that the structural core is a beta-sandwich with beta-strands connected by loops, three helices and two short two-stranded beta-sheets at each connection side. The Xrcc1 NTD specifically binds single-strand break DNA (gapped and nicked) and a gapped DNA-beta-Pol complex [].; GO: 0003684 damaged DNA binding, 0000012 single strand break repair, 0005634 nucleus; PDB: 3K77_E 3K75_C 3LQC_A 1XNA_A 1XNT_A.

>KOG3226|consensus Back     alignment and domain information
>cd08366 APC10 APC10 subunit of the anaphase-promoting complex (APC) that mediates substrate ubiquitination Back     alignment and domain information
>PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain Back     alignment and domain information
>cd00057 FA58C Substituted updates: Jan 31, 2002 Back     alignment and domain information
>PF03561 Allantoicase: Allantoicase repeat; InterPro: IPR015908 Allantoicase (also known as allantoate amidinohydrolase) is involved in purine degradation, facilitating the utilization of purines as secondary nitrogen sources under nitrogen-limiting conditions Back     alignment and domain information
>cd08666 APC10-HECTD3 APC10-like DOC1 domain of HECTD3, a HECT E3 ubiquitin ligase protein that mediates substrate ubiquitination Back     alignment and domain information
>PF06588 Muskelin_N: Muskelin N-terminus; InterPro: IPR010565 This entry represents the N-terminal region of muskelin and is found in conjunction with several IPR006652 from INTERPRO repeats Back     alignment and domain information
>PF03256 APC10: Anaphase-promoting complex, subunit 10 (APC10); InterPro: IPR004939 The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase Back     alignment and domain information
>cd08159 APC10-like APC10-like DOC1 domains in E3 ubiquitin ligases that mediate substrate ubiquitination Back     alignment and domain information
>KOG3437|consensus Back     alignment and domain information
>cd08667 APC10-ZZEF1 APC10/DOC1-like domain of uncharacterized Zinc finger ZZ-type and EF-hand domain-containing protein 1 (ZZEF1) and homologs Back     alignment and domain information
>cd08365 APC10-like1 APC10-like DOC1 domains of E3 ubiquitin ligases that mediate substrate ubiquitination Back     alignment and domain information
>cd08665 APC10-CUL7 APC10-like DOC1 domain of CUL7, subunit of the SCF-ROC1-like E3 ubiquitin ligase complex that mediates substrate ubiquitination Back     alignment and domain information
>cd08664 APC10-HERC2 APC10-like DOC1 domain present in HERC2 (HECT domain and RLD2) Back     alignment and domain information
>TIGR02961 allantoicase allantoicase Back     alignment and domain information
>PRK13257 allantoicase; Provisional Back     alignment and domain information
>PRK13797 putative bifunctional allantoicase/OHCU decarboxylase; Provisional Back     alignment and domain information
>TIGR02961 allantoicase allantoicase Back     alignment and domain information
>PRK13797 putative bifunctional allantoicase/OHCU decarboxylase; Provisional Back     alignment and domain information
>PRK13257 allantoicase; Provisional Back     alignment and domain information
>PF00055 Laminin_N: Laminin N-terminal (Domain VI); InterPro: IPR008211 Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue Back     alignment and domain information
>PF07738 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: IPR012919 The Caenorhabditis elegans UNC-84 protein is a nuclear envelope protein that is involved in nuclear anchoring and migration during development Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
3k75_B 189 X-Ray Crystal Structure Of Reduced Xrcc1 Bound To D 4e-14
3k77_A161 X-Ray Crystal Structure Of Xrcc1 Length = 161 4e-14
1xna_A 183 Nmr Solution Structure Of The Single-Strand Break R 1e-13
>pdb|3K75|B Chain B, X-Ray Crystal Structure Of Reduced Xrcc1 Bound To Dna Pol Beta Catalytic Domain Length = 189 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 35/77 (45%), Positives = 48/77 (62%) Query: 1 MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60 M I+ VVS SS+D H A+NLL ++ +KW+ GEK +LQL + QI+ +DI Sbjct: 1 MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI 60 Query: 61 GNEFSAFVEVFVAKSSN 77 GN+ SAFVEV V S+ Sbjct: 61 GNDGSAFVEVLVGSSAG 77
>pdb|3K77|A Chain A, X-Ray Crystal Structure Of Xrcc1 Length = 161 Back     alignment and structure
>pdb|1XNA|A Chain A, Nmr Solution Structure Of The Single-Strand Break Repair Protein Xrcc1-N-Terminal Domain Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
3lqc_A 189 DNA repair protein XRCC1; allosteric disulfide, sc 4e-31
>3lqc_A DNA repair protein XRCC1; allosteric disulfide, scaffolding protein, DNA repair, DNA D nucleus, phosphoprotein, polymorphism, DNA replication; HET: DNA; 2.35A {Homo sapiens} PDB: 3k75_B* 1xna_A 1xnt_A 3k77_A* Length = 189 Back     alignment and structure
 Score =  106 bits (266), Expect = 4e-31
 Identities = 35/80 (43%), Positives = 48/80 (60%)

Query: 1  MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60
          M  I+   VVS SS+D  H A+NLL  ++ +KW+    GEK    +LQL  + QI+ +DI
Sbjct: 1  MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI 60

Query: 61 GNEFSAFVEVFVAKSSNPDD 80
          GN+ SAFVEV V  S+    
Sbjct: 61 GNDGSAFVEVLVGSSAGGAG 80


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
3lqc_A 189 DNA repair protein XRCC1; allosteric disulfide, sc 100.0
2yc2_A139 IFT25, intraflagellar transport protein 25; transp 98.53
1tvg_A153 LOC51668 protein; cell cycle, structural genomics, 98.39
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 97.26
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 97.26
3f2z_A159 Uncharacterized protein BF3579; the present C-term 97.12
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 97.03
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 96.93
3hnm_A172 Putative chitobiase; PSI-2, protein structure init 96.36
2v72_A143 CBM32, EXO-alpha-sialidase; galactose, bacterial p 96.35
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 96.24
1jhj_A171 APC10; beta sandwich, jellyroll, cell cycle; 1.60A 96.09
1o59_A355 Allantoicase; YIR029W, structural genomics, JCSG, 95.93
1gqp_A221 DOC1/APC10; cell cycle, APC10/DOC1, APC/cyclosome, 95.77
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 95.54
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 95.11
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 94.91
1o59_A 355 Allantoicase; YIR029W, structural genomics, JCSG, 94.6
1w8o_A601 Bacterial sialidase; 3D-structure, glycosidase, hy 94.53
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 94.02
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 93.9
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 93.88
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 93.82
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 93.06
4gwi_A153 Lectinolysin, platelet aggregation factor SM-HPAF; 92.84
3cqo_A 293 FBP32; F-lectin, fucolectin, sugar binding protein 91.63
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 90.9
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 90.31
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 86.09
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 85.57
>3lqc_A DNA repair protein XRCC1; allosteric disulfide, scaffolding protein, DNA repair, DNA D nucleus, phosphoprotein, polymorphism, DNA replication; HET: DNA; 2.35A {Homo sapiens} PDB: 3k75_B* 1xna_A 1xnt_A 3k77_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-45  Score=265.90  Aligned_cols=81  Identities=46%  Similarity=0.726  Sum_probs=77.7

Q ss_pred             CCcceeceEEEeecCCCCCccccccCCCCCCCeeecCCCceeEEEEEecCCcceeeEEEeCCCCeEEEEEEeeccCC---
Q psy12987          1 MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAKSSN---   77 (82)
Q Consensus         1 Mp~i~~~~Vvs~SSEd~~hpaeNLL~~~~~r~W~~~~~Ge~~~~V~lql~~~~~I~~IDIGN~gSAfiEvlVg~s~~---   77 (82)
                      ||+|+|+||||||||||+|||+|||++|+||+|+|+++||++++|||||++|++|++|||||+||||||||||||+|   
T Consensus         1 Mp~vk~k~Vvs~SSED~~~~AeNLL~~d~~rkW~~~~~gek~~~VeLQle~~~~I~~IDIGN~gSAfIEVlVgrS~~~~~   80 (189)
T 3lqc_A            1 MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAG   80 (189)
T ss_dssp             -CCGGGEEEEEETTSCHHHHHHHHHTCHHHHHHHHHTTTCSEEEEEEEEEEEECCCEEEEEEEBCSEEEEEEECCTTCCC
T ss_pred             CCcceeeEEEEEcCCCCCCchhhccCCCCCCceeccCCCCceEEEEEEcCCceEeeEEeecCCceEEEEEEeecccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999   


Q ss_pred             CCCC
Q psy12987         78 PDDY   81 (82)
Q Consensus        78 ~~~f   81 (82)
                      ++||
T Consensus        81 ~~~f   84 (189)
T 3lqc_A           81 EQDY   84 (189)
T ss_dssp             GGGC
T ss_pred             CCCc
Confidence            3666



>2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A Back     alignment and structure
>1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Back     alignment and structure
>1jhj_A APC10; beta sandwich, jellyroll, cell cycle; 1.60A {Homo sapiens} SCOP: b.18.1.9 Back     alignment and structure
>1o59_A Allantoicase; YIR029W, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics, hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: b.18.1.22 b.18.1.22 PDB: 1sg3_A Back     alignment and structure
>1gqp_A DOC1/APC10; cell cycle, APC10/DOC1, APC/cyclosome, ubiquitination, E3 ubiquitin ligase, beta sandwich, jelly roll; 2.2A {Saccharomyces cerevisiae} SCOP: b.18.1.9 Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>1o59_A Allantoicase; YIR029W, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics, hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: b.18.1.22 b.18.1.22 PDB: 1sg3_A Back     alignment and structure
>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Back     alignment and structure
>4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d1xnta_151 b.18.1.8 (A:) N-terminal domain of xrcc1 {Human (H 2e-34
>d1xnta_ b.18.1.8 (A:) N-terminal domain of xrcc1 {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure

class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: N-terminal domain of xrcc1
domain: N-terminal domain of xrcc1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  112 bits (282), Expect = 2e-34
 Identities = 37/85 (43%), Positives = 51/85 (60%), Gaps = 3/85 (3%)

Query: 1  MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDI 60
          M  I+   VVS SS+D  H A+NLL  ++ +KW+    GEK    +LQL  + QI+ +DI
Sbjct: 1  MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI 60

Query: 61 GNEFSAFVEVFVAKSS---NPDDYK 82
          GN+ SAFVEV V  S+      DY+
Sbjct: 61 GNDGSAFVEVLVGSSAGGAGEQDYE 85


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1xnta_151 N-terminal domain of xrcc1 {Human (Homo sapiens) [ 100.0
d1tvga_136 Placental protein 25, pp25 {Human (Homo sapiens) [ 98.57
d1gqpa_194 APC10/DOC1 subunit of the anaphase-promoting compl 97.89
d1jhja_161 APC10/DOC1 subunit of the anaphase-promoting compl 97.82
d1k3ia2162 Galactose oxidase, N-terminal domain {Fungi (Fusar 97.63
d1w8oa2142 Sialidase, C-terminal domain {Micromonospora virid 97.09
d1o59a2150 Allantoicase {Baker's yeast (Saccharomyces cerevis 94.89
d2qqia2155 B1 domain of neuropilin-1 {Human (Homo sapiens) [T 92.86
d2qqia1156 C2 domain of factor VIII {Human (Homo sapiens) [Ta 92.54
d1o59a1188 Allantoicase {Baker's yeast (Saccharomyces cerevis 92.2
d1sddb3162 C2 domain of factor V {Cow (Bos taurus) [TaxId: 99 89.16
>d1xnta_ b.18.1.8 (A:) N-terminal domain of xrcc1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: N-terminal domain of xrcc1
domain: N-terminal domain of xrcc1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.6e-47  Score=266.23  Aligned_cols=82  Identities=45%  Similarity=0.718  Sum_probs=78.9

Q ss_pred             CCcceeceEEEeecCCCCCccccccCCCCCCCeeecCCCceeEEEEEecCCcceeeEEEeCCCCeEEEEEEeeccCCC--
Q psy12987          1 MAPIKFARVVSYSSEDPVHKADNLLNPESTKKWKCKSMGEKQAVAILQLSSQVQINGIDIGNEFSAFVEVFVAKSSNP--   78 (82)
Q Consensus         1 Mp~i~~~~Vvs~SSEd~~hpaeNLL~~~~~r~W~~~~~Ge~~~~V~lql~~~~~I~~IDIGN~gSAfiEvlVg~s~~~--   78 (82)
                      ||+|+|||||||||||++|||+|||+++++|+|+|+++||++++|||||++|++|++|||||+||||||||||||+|+  
T Consensus         1 M~~i~~k~Vvs~SSeD~~~~a~NLL~~~~~rkW~~~~~gek~a~ViLQle~as~I~~IDIGN~gSAfiEVlVgrSs~~~~   80 (151)
T d1xnta_           1 MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAG   80 (151)
T ss_dssp             CCSCCBCCCSEEESCCSTTCGGGGGGSSTTCCCCCSSSSCSEEEEEEEEEEEECCSEEEEEEEBCCEEEEEEECSSSSSC
T ss_pred             CCceeeeEEEEEcccCCCCchhhccCCCCCCcceecCCCCeeEEEEEEeCCceecceEeecCCCeEEEEEEEeccCCCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999873  


Q ss_pred             -CCCC
Q psy12987         79 -DDYK   82 (82)
Q Consensus        79 -~~f~   82 (82)
                       +||+
T Consensus        81 ~~~f~   85 (151)
T d1xnta_          81 EQDYE   85 (151)
T ss_dssp             SSCCE
T ss_pred             Cccce
Confidence             5673



>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1o59a2 b.18.1.22 (A:194-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o59a1 b.18.1.22 (A:0-187) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure