Psyllid ID: psy1308


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------
MFRILVQRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSGADPTVKDNSGHIPSDYAEDANIKQILQKYAEKYADLQREKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVSEDSAKGGIIKLKVKKKGMKDFIDVV
ccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccHHHHcccHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHccccccccccccccHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccccccccccEEEccccEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHccHHHHHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccEEEEccccccEEEEEEEEcccccccccc
ccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEHHHHHHHccHHHHccccccccccccccHHHHHHHccccEEEEEHHHHHHcHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccHHHHHHHcccccHHHHHHHHHHHHcccccccccHccccHHHHHHHHHHHHHHHcccHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEccccccccccccccccccccccc
MFRILVQRRQLVLCILSnyfkqkpykrgfqssklfyttqstqadfksCLSVFpkirqsnntcmynNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIEnskldvnmrhplgwtplhvAAINGKVDNVRVLLEaganpnlgdlfNTVHRTAaekkmnpfeVLLKREDefndvlnpnmtfLGFSALHYGVVAGNTEVVELLLKsgadptvkdnsghipsdyaedANIKQILQKYAEKYADLQREKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKrkengwtdddhplVFLFlgssgigkTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAkligappgylghddggqltkrlkkcpnavvlfdevdkahPDVLTVLLQLFdegrltdgkgktiecKDAIFVMTSNLASNEIAQHALQLRKEgeefskrtpsisksqgsnldvtisrhfkdhvvqpilkrhfrrdeFLGRINEIVYFlpfskselHTLVCRELNFWAKKALdkhninivWDIDVETiladgydvhygarsiKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVsedsakggIIKLKVKKKGMKDFIDVV
mfrilvqrRQLVLCILsnyfkqkpykrgfQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAganpnlgdlFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSgadptvkdnsghipsdyaedaNIKQILQKYAEKYADLQrekeaeerrkypleqrlkdrivgqesAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLfdegrltdgkgktIECKDAIFVMTSNLASNEIAQHALQLRKEGEefskrtpsisksqgsnldvTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAaheksvigkgSFVRLYVQWSkevsedsakggiiklkvkkkgmkdfidvv
MFRILVQRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSGADPTVKDNSGHIPSDYAEDANIKQILQKYAEKYADLQREKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVSEDSAkggiiklkvkkkgmkDFIDVV
**RILVQRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKS*********************NIKQILQKYA**************************RIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEI*****************************DVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVS****KGGIIKLKV************
**R***QRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIE*****VNMRHPLGWTPLHVAA***************ANPNLGDLFN***************************LNPNMTFLGFSALHYGVVAGNTEVV***********************AEDANIKQILQKYAEKYADL***********YPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQ**************************ISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKE************************DVV
MFRILVQRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSGADPTVKDNSGHIPSDYAEDANIKQILQKYAEKYADL**********KYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRK******************NLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVSEDSAKGGIIKLKVKKKGMKDFIDVV
MFRILVQRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSGAD*********IPSDYAEDANIKQILQKYAEKYADLQREKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTP************TISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVSEDSAKG*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRILVQRRQLVLCILSNYFKQKPYKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSGADPTVKDNSGHIPSDYAExxxxxxxxxxxxxxxxxxxxxxxxxxxxKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWSKEVSEDSAKGGIIKLKVKKKGMKDFIDVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query607 2.2.26 [Sep-21-2011]
Q60649677 Caseinolytic peptidase B yes N/A 0.902 0.809 0.562 1e-173
Q5E9N5677 Caseinolytic peptidase B yes N/A 0.808 0.725 0.610 1e-172
Q9WTT2677 Caseinolytic peptidase B yes N/A 0.899 0.806 0.561 1e-172
Q9H078707 Caseinolytic peptidase B yes N/A 0.827 0.710 0.567 1e-168
Q6MD97868 Chaperone protein ClpB OS yes N/A 0.520 0.364 0.423 1e-70
Q81GM5866 Chaperone protein ClpB OS yes N/A 0.459 0.322 0.401 2e-58
Q7MNK1857 Chaperone protein ClpB OS yes N/A 0.454 0.322 0.381 3e-58
Q7CU92874 Chaperone protein ClpB OS yes N/A 0.622 0.432 0.359 3e-58
Q7AJA9866 Chaperone protein ClpB OS yes N/A 0.471 0.330 0.412 3e-58
Q89YY3862 Chaperone protein ClpB OS yes N/A 0.451 0.317 0.395 4e-58
>sp|Q60649|CLPB_MOUSE Caseinolytic peptidase B protein homolog OS=Mus musculus GN=Clpb PE=1 SV=1 Back     alignment and function desciption
 Score =  610 bits (1572), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 314/558 (56%), Positives = 417/558 (74%), Gaps = 10/558 (1%)

Query: 25  YKRGFQSSKLFYTTQSTQADFKSCLSVFPKIRQSNNTCMYNNLLFASACSLALTLLEC-- 82
           + R  + +++ Y T ++     S     P  + S N       L   A ++AL +++C  
Sbjct: 71  WGRRGERTEIPYLTAASSERGPSPEETLPG-QDSWNGVPNKTGLGMWALAMAL-VVQCYS 128

Query: 83  --QSIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLL 140
              S KD  L  AAR  + +E++  +     DVN RH LGWT L VA+I+     V+VLL
Sbjct: 129 KNPSNKDAALMEAARANNVQEVRRLLSEGA-DVNARHKLGWTALMVASISHNESVVQVLL 187

Query: 141 EAGANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAG 200
            AGA+PNLGD F++V++TA E+ ++  EVL+ RED+FN+ LN   +F G +ALHY V+A 
Sbjct: 188 AAGADPNLGDEFSSVYKTANEQGVHSLEVLVTREDDFNNRLNHRASFKGCTALHYAVLAD 247

Query: 201 NTEVVELLLKSGADPTVKDNSGHIPSDYAEDANIKQILQKYAEKYADLQREKEAEERRKY 260
           +  +V+ LL  GA+P  ++  GH P DYA +  + ++L+    KY + QR++EAEERR++
Sbjct: 248 DYSIVKELLDRGANPLQRNEMGHTPLDYAREGEVMKLLKTSETKYMEKQRKREAEERRRF 307

Query: 261 PLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFY 320
           PLEQRLK+ I+GQESAI  + AAI+RKENGW D++HPLVFLFLGSSGIGKTELAKQ A Y
Sbjct: 308 PLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKY 367

Query: 321 IHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVD 380
           +H+D K+ FIRLDMSE+QE+HEVAK IG+PPGY+GH++GGQLTK+LK+CPNAVVLFDEVD
Sbjct: 368 MHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAVVLFDEVD 427

Query: 381 KAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFS 440
           KAHPDVLT++LQLFDEGRLTDGKGKTI+CKDAIF+MTSN+AS+EIAQHALQLR+E  E S
Sbjct: 428 KAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMS 487

Query: 441 KR--TPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSEL 498
           +     ++   Q S+  +TIS++FK++V++PILK HFRRDEFLGRINEIVYFLPF  SEL
Sbjct: 488 RNRIAENLGDVQMSD-KITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSEL 546

Query: 499 HTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAA 558
             LV +ELNFWAK+A  +HNI ++WD +V  +L DGY+VHYGARSIKHEVER+VV+QLAA
Sbjct: 547 IQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVERRVVNQLAA 606

Query: 559 AHEKSVIGKGSFVRLYVQ 576
           A+E+ ++  G  +R+ V+
Sbjct: 607 AYEQDLLPGGCTLRITVE 624




May function as a regulatory ATPase and be related to secretion/protein trafficking process.
Mus musculus (taxid: 10090)
>sp|Q5E9N5|CLPB_BOVIN Caseinolytic peptidase B protein homolog OS=Bos taurus GN=CLPB PE=2 SV=1 Back     alignment and function description
>sp|Q9WTT2|CLPB_RAT Caseinolytic peptidase B protein homolog OS=Rattus norvegicus GN=Clpb PE=2 SV=1 Back     alignment and function description
>sp|Q9H078|CLPB_HUMAN Caseinolytic peptidase B protein homolog OS=Homo sapiens GN=CLPB PE=1 SV=1 Back     alignment and function description
>sp|Q6MD97|CLPB_PARUW Chaperone protein ClpB OS=Protochlamydia amoebophila (strain UWE25) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q81GM5|CLPB_BACCR Chaperone protein ClpB OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q7MNK1|CLPB_VIBVY Chaperone protein ClpB OS=Vibrio vulnificus (strain YJ016) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q7CU92|CLPB_AGRT5 Chaperone protein ClpB OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=clpB PE=3 SV=2 Back     alignment and function description
>sp|Q7AJA9|CLPB_CHLPN Chaperone protein ClpB OS=Chlamydia pneumoniae GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q89YY3|CLPB_BACTN Chaperone protein ClpB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=clpB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
91080595593 PREDICTED: similar to Caseinolytic pepti 0.909 0.930 0.614 0.0
242023901682 suppressor of potassium transport defect 0.912 0.812 0.595 0.0
307180438642 Caseinolytic peptidase B protein-like pr 0.876 0.828 0.603 0.0
332026312609 Caseinolytic peptidase B protein-like pr 0.876 0.873 0.604 0.0
322792402642 hypothetical protein SINV_11479 [Solenop 0.863 0.816 0.600 0.0
383853509670 PREDICTED: caseinolytic peptidase B prot 0.874 0.792 0.604 0.0
350400658643 PREDICTED: caseinolytic peptidase B prot 0.855 0.807 0.609 0.0
340711024643 PREDICTED: caseinolytic peptidase B prot 0.878 0.828 0.595 0.0
345486795631 PREDICTED: caseinolytic peptidase B prot 0.840 0.808 0.632 0.0
390351646544 PREDICTED: caseinolytic peptidase B prot 0.850 0.948 0.591 0.0
>gi|91080595|ref|XP_973935.1| PREDICTED: similar to Caseinolytic peptidase B protein homolog (Suppressor of potassium transport defect 3) [Tribolium castaneum] gi|270005512|gb|EFA01960.1| hypothetical protein TcasGA2_TC007578 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/565 (61%), Positives = 432/565 (76%), Gaps = 13/565 (2%)

Query: 48  CLSVFPKIRQSNNTCMYNNLLFASACSLALTLLECQSIKDLT-----LFRAARYGSAKEL 102
           C   FP  +Q+     +N+    S   L  T L   S  + T     LFRAA+YG  +EL
Sbjct: 22  CAPKFPSFQQNEEKRGFNHPKTDSLAFLGFTGLVIASCDNRTQSNKRLFRAAQYGVVEEL 81

Query: 103 KTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAGANPNLGDLFNTVHRTAAEK 162
           KT I+N K ++N RH LGWTPL VAA+N + + V+ LLEAGA PNLG+ F +  RTA EK
Sbjct: 82  KTLIKN-KANLNARHELGWTPLMVAAVNNQYEAVKALLEAGAEPNLGEEFISAKRTAKEK 140

Query: 163 KMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTEVVELLLKSGADPTVKDNSG 222
            ++P EVL+ RE+EF++ LN  ++F GF+ALHY V+  N  +V+LL+  GADPT+++ +G
Sbjct: 141 GLHPIEVLMTREEEFSNSLNAKVSFRGFTALHYAVLINNLSIVKLLIDQGADPTIENEAG 200

Query: 223 HIPSDYAEDANIKQILQKYAEKYADLQREKEAEERRKYPLEQRLKDRIVGQESAINIISA 282
           H P  YA + ++K  LQ+   K+ +++++ E EERR++PLE+RLK RIVGQE AI I+SA
Sbjct: 201 HTPLAYAVEGDLKNYLQEKTSKFEEIKKQNELEERRRFPLEERLKTRIVGQEGAITIVSA 260

Query: 283 AIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHE 342
            I+RKENGW DD+HPLVFLFLGSSGIGKTELAKQLA YIH++K +AFIRLDMSEYQEKHE
Sbjct: 261 TIRRKENGWGDDEHPLVFLFLGSSGIGKTELAKQLAAYIHKEKPQAFIRLDMSEYQEKHE 320

Query: 343 VAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDG 402
           VAKLIGAPPGY+GHD+GGQLT RLK+CPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDG
Sbjct: 321 VAKLIGAPPGYIGHDEGGQLTSRLKQCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDG 380

Query: 403 KGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHF 462
            GKTIECK+AIF+MTSNLAS+EIAQH L+LR+E E       S +  +  + ++TISR F
Sbjct: 381 HGKTIECKNAIFIMTSNLASDEIAQHGLKLRQEIENLRANRLSNTTDEEISDNITISRKF 440

Query: 463 KDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIV 522
           KD VV+PILKRHF+RDEFLGRINEIVYFLPFS++EL  LV RE++ WA++A DKH I++ 
Sbjct: 441 KDEVVKPILKRHFKRDEFLGRINEIVYFLPFSRTELLQLVSREMSVWAQRAKDKHKIDLN 500

Query: 523 WDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQW-SKEV 581
           WD  VE+ LADGYDVHYGARSIK+EVER+VV+QLAAAHE   IGKGS V++   W  K +
Sbjct: 501 WDRSVESALADGYDVHYGARSIKYEVERRVVNQLAAAHESGFIGKGSVVQVTTVWHEKTL 560

Query: 582 SEDSAKGGIIKLKVKKKGMKDFIDV 606
           S +      IKL+VK KG K F+DV
Sbjct: 561 SPE------IKLRVKSKGAKGFVDV 579




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242023901|ref|XP_002432369.1| suppressor of potassium transport defect, putative [Pediculus humanus corporis] gi|212517792|gb|EEB19631.1| suppressor of potassium transport defect, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307180438|gb|EFN68464.1| Caseinolytic peptidase B protein-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332026312|gb|EGI66446.1| Caseinolytic peptidase B protein-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322792402|gb|EFZ16386.1| hypothetical protein SINV_11479 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383853509|ref|XP_003702265.1| PREDICTED: caseinolytic peptidase B protein homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|350400658|ref|XP_003485912.1| PREDICTED: caseinolytic peptidase B protein homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711024|ref|XP_003394082.1| PREDICTED: caseinolytic peptidase B protein homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|345486795|ref|XP_001607140.2| PREDICTED: caseinolytic peptidase B protein homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|390351646|ref|XP_786389.2| PREDICTED: caseinolytic peptidase B protein homolog [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
UNIPROTKB|E2R362677 CLPB "Uncharacterized protein" 0.807 0.723 0.612 4.5e-162
UNIPROTKB|F6XXW3704 CLPB "Uncharacterized protein" 0.807 0.696 0.612 4.5e-162
MGI|MGI:1100517677 Clpb "ClpB caseinolytic peptid 0.825 0.740 0.6 4.5e-162
UNIPROTKB|Q5E9N5677 CLPB "Caseinolytic peptidase B 0.808 0.725 0.610 2.5e-161
UNIPROTKB|F1M955543 Clpb "Caseinolytic peptidase B 0.803 0.898 0.611 2.5e-161
RGD|621328677 Clpb "ClpB caseinolytic peptid 0.825 0.740 0.596 2.2e-160
UNIPROTKB|Q9H078707 CLPB "Caseinolytic peptidase B 0.675 0.579 0.639 3.3e-160
UNIPROTKB|H0YGM0712 CLPB "Caseinolytic peptidase B 0.675 0.575 0.639 4.8e-157
UNIPROTKB|B4DXW4506 CLPB "cDNA FLJ53238, highly si 0.741 0.889 0.631 1.1e-153
UNIPROTKB|I3LJ13410 LOC100524385 "Uncharacterized 0.581 0.860 0.673 1.9e-131
UNIPROTKB|E2R362 CLPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 1578 (560.5 bits), Expect = 4.5e-162, P = 4.5e-162
 Identities = 304/496 (61%), Positives = 391/496 (78%)

Query:    84 SIKDLTLFRAARYGSAKELKTFIENSKLDVNMRHPLGWTPLHVAAINGKVDNVRVLLEAG 143
             S KD+ L  AAR  + +E+   +     DVN RH LGWT L VAAI+     VR+LL AG
Sbjct:   132 SNKDIALMEAARANNVQEVSRLLSEGA-DVNARHRLGWTALMVAAISRNDSVVRILLAAG 190

Query:   144 ANPNLGDLFNTVHRTAAEKKMNPFEVLLKREDEFNDVLNPNMTFLGFSALHYGVVAGNTE 203
             A+PNLGD F++V++TA E+ ++  EVL+ RED+FN+ LN   +F G +ALHY V+A +  
Sbjct:   191 ADPNLGDDFSSVYKTAKEQGIHSLEVLVTREDDFNNRLNNRASFKGCTALHYAVLADDYR 250

Query:   204 VVELLLKSGADPTVKDNSGHIPSDYAEDANIKQILQKYAEKYADLQREKEAEERRKYPLE 263
              V+ LL  GA+P  ++  GH P DYA +  + ++L+    KY + QR++EAEERR++PLE
Sbjct:   251 TVKELLDGGANPLQRNEMGHTPLDYAREGEVMKLLRTSEAKYQEKQRKREAEERRRFPLE 310

Query:   264 QRLKDRIVGQESAINIISAAIKRKENGWTDDDHPLVFLFLGSSGIGKTELAKQLAFYIHR 323
             QRLK+ I+GQESAI  + AAI+RKENGW D++HPLVFLFLGSSGIGKTELAKQ A Y+H+
Sbjct:   311 QRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHK 370

Query:   324 DKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAH 383
             D K+ FIRLDMSE+QE+HEVAK IG+PPGY+GH++GGQLTK+LK+CPNAVVLFDEVDKAH
Sbjct:   371 DAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAVVLFDEVDKAH 430

Query:   384 PDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRT 443
             PDVLT++LQLFDEGRLTDGKGKTI+CKDAIF+MTSN+AS+EIAQHALQLR+E  E S   
Sbjct:   431 PDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSHNR 490

Query:   444 PSISKSQGS---NLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHT 500
               I+++ G    N  +TIS++FK++V++PILK HFRRDEFLGRINEIVYFLPF  SEL  
Sbjct:   491 --IAENLGDVQINDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQ 548

Query:   501 LVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKHEVERQVVSQLAAAH 560
             LV +ELNFWAK+A  +HNI ++WD +V  +L DGY+VHYGARSIKHEVER+VV+QLAAA+
Sbjct:   549 LVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVERRVVNQLAAAY 608

Query:   561 EKSVIGKGSFVRLYVQ 576
             E+ ++  G  +R+ V+
Sbjct:   609 EQDLLPGGCTLRITVE 624




GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F6XXW3 CLPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1100517 Clpb "ClpB caseinolytic peptidase B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9N5 CLPB "Caseinolytic peptidase B protein homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1M955 Clpb "Caseinolytic peptidase B protein homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|621328 Clpb "ClpB caseinolytic peptidase B homolog (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H078 CLPB "Caseinolytic peptidase B protein homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YGM0 CLPB "Caseinolytic peptidase B protein homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXW4 CLPB "cDNA FLJ53238, highly similar to Caseinolytic peptidase B protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJ13 LOC100524385 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q60649CLPB_MOUSENo assigned EC number0.56270.90280.8094yesN/A
Q5E9N5CLPB_BOVINNo assigned EC number0.61010.80880.7252yesN/A
Q9H078CLPB_HUMANNo assigned EC number0.56740.82700.7100yesN/A
Q9WTT2CLPB_RATNo assigned EC number0.56190.89950.8064yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 1e-89
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 1e-77
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 2e-69
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 4e-64
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 4e-63
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 4e-62
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 2e-55
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 1e-42
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-14
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 5e-14
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 4e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-12
smart00382148 smart00382, AAA, ATPases associated with a variety 6e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-10
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-08
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 6e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-06
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-06
pfam13401124 pfam13401, AAA_22, AAA domain 5e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-06
pfam1043181 pfam10431, ClpB_D2-small, C-terminal, D2-small dom 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
smart0024830 smart00248, ANK, ankyrin repeats 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-05
pfam00004131 pfam00004, AAA, ATPase family associated with vari 5e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-05
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 3e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 3e-04
TIGR00764 608 TIGR00764, lon_rel, lon-related putative ATP-depen 5e-04
COG1221403 COG1221, PspF, Transcriptional regulators containi 5e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 9e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.003
smart0108690 smart01086, ClpB_D2-small, C-terminal, D2-small do 0.003
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.003
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  294 bits (754), Expect = 1e-89
 Identities = 132/328 (40%), Positives = 194/328 (59%), Gaps = 30/328 (9%)

Query: 251 EKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSSGIG 309
           E E E+     LE+RLK R++GQ+ A+  +S AI+R   G  D + P+  FLFLG +G+G
Sbjct: 476 EDEKEKLLN--LERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVG 533

Query: 310 KTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKC 369
           KTELAK LA  +    ++A IR+DMSEY EKH V++LIGAPPGY+G+++GGQLT+ +++ 
Sbjct: 534 KTELAKALAEALF-GDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRK 592

Query: 370 PNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHA 429
           P +V+L DE++KAHPDV  +LLQ+ D+GRLTDG+G+T++ ++ I +MTSN  S EI + A
Sbjct: 593 PYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILRDA 652

Query: 430 LQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVY 489
                                    D       K+  V   LK+HF R EFL RI+EI+ 
Sbjct: 653 D----------------------GDDFADKEALKEA-VMEELKKHF-RPEFLNRIDEIIP 688

Query: 490 FLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDV-ETILADGYDVHYGARSIKHEV 548
           F P SK  L  +V  +LN  AK+ L +  I +    +  + +   GYD  YGAR ++  +
Sbjct: 689 FNPLSKEVLERIVDLQLNRLAKR-LAERGITLELSDEAKDFLAEKGYDPEYGARPLRRAI 747

Query: 549 ERQVVSQLAAAHEKSVIGKGSFVRLYVQ 576
           ++++   LA       I  G  V++ V 
Sbjct: 748 QQEIEDPLADEILFGKIEDGGTVKVDVD 775


Length = 786

>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|204486 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|233120 TIGR00764, lon_rel, lon-related putative ATP-dependent protease Back     alignment and domain information
>gnl|CDD|224142 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|198154 smart01086, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 607
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
KOG1051|consensus898 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 99.98
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.98
PHA02791284 ankyrin-like protein; Provisional 99.98
PHA03100480 ankyrin repeat protein; Provisional 99.98
PHA03100480 ankyrin repeat protein; Provisional 99.98
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.97
PHA03095471 ankyrin-like protein; Provisional 99.97
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.97
KOG0510|consensus 929 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.97
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA03095471 ankyrin-like protein; Provisional 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.97
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.97
COG2204464 AtoC Response regulator containing CheY-like recei 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
KOG0510|consensus 929 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.97
KOG0509|consensus600 99.97
PHA02874434 ankyrin repeat protein; Provisional 99.96
KOG0509|consensus600 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02876682 ankyrin repeat protein; Provisional 99.96
KOG0508|consensus615 99.95
PHA02917661 ankyrin-like protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
KOG0508|consensus615 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02989494 ankyrin repeat protein; Provisional 99.94
KOG4177|consensus 1143 99.93
KOG4177|consensus 1143 99.93
PHA02792631 ankyrin-like protein; Provisional 99.93
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.93
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.93
PHA02730672 ankyrin-like protein; Provisional 99.93
KOG0502|consensus296 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
COG1221403 PspF Transcriptional regulators containing an AAA- 99.92
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.92
PHA02795437 ankyrin-like protein; Provisional 99.91
PHA02917661 ankyrin-like protein; Provisional 99.91
PHA02730672 ankyrin-like protein; Provisional 99.91
PRK15424538 propionate catabolism operon regulatory protein Pr 99.91
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.91
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.91
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.91
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.9
PRK11608326 pspF phage shock protein operon transcriptional ac 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0514|consensus452 99.9
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.9
KOG0507|consensus 854 99.89
KOG0745|consensus564 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.88
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.88
KOG0502|consensus296 99.88
PHA02792631 ankyrin-like protein; Provisional 99.87
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.87
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.87
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.87
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.87
KOG0505|consensus527 99.87
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.87
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.86
PHA02741169 hypothetical protein; Provisional 99.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.86
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.86
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.85
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.85
KOG0512|consensus228 99.85
KOG0514|consensus452 99.84
KOG0505|consensus527 99.83
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
PRK15115444 response regulator GlrR; Provisional 99.83
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.82
PHA02741169 hypothetical protein; Provisional 99.82
KOG0195|consensus448 99.82
KOG2004|consensus 906 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.8
KOG2170|consensus344 99.79
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.79
KOG0507|consensus 854 99.79
CHL00181287 cbbX CbbX; Provisional 99.78
KOG4369|consensus 2131 99.77
KOG0512|consensus228 99.76
KOG3676|consensus782 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
KOG4369|consensus 2131 99.72
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.7
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.69
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.69
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.68
KOG0195|consensus448 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
KOG4214|consensus117 99.61
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.6
KOG3676|consensus782 99.56
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.54
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.47
KOG1710|consensus396 99.45
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
KOG4214|consensus117 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.41
KOG0515|consensus752 99.4
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.39
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.38
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.38
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 99.38
PRK13342 413 recombination factor protein RarA; Reviewed 99.37
PRK13341 725 recombination factor protein RarA/unknown domain f 99.36
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.34
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.32
PRK13531 498 regulatory ATPase RavA; Provisional 99.31
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.3
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.3
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.29
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.27
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.26
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.26
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.26
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.25
PLN03025319 replication factor C subunit; Provisional 99.25
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.24
KOG0515|consensus752 99.23
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.23
KOG0730|consensus693 99.23
KOG2028|consensus 554 99.22
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.22
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.22
PRK12402337 replication factor C small subunit 2; Reviewed 99.22
PHA02244383 ATPase-like protein 99.22
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.22
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.21
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.19
KOG0989|consensus346 99.19
KOG1710|consensus396 99.19
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.18
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.18
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.18
CHL00195489 ycf46 Ycf46; Provisional 99.18
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.17
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.17
PRK03992389 proteasome-activating nucleotidase; Provisional 99.17
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.16
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.16
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.15
PRK13765 637 ATP-dependent protease Lon; Provisional 99.14
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.14
PHA02544316 44 clamp loader, small subunit; Provisional 99.13
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.13
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.12
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.11
KOG0736|consensus953 99.1
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.1
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.1
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.09
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.09
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.09
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.07
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.06
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.06
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.06
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.04
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.04
CHL00176 638 ftsH cell division protein; Validated 99.04
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.04
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.04
KOG0733|consensus802 99.03
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.03
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.03
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.02
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.01
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.01
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.01
PRK00440319 rfc replication factor C small subunit; Reviewed 99.0
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.99
KOG0727|consensus408 98.98
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.97
PF07726131 AAA_3: ATPase family associated with various cellu 98.96
COG0714329 MoxR-like ATPases [General function prediction onl 98.96
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.96
KOG0738|consensus491 98.96
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.94
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.94
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.94
PRK04195 482 replication factor C large subunit; Provisional 98.93
PRK08084235 DNA replication initiation factor; Provisional 98.93
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.93
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.92
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.92
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.92
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.92
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.9
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.9
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.9
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.88
PF00004132 AAA: ATPase family associated with various cellula 98.87
PRK08727233 hypothetical protein; Validated 98.86
smart00350509 MCM minichromosome maintenance proteins. 98.86
PRK06893229 DNA replication initiation factor; Validated 98.86
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.85
PF1360630 Ank_3: Ankyrin repeat 98.85
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.85
KOG0991|consensus333 98.84
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.84
PRK05642234 DNA replication initiation factor; Validated 98.82
KOG0734|consensus 752 98.82
KOG0733|consensus 802 98.82
PF1360630 Ank_3: Ankyrin repeat 98.82
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.79
KOG0818|consensus669 98.79
PRK09862506 putative ATP-dependent protease; Provisional 98.78
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.78
KOG0728|consensus404 98.78
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.78
KOG0783|consensus 1267 98.76
PRK09112351 DNA polymerase III subunit delta'; Validated 98.75
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.75
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.75
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.73
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.72
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.72
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.71
PRK12422445 chromosomal replication initiation protein; Provis 98.7
CHL00206 2281 ycf2 Ycf2; Provisional 98.7
PRK14087450 dnaA chromosomal replication initiation protein; P 98.7
KOG0739|consensus439 98.7
PRK07471365 DNA polymerase III subunit delta'; Validated 98.7
KOG0744|consensus423 98.69
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.69
PRK07399314 DNA polymerase III subunit delta'; Validated 98.69
KOG0506|consensus622 98.67
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.66
PRK05564313 DNA polymerase III subunit delta'; Validated 98.66
PRK00149450 dnaA chromosomal replication initiation protein; R 98.65
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.65
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.65
PRK14088440 dnaA chromosomal replication initiation protein; P 98.61
PRK08058329 DNA polymerase III subunit delta'; Validated 98.61
KOG0735|consensus952 98.59
KOG3609|consensus 822 98.58
KOG0506|consensus622 98.58
PRK04132846 replication factor C small subunit; Provisional 98.56
KOG0731|consensus 774 98.56
CHL00095 821 clpC Clp protease ATP binding subunit 98.55
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.53
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.53
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.52
KOG0818|consensus669 98.52
KOG0783|consensus 1267 98.52
PRK09087226 hypothetical protein; Validated 98.51
KOG0743|consensus457 98.5
KOG0782|consensus1004 98.48
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.47
KOG1942|consensus456 98.45
PRK14086617 dnaA chromosomal replication initiation protein; P 98.45
PRK10865 857 protein disaggregation chaperone; Provisional 98.45
KOG0522|consensus560 98.44
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.43
PRK06871325 DNA polymerase III subunit delta'; Validated 98.43
PRK06620214 hypothetical protein; Validated 98.41
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.41
KOG0705|consensus749 98.4
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.38
PRK05707328 DNA polymerase III subunit delta'; Validated 98.37
PRK08769319 DNA polymerase III subunit delta'; Validated 98.36
KOG0652|consensus424 98.36
KOG0726|consensus440 98.34
KOG0705|consensus749 98.33
KOG0729|consensus435 98.31
KOG0651|consensus388 98.29
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.27
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 98.27
KOG0522|consensus560 98.27
KOG0782|consensus1004 98.26
KOG0737|consensus386 98.24
PRK07993334 DNA polymerase III subunit delta'; Validated 98.22
PRK06090319 DNA polymerase III subunit delta'; Validated 98.22
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.21
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.21
PRK06964342 DNA polymerase III subunit delta'; Validated 98.18
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.14
PRK15455 644 PrkA family serine protein kinase; Provisional 98.14
KOG0742|consensus630 98.12
PRK12377248 putative replication protein; Provisional 98.12
PRK08116268 hypothetical protein; Validated 98.1
smart00382148 AAA ATPases associated with a variety of cellular 98.08
KOG2035|consensus351 98.06
KOG0521|consensus785 98.06
KOG0732|consensus 1080 98.06
KOG0520|consensus975 98.04
KOG0740|consensus428 98.02
PRK08699325 DNA polymerase III subunit delta'; Validated 98.0
KOG2384|consensus223 97.98
KOG0741|consensus 744 97.96
KOG0511|consensus516 97.95
KOG2227|consensus529 97.94
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.93
COG0593408 DnaA ATPase involved in DNA replication initiation 97.93
PF13173128 AAA_14: AAA domain 97.92
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.89
PRK07276290 DNA polymerase III subunit delta'; Validated 97.87
KOG0521|consensus785 97.87
KOG0511|consensus516 97.85
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.85
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.85
PRK05917290 DNA polymerase III subunit delta'; Validated 97.85
KOG0520|consensus975 97.85
KOG3609|consensus 822 97.83
KOG0480|consensus764 97.83
KOG0478|consensus804 97.77
KOG2384|consensus223 97.76
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.74
PRK06835329 DNA replication protein DnaC; Validated 97.72
KOG1969|consensus 877 97.7
PRK06526254 transposase; Provisional 97.69
PRK07952244 DNA replication protein DnaC; Validated 97.64
PF05729166 NACHT: NACHT domain 97.61
PRK07132299 DNA polymerase III subunit delta'; Validated 97.61
KOG0741|consensus744 97.6
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.54
PRK05818261 DNA polymerase III subunit delta'; Validated 97.54
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.53
PRK08181269 transposase; Validated 97.51
PRK08939306 primosomal protein DnaI; Reviewed 97.49
KOG0990|consensus360 97.49
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.48
KOG0735|consensus 952 97.45
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.42
KOG0730|consensus 693 97.4
PRK09183259 transposase/IS protein; Provisional 97.38
KOG2505|consensus591 97.38
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.36
KOG1514|consensus767 97.27
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.19
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.16
PRK06921266 hypothetical protein; Provisional 97.13
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.01
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.01
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.88
PHA01747425 putative ATP-dependent protease 96.86
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.83
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.72
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.71
PRK10536262 hypothetical protein; Provisional 96.7
KOG0477|consensus854 96.66
KOG0479|consensus 818 96.65
KOG0482|consensus721 96.64
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.58
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.41
PRK14974336 cell division protein FtsY; Provisional 96.38
KOG2680|consensus454 96.38
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.33
PRK04296190 thymidine kinase; Provisional 96.31
KOG0736|consensus 953 96.3
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.2
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 96.17
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.16
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.04
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.92
PRK06581263 DNA polymerase III subunit delta'; Validated 95.92
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.86
COG1485367 Predicted ATPase [General function prediction only 95.82
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.78
KOG2505|consensus591 95.73
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.71
KOG0481|consensus729 95.71
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.53
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.53
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.5
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.46
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.45
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.45
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.36
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.32
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.28
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.1
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.87
PRK00771437 signal recognition particle protein Srp54; Provisi 94.86
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.83
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.8
PHA02774613 E1; Provisional 94.8
KOG3347|consensus176 94.77
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 94.69
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 94.58
PF05609465 LAP1C: Lamina-associated polypeptide 1C (LAP1C); I 94.48
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.38
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 94.29
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.26
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 94.16
PRK06696223 uridine kinase; Validated 94.15
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 94.07
KOG2543|consensus438 93.99
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 93.98
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 93.98
PRK10867433 signal recognition particle protein; Provisional 93.95
COG4178604 ABC-type uncharacterized transport system, permeas 93.94
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 93.86
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.85
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.83
KOG2228|consensus408 93.78
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.73
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.73
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.63
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 93.57
PTZ00293211 thymidine kinase; Provisional 93.46
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.42
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 93.37
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.34
PF13337457 Lon_2: Putative ATP-dependent Lon protease 93.31
cd03246173 ABCC_Protease_Secretion This family represents the 93.31
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 93.3
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.26
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 93.18
PRK00131175 aroK shikimate kinase; Reviewed 93.11
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 93.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.05
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 92.93
PRK10875 615 recD exonuclease V subunit alpha; Provisional 92.9
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 92.9
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.9
PRK10416318 signal recognition particle-docking protein FtsY; 92.89
TIGR00959428 ffh signal recognition particle protein. This mode 92.87
PRK08118167 topology modulation protein; Reviewed 92.87
KOG0922|consensus 674 92.83
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 92.81
PRK13695174 putative NTPase; Provisional 92.59
KOG1808|consensus 1856 92.57
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 92.52
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.48
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 92.43
cd03115173 SRP The signal recognition particle (SRP) mediates 92.32
PRK05541176 adenylylsulfate kinase; Provisional 92.25
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.23
PRK06547172 hypothetical protein; Provisional 92.11
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 92.07
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.07
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 92.07
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 92.01
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 91.94
KOG2383|consensus467 91.93
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 91.83
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 91.79
PRK04220301 2-phosphoglycerate kinase; Provisional 91.76
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 91.76
PRK07667193 uridine kinase; Provisional 91.74
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 91.67
PRK06762166 hypothetical protein; Provisional 91.61
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 91.56
TIGR00064272 ftsY signal recognition particle-docking protein F 91.55
cd03215182 ABC_Carb_Monos_II This family represents domain II 91.55
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 91.46
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 91.44
PRK08485206 DNA polymerase III subunit delta'; Validated 91.41
PRK09435332 membrane ATPase/protein kinase; Provisional 91.41
PRK07261171 topology modulation protein; Provisional 91.26
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 91.25
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.25
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 91.19
PRK09270229 nucleoside triphosphate hydrolase domain-containin 91.1
PRK03846198 adenylylsulfate kinase; Provisional 91.04
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 91.01
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 90.95
PRK05439311 pantothenate kinase; Provisional 90.93
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.3e-57  Score=484.03  Aligned_cols=319  Identities=42%  Similarity=0.696  Sum_probs=286.2

Q ss_pred             HHHHHHHHHHhhhhHHhhHHHhhcccccHHHHHHhHhhhhHHHHHHHHHHHHHhhCCCCCCCCCc-eeeeeccCCCChhH
Q psy1308         234 IKQILQKYAEKYADLQREKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSSGIGKTE  312 (607)
Q Consensus       234 ~~~~~~~ll~~~~~~~~~~~~~~~~~~~L~~~l~~~i~Gq~~ai~~l~~~i~~~~~~~~~~~~p~-~~ll~G~~G~GKt~  312 (607)
                      ..+++..+...+....  .+.+......|+..+.+.++||+.|++.++.++++...|+.++++|+ +|+|.||+|||||+
T Consensus       459 Ia~vv~~~TgIPv~~l--~~~e~~kll~le~~L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTE  536 (786)
T COG0542         459 IAEVVARWTGIPVAKL--LEDEKEKLLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTE  536 (786)
T ss_pred             HHHHHHHHHCCChhhh--chhhHHHHHHHHHHHhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHH
Confidence            4445555554444422  23466678889999999999999999999999999999999999999 99999999999999


Q ss_pred             HHHHHHHHhccCcCCceEEeecccccccchhHhhhcCCCCCccCCCCchhhHHHhhCCCeEEEEecCCccCHHHHHHHHH
Q psy1308         313 LAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQ  392 (607)
Q Consensus       313 la~~la~~l~~~~~~~~~~l~~a~~~~~~~~~~llg~~~g~~g~~~~~~l~~~~~~~~~~vl~lDEiek~~~~~~~~Ll~  392 (607)
                      +|++||+.++.+ +..++++|||+|.+.|++++|+|+||||+||++||.+++.+++.|++||+||||||+||+|++.|||
T Consensus       537 LAkaLA~~Lfg~-e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHpdV~nilLQ  615 (786)
T COG0542         537 LAKALAEALFGD-EQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQ  615 (786)
T ss_pred             HHHHHHHHhcCC-CccceeechHHHHHHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcCHHHHHHHHH
Confidence            999999999987 7899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccceeecCCCcEEecCceEEEEecCcchHHHHHHHhhhhhcccccccCCCCcccccCCCcchhcchhhhhhhhhHHHH
Q psy1308         393 LFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILK  472 (607)
Q Consensus       393 ~~~~~~~~~~~g~~~~~~~~~iI~tsn~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  472 (607)
                      +||+|+++|..|+++||+|++||||||+|++.+.+....                       .........++.+.+.++
T Consensus       616 VlDdGrLTD~~Gr~VdFrNtiIImTSN~Gs~~i~~~~~~-----------------------~~~~~~~~~~~~v~~~l~  672 (786)
T COG0542         616 VLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILRDADG-----------------------DDFADKEALKEAVMEELK  672 (786)
T ss_pred             HhcCCeeecCCCCEEecceeEEEEecccchHHHHhhccc-----------------------cccchhhhHHHHHHHHHH
Confidence            999999999999999999999999999999988764211                       000011123455678899


Q ss_pred             hccCChhhhccccceeeeccCCHHHHHHHHHHHHHHHHHHHhhcCCcEEEeCHhHHHHHHc-cCCCCCCccchhHHHHHH
Q psy1308         473 RHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILAD-GYDVHYGARSIKHEVERQ  551 (607)
Q Consensus       473 ~~f~~~el~~ri~~iv~f~pl~~~~~~~i~~~~l~~~~~~~~~~~~i~l~~~~~a~~~L~~-~~~~~~GaR~L~~~i~~~  551 (607)
                      ++|+ |||++|+|++|+|.||+++++.+|+..++.++..++. .+++.+++++++.++|++ +|++.+|||+|++.|++.
T Consensus       673 ~~F~-PEFLNRid~II~F~~L~~~~l~~Iv~~~L~~l~~~L~-~~~i~l~~s~~a~~~l~~~gyd~~~GARpL~R~Iq~~  750 (786)
T COG0542         673 KHFR-PEFLNRIDEIIPFNPLSKEVLERIVDLQLNRLAKRLA-ERGITLELSDEAKDFLAEKGYDPEYGARPLRRAIQQE  750 (786)
T ss_pred             hhCC-HHHHhhcccEEeccCCCHHHHHHHHHHHHHHHHHHHH-hCCceEEECHHHHHHHHHhccCCCcCchHHHHHHHHH
Confidence            9998 9999999999999999999999999999999999998 459999999999999986 999999999999999999


Q ss_pred             HHHHHHHHHHhccCCCCCEEEEEEecCCc
Q psy1308         552 VVSQLAAAHEKSVIGKGSFVRLYVQWSKE  580 (607)
Q Consensus       552 i~~~l~~~~l~~~~~~~~~v~i~~~~~~~  580 (607)
                      |.++|++.++.+.+..|.++.|++.++..
T Consensus       751 i~~~La~~iL~g~~~~~~~v~v~~~~~~~  779 (786)
T COG0542         751 IEDPLADEILFGKIEDGGTVKVDVDDEKI  779 (786)
T ss_pred             HHHHHHHHHHhcccCCCcEEEEEecCceE
Confidence            99999999999999999999999998554



>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>KOG0479|consensus Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG0481|consensus Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF05609 LAP1C: Lamina-associated polypeptide 1C (LAP1C); InterPro: IPR008662 This entry contains Rattus norvegicus LAP1C proteins and several uncharacterised highly related sequences from both Mus sp Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG2383|consensus Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK08485 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 4e-56
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 3e-55
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 7e-53
3pxi_A758 Structure Of Meca108:clpc Length = 758 1e-37
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 5e-37
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-17
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-16
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-15
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-14
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-14
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-14
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-14
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 9e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-13
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-12
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-11
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-11
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-11
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-10
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-09
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 6e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 7e-08
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 5e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 6e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-06
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-06
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-05
1uoh_A226 Human Gankyrin Length = 226 2e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 8e-05
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 8e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 1e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 1e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-04
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-04
1bi7_B156 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 5e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 8e-04
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure

Iteration: 1

Score = 216 bits (549), Expect = 4e-56, Method: Compositional matrix adjust. Identities = 116/291 (39%), Positives = 187/291 (64%), Gaps = 30/291 (10%) Query: 269 RIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSSGIGKTELAKQLAFYIHRDKKE 327 R+VGQ+ AI ++ AI+R G D + P+ FLFLG +G+GKTELAK LA + D +E Sbjct: 559 RVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLF-DTEE 617 Query: 328 AFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVL 387 A IR+DM+EY EKH V++LIGAPPGY+G+++GGQLT+ +++ P +V+LFDE++KAHPDV Sbjct: 618 AMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVF 677 Query: 388 TVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLRKEGEEFSKRTPSIS 447 +LLQ+ D+GRLTD G+T++ ++ + ++TSNL S I L+ ++G + + Sbjct: 678 NILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLI----LEGLQKGWPYER------ 727 Query: 448 KSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELHTLVCRELN 507 +D V + +L++HF R EFL R++EIV F P +K ++ +V +L+ Sbjct: 728 --------------IRDEVFK-VLQQHF-RPEFLNRLDEIVVFRPLTKEQIRQIVEIQLS 771 Query: 508 FWAKKALDKHNINIVWDIDVETILAD-GYDVHYGARSIKHEVERQVVSQLA 557 + + +K I++ + LA+ GYD +GAR ++ ++R++ + LA Sbjct: 772 YLRARLAEKR-ISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLA 821
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 3e-89
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 3e-86
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 8e-83
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 3e-70
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-18
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-09
2rfa_A232 Transient receptor potential cation channel subfa 1e-16
2rfa_A232 Transient receptor potential cation channel subfa 9e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-05
2pnn_A273 Transient receptor potential cation channel subfa 7e-16
2pnn_A273 Transient receptor potential cation channel subfa 1e-12
2pnn_A273 Transient receptor potential cation channel subfa 9e-09
2pnn_A273 Transient receptor potential cation channel subfa 2e-06
2pnn_A273 Transient receptor potential cation channel subfa 1e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-05
2etb_A256 Transient receptor potential cation channel subfam 5e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-12
2etb_A256 Transient receptor potential cation channel subfam 1e-11
2etb_A256 Transient receptor potential cation channel subfam 6e-08
2etb_A256 Transient receptor potential cation channel subfam 8e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-04
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 9e-06
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 2e-05
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 1e-04
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 5e-04
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
 Score =  277 bits (712), Expect = 3e-89
 Identities = 124/324 (38%), Positives = 200/324 (61%), Gaps = 31/324 (9%)

Query: 256 ERRKY-PLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSSGIGKTEL 313
           ER K   LE+ L  R+VGQ+ AI  ++ AI+R   G  D + P+  FLFLG +G+GKTEL
Sbjct: 4   EREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTEL 63

Query: 314 AKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAV 373
           AK LA  +  D +EA IR+DM+EY EKH V++LIGAPPGY+G+++GGQLT+ +++ P +V
Sbjct: 64  AKTLAATLF-DTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSV 122

Query: 374 VLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIAQHALQLR 433
           +LFD ++KAHPDV  +LLQ+ D+GRLTD  G+T++ ++ + +MTSNL S  I    L+  
Sbjct: 123 ILFDAIEKAHPDVFNILLQMLDDGRLTDSHGRTVDFRNTVIIMTSNLGSPLI----LEGL 178

Query: 434 KEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPF 493
           ++G  + +                     +D V + +L++HF R EFL R++EIV F P 
Sbjct: 179 QKGWPYERI--------------------RDEVFK-VLQQHF-RPEFLNRLDEIVVFRPL 216

Query: 494 SKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILAD-GYDVHYGARSIKHEVERQV 552
           +K ++  +V  ++++   + L +  I++      +  LA+ GYD  +GAR ++  ++R++
Sbjct: 217 TKEQIRQIVEIQMSYLRAR-LAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQREL 275

Query: 553 VSQLAAAHEKSVIGKGSFVRLYVQ 576
            + LA       + +G  V++ V 
Sbjct: 276 ETPLAQKILAGEVKEGDRVQVDVG 299


>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.98
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.98
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.89
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.7
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.63
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.59
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.53
3pvs_A 447 Replication-associated recombination protein A; ma 99.53
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.52
3co5_A143 Putative two-component system transcriptional RES 99.46
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.44
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.43
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.41
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.39
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.39
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.39
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.39
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.37
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.36
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.35
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.32
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.32
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.31
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.3
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.3
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.3
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.3
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.29
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.28
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.25
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.24
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.22
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.22
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.21
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.21
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.2
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.2
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.2
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.19
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.18
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.18
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.17
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.17
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.16
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.15
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.14
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.11
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.1
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.1
3bos_A242 Putative DNA replication factor; P-loop containing 99.07
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.04
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.0
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.98
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.95
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.94
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.93
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.92
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.92
3f8t_A506 Predicted ATPase involved in replication control, 98.91
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 98.9
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.89
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.89
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.86
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.84
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.82
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.79
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.77
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.73
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.73
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.73
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.72
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.57
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.5
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.5
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.39
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.21
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.17
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.13
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.08
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.0
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.97
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.89
2qgz_A308 Helicase loader, putative primosome component; str 97.79
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.78
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.67
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.52
2fna_A357 Conserved hypothetical protein; structural genomic 97.38
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.16
1tue_A212 Replication protein E1; helicase, replication, E1E 97.02
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.0
1qzm_A94 ATP-dependent protease LA; oligomerization domain, 96.97
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.59
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.22
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.07
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.92
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.91
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.76
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.1
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.96
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.86
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.55
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.49
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.41
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.34
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.22
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.17
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 93.94
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.77
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.63
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.55
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.39
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.26
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.13
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 92.44
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 92.44
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.93
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.84
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.76
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.55
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.17
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.12
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.02
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 90.97
3vaa_A199 Shikimate kinase, SK; structural genomics, center 90.87
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 90.86
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 90.8
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 90.64
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 90.62
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.59
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.37
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 90.29
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 90.2
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 90.18
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.15
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 90.07
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 89.9
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 89.8
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.79
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.75
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 89.72
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 89.68
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.67
3tlx_A243 Adenylate kinase 2; structural genomics, structura 89.66
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.66
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 89.62
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.6
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 89.56
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 89.52
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 89.44
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 89.44
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 89.37
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 89.23
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.21
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 89.19
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.13
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 89.12
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 89.07
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 89.05
1via_A175 Shikimate kinase; structural genomics, transferase 88.97
3r20_A233 Cytidylate kinase; structural genomics, seattle st 88.94
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 88.93
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.93
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 88.9
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 88.7
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.65
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 88.64
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 88.64
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.58
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.53
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 88.51
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 88.3
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 88.29
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.26
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.25
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 88.16
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 87.98
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 87.96
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 87.91
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 87.84
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 87.8
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 87.66
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 87.65
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 87.48
3h1t_A590 Type I site-specific restriction-modification syst 87.46
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 87.35
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 87.29
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 87.17
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 87.16
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.1
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 86.98
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 86.92
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 86.81
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 86.65
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 86.46
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 86.44
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 86.26
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 86.18
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 86.13
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 86.07
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 85.99
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 85.87
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 85.62
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 85.6
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 85.59
2og2_A359 Putative signal recognition particle receptor; nuc 85.51
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 85.32
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 84.85
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 84.71
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 84.7
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 84.46
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 84.33
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 84.05
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 83.93
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 83.9
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 83.84
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 83.8
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 83.76
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 83.75
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 83.71
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 83.6
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 83.6
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.53
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 83.45
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 83.33
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 83.14
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 82.83
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 82.81
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 82.75
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 82.67
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 82.62
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 82.54
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 82.37
1u94_A356 RECA protein, recombinase A; homologous recombinat 82.34
1vma_A306 Cell division protein FTSY; TM0570, structural gen 82.15
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 82.13
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 82.03
1xp8_A366 RECA protein, recombinase A; recombination, radior 81.86
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 81.83
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 81.82
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 81.78
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 81.61
1xjc_A169 MOBB protein homolog; structural genomics, midwest 81.32
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 81.28
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 81.03
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 80.99
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 80.73
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 80.36
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 80.36
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
Probab=100.00  E-value=3.7e-36  Score=343.76  Aligned_cols=295  Identities=41%  Similarity=0.712  Sum_probs=247.9

Q ss_pred             cHHHHHHhHhhhhHHHHHHHHHHHHHhhCCCCCCCCCc-eeeeeccCCCChhHHHHHHHHHhccCcCCceEEeecccccc
Q psy1308         261 PLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQE  339 (607)
Q Consensus       261 ~L~~~l~~~i~Gq~~ai~~l~~~i~~~~~~~~~~~~p~-~~ll~G~~G~GKt~la~~la~~l~~~~~~~~~~l~~a~~~~  339 (607)
                      .+...+...++||+.+++.+...+.+...+..++++|. +++|+||+|+|||.+|+.+++.++.. ..+|+.++|+.+..
T Consensus       551 ~l~~~l~~~viG~~~a~~~l~~~i~~~~~g~~~~~~p~~~vLl~Gp~GtGKT~lA~~la~~~~~~-~~~~i~i~~~~~~~  629 (854)
T 1qvr_A          551 RLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDT-EEAMIRIDMTEYME  629 (854)
T ss_dssp             SHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSEEEEEBSCSSSSHHHHHHHHHHHHHSS-GGGEEEECTTTCCS
T ss_pred             HHHHHHhcccCCcHHHHHHHHHHHHHHhcccCCCCCCceEEEEECCCCCCHHHHHHHHHHHhcCC-CCcEEEEechhccc
Confidence            45556677899999999999999999988888888898 99999999999999999999999775 67899999999999


Q ss_pred             cchhHhhhcCCCCCccCCCCchhhHHHhhCCCeEEEEecCCccCHHHHHHHHHhhccceeecCCCcEEecCceEEEEecC
Q psy1308         340 KHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSN  419 (607)
Q Consensus       340 ~~~~~~llg~~~g~~g~~~~~~l~~~~~~~~~~vl~lDEiek~~~~~~~~Ll~~~~~~~~~~~~g~~~~~~~~~iI~tsn  419 (607)
                      .+.+.+++|.++||+|++.++.+++.++..+++|||||||+++++++++.|++++++|.+++..|++++|++++||+|||
T Consensus       630 ~~~~s~l~g~~~~~~G~~~~g~l~~~~~~~~~~vl~lDEi~~l~~~~~~~Ll~~l~~~~~~~~~g~~vd~~~~iiI~tsn  709 (854)
T 1qvr_A          630 KHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSN  709 (854)
T ss_dssp             SGGGGGC--------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEECCSSSCCEECTTEEEEEECC
T ss_pred             hhHHHHHcCCCCCCcCccccchHHHHHHhCCCeEEEEecccccCHHHHHHHHHHhccCceECCCCCEeccCCeEEEEecC
Confidence            99999999999999999988899999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchHHHHHHHhhhhhcccccccCCCCcccccCCCcchhcchhhhhhhhhHHHHhccCChhhhccccceeeeccCCHHHHH
Q psy1308         420 LASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSKSELH  499 (607)
Q Consensus       420 ~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~f~~~el~~ri~~iv~f~pl~~~~~~  499 (607)
                      .+...+.+.. +.   +                    ..+ ....+.+.+.+.+.|+ |+|++||+.+++|.|++.+++.
T Consensus       710 ~~~~~~~~~~-~~---~--------------------~~~-~~l~~~v~~~~~~~f~-~~l~~Rl~~~i~~~pl~~edi~  763 (854)
T 1qvr_A          710 LGSPLILEGL-QK---G--------------------WPY-ERIRDEVFKVLQQHFR-PEFLNRLDEIVVFRPLTKEQIR  763 (854)
T ss_dssp             TTHHHHHHHH-HT---T--------------------CCH-HHHHHHHHHHHHTTSC-HHHHHTCSBCCBCCCCCHHHHH
T ss_pred             cChHHHhhhc-cc---c--------------------cch-HHHHHHHHHHHHhhCC-HHHHHhcCeEEeCCCCCHHHHH
Confidence            9988775521 00   0                    000 1123344455788898 9999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhcCCcEEEeCHhHHHHHHc-cCCCCCCccchhHHHHHHHHHHHHHHHHhccCCCCCEEEEEEecC
Q psy1308         500 TLVCRELNFWAKKALDKHNINIVWDIDVETILAD-GYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLYVQWS  578 (607)
Q Consensus       500 ~i~~~~l~~~~~~~~~~~~i~l~~~~~a~~~L~~-~~~~~~GaR~L~~~i~~~i~~~l~~~~l~~~~~~~~~v~i~~~~~  578 (607)
                      .|+..++..+..++... ++.+.++++++++|++ +|+|++|+|+|++.|++.+..++++.++.++++.|++|+|+++++
T Consensus       764 ~i~~~~l~~~~~~~~~~-~~~~~~~~~a~~~L~~~~~~~~gn~R~L~~~i~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~  842 (854)
T 1qvr_A          764 QIVEIQLSYLRARLAEK-RISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPA  842 (854)
T ss_dssp             HHHHHHHHHHHHHHHTT-TCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEECCTT
T ss_pred             HHHHHHHHHHHHHHHhC-CceEEECHHHHHHHHHcCCCCCCChHHHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEEEECC
Confidence            99999999999888654 7889999999999986 788899999999999999999999999999999999999999766


Q ss_pred             Ccccc
Q psy1308         579 KEVSE  583 (607)
Q Consensus       579 ~~~~~  583 (607)
                      +..+.
T Consensus       843 ~~~~~  847 (854)
T 1qvr_A          843 GLVFA  847 (854)
T ss_dssp             SCEEE
T ss_pred             EEEEE
Confidence            65443



>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 607
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 8e-68
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 5e-53
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 6e-32
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-20
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-19
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.004
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-05
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 7e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-04
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 8e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 9e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-04
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-04
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-04
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 1e-04
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-04
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 5e-04
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 0.001
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 0.004
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]
 Score =  221 bits (563), Expect = 8e-68
 Identities = 114/329 (34%), Positives = 188/329 (57%), Gaps = 28/329 (8%)

Query: 248 LQREKEAEERRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSS 306
           + +  E E  +   LE+ L  R+VGQ+ AI  ++ AI+R   G  D + P+  FLFLG +
Sbjct: 3   VSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPT 62

Query: 307 GIGKTELAKQLAFYIHRDKKEAFIRLDMSEYQEKHEVAKLIGAPPGYLGHDDGGQLTKRL 366
           G+GKTELAK LA  +  D +EA IR+DM+EY EKH V++LIGAPPGY+G+++GGQLT+ +
Sbjct: 63  GVGKTELAKTLAATLF-DTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAV 121

Query: 367 KKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFVMTSNLASNEIA 426
           ++ P +V+LFDE++KAHPDV  +LLQ+ D+GRLTD  G+T++ ++ + ++TSNL S  I 
Sbjct: 122 RRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLIL 181

Query: 427 QHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINE 486
           +   +         +    +                          +   R EFL R++E
Sbjct: 182 EGLQKGWPYERIRDEVFKVL--------------------------QQHFRPEFLNRLDE 215

Query: 487 IVYFLPFSKSELHTLVCRELNFWAKKALDKHNINIVWDIDVETILADGYDVHYGARSIKH 546
           IV F P +K ++  +V  +L++   +  +K     + +   + +   GYD  +GAR ++ 
Sbjct: 216 IVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRR 275

Query: 547 EVERQVVSQLAAAHEKSVIGKGSFVRLYV 575
            ++R++ + LA       + +G  V++ V
Sbjct: 276 VIQRELETPLAQKILAGEVKEGDRVQVDV 304


>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.92
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.89
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.82
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.81
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.47
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.4
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.38
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.37
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.36
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.35
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.33
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.28
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.19
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.18
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.14
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.06
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.03
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.03
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.99
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.96
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.93
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.89
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.83
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.8
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.57
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.49
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.43
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.38
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.9
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.38
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 96.95
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.37
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.37
d1okkd2207 GTPase domain of the signal recognition particle r 95.96
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.92
d1vmaa2213 GTPase domain of the signal recognition particle r 95.87
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.78
d2qy9a2211 GTPase domain of the signal recognition particle r 95.78
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.52
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.21
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.12
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.0
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.96
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.94
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.94
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.74
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.47
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.43
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.26
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.07
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.03
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.01
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.99
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.99
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.82
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.73
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.67
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.64
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.43
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.36
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.34
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.18
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.01
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.89
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.5
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.1
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.09
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.92
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.89
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.71
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.47
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 91.32
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.26
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.21
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.08
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.05
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 90.37
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.23
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.14
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 89.61
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 89.36
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.31
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.94
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.89
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 88.78
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 88.75
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 88.73
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.35
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.16
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 87.96
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 87.17
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 86.48
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 86.06
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 85.26
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 84.59
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 84.07
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 83.77
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 82.78
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 82.73
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.69
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 82.46
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 80.19
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=1.1e-49  Score=397.67  Aligned_cols=301  Identities=40%  Similarity=0.689  Sum_probs=261.3

Q ss_pred             cccccHHHHHHhHhhhhHHHHHHHHHHHHHhhCCCCCCCCCc-eeeeeccCCCChhHHHHHHHHHhccCcCCceEEeecc
Q psy1308         257 RRKYPLEQRLKDRIVGQESAINIISAAIKRKENGWTDDDHPL-VFLFLGSSGIGKTELAKQLAFYIHRDKKEAFIRLDMS  335 (607)
Q Consensus       257 ~~~~~L~~~l~~~i~Gq~~ai~~l~~~i~~~~~~~~~~~~p~-~~ll~G~~G~GKt~la~~la~~l~~~~~~~~~~l~~a  335 (607)
                      .....|++.|.+.++||+.+++.+..++.+...++.++++|. +++|+||+|+|||++|+.||+.++.. ..+++++||+
T Consensus        12 ~~l~~l~~~L~~~v~GQ~~ai~~v~~~i~~~~~~l~~~~kp~~~~lf~Gp~G~GKt~lak~la~~l~~~-~~~~~~~~~~   90 (315)
T d1qvra3          12 EKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDT-EEAMIRIDMT   90 (315)
T ss_dssp             HHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSEEEEEBSCSSSSHHHHHHHHHHHHHSS-GGGEEEECTT
T ss_pred             HHHHHHHHHhcCeEeCHHHHHHHHHHHHHHHhcCCCCCCCCceEEEEECCCcchHHHHHHHHHHHhcCC-CcceEEEecc
Confidence            445678999999999999999999999999999999999998 89999999999999999999999876 7789999999


Q ss_pred             cccccchhHhhhcCCCCCccCCCCchhhHHHhhCCCeEEEEecCCccCHHHHHHHHHhhccceeecCCCcEEecCceEEE
Q psy1308         336 EYQEKHEVAKLIGAPPGYLGHDDGGQLTKRLKKCPNAVVLFDEVDKAHPDVLTVLLQLFDEGRLTDGKGKTIECKDAIFV  415 (607)
Q Consensus       336 ~~~~~~~~~~llg~~~g~~g~~~~~~l~~~~~~~~~~vl~lDEiek~~~~~~~~Ll~~~~~~~~~~~~g~~~~~~~~~iI  415 (607)
                      .|.+.+.+.+|+|+++||+|+++++.+++.++++|++||+||||||+|+++++.|++++++|++++..|++++|++++||
T Consensus        91 ~~~~~~~~~~L~g~~~gyvG~~~~~~l~~~~~~~p~~Vvl~DEieK~~~~v~~~ll~~l~~g~~~~~~gr~v~~~~~i~i  170 (315)
T d1qvra3          91 EYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVII  170 (315)
T ss_dssp             TCCSSGGGGGC--------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEECCSSSCCEECTTEEEE
T ss_pred             ccccchhhhhhcCCCCCCcCcccCChHHHHHHhCCCcEEEEehHhhcCHHHHHHHHHHhccCceeCCCCcEecCcceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCcchHHHHHHHhhhhhcccccccCCCCcccccCCCcchhcchhhhhhhhhHHHHhccCChhhhccccceeeeccCCH
Q psy1308         416 MTSNLASNEIAQHALQLRKEGEEFSKRTPSISKSQGSNLDVTISRHFKDHVVQPILKRHFRRDEFLGRINEIVYFLPFSK  495 (607)
Q Consensus       416 ~tsn~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~f~~~el~~ri~~iv~f~pl~~  495 (607)
                      +|||+|.+.+.+......                         ............++++|+ |||++|||.+++|.||+.
T Consensus       171 ~tsnlG~~~i~~~~~~~~-------------------------~~~~~~~~~~~~l~~~f~-pEflnRid~Ii~F~~L~~  224 (315)
T d1qvra3         171 LTSNLGSPLILEGLQKGW-------------------------PYERIRDEVFKVLQQHFR-PEFLNRLDEIVVFRPLTK  224 (315)
T ss_dssp             EECCTTHHHHHHHHHTTC-------------------------CHHHHHHHHHHHHHTTSC-HHHHHTCSBCCBCCCCCH
T ss_pred             EecccChHHHhhhccccc-------------------------chhhhhHHHHHHHHhhcC-HHHHhcCCeeeeccchhh
Confidence            999999998866432211                         011123334566788998 999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhhcCCcEEEeCHhHHHHHHc-cCCCCCCccchhHHHHHHHHHHHHHHHHhccCCCCCEEEEE
Q psy1308         496 SELHTLVCRELNFWAKKALDKHNINIVWDIDVETILAD-GYDVHYGARSIKHEVERQVVSQLAAAHEKSVIGKGSFVRLY  574 (607)
Q Consensus       496 ~~~~~i~~~~l~~~~~~~~~~~~i~l~~~~~a~~~L~~-~~~~~~GaR~L~~~i~~~i~~~l~~~~l~~~~~~~~~v~i~  574 (607)
                      +++.+|+..++.++.+++..+ ++.+.++++++++|++ +|++.+|||+|++.|++.|.++|++.++++++++|++|+|+
T Consensus       225 ~~~~~I~~~~l~~l~~rl~~~-~i~l~i~~~~~~~L~~~~y~~~~GAR~L~r~Ie~~i~~~La~~iL~~~~~~g~~i~i~  303 (315)
T d1qvra3         225 EQIRQIVEIQLSYLRARLAEK-RISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVD  303 (315)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTT-TCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEE
T ss_pred             hhhHHHHHHHHHHHHHHHHhc-cccccccHHHHHHHHHhCCCCCCCcchHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEE
Confidence            999999999999999998775 8999999999999987 89999999999999999999999999999999999999999


Q ss_pred             EecCCcccccC
Q psy1308         575 VQWSKEVSEDS  585 (607)
Q Consensus       575 ~~~~~~~~~~~  585 (607)
                      +.+++..++.+
T Consensus       304 ~~~~~lvf~~~  314 (315)
T d1qvra3         304 VGPAGLVFAVP  314 (315)
T ss_dssp             CCTTSCEEESC
T ss_pred             EECCEEEEEee
Confidence            99999877654



>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure