Psyllid ID: psy13773


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDEDDPVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQSQSGGPNSAPANESGTGGILLMFPSNPNQSQSGGPNSAPANESGTGGILQDEAEDDLYN
cEEEcccccHHHHHHcccccccccEEEccccccHHHHHHHHHHHcccEEEEEEcccHHHHHHcHHHHHHHHHHHHcccccccEEccccccccccccEEEcccccHHHHHcHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccEEcccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHcHcHHHHHHHHHHHHHccEEEEEEccccccccHHHHccccccHHHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcccHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccccccccEEEEEcccccccEEEcccccEEEcccccEEEEEccccccccc
mistypvehpekflkfgmqpsrgvlfygppgcgkTLLAKAIANECQanfisvkgpelltmwfgeseanVRDIFDKVTMENFRyamgksspsalRETIvevpnitwediggleGVKRELQELVQDVDLNYIAKvtngfsgaDLTEICQRACKLAIRQSIETEIRREREklagnpaasaametededdpvpeiTRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQsrgfgtnfrfpsnpnqsqsggpnsapanesgtggillmfpsnpnqsqsggpnsapanesgtggilqdeaeddlyn
mistypvehpekFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYamgksspsalrETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRrereklagnpaasaametededdpvPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQSQSGGPNSAPANESGTGGILLMFPSNPNQSQSGGPNSAPANESgtggilqdeaeddlyn
MISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDEDDPVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQSQSGGPNSAPANESGTGGILLMFPSNPNQSQSGGPNSAPANESGTGGILQDEAEDDLYN
************FLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMGKS**SALRETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSI****************************************************DIRKYEMFAQ*******************************************************************************
MISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMG***********VEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRRE*************METEDEDDPVPEITRAHFEEAMRFARRSVNDADIRKYE****************************************GGILLMF****************************E****LY*
MISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREK******************PVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSN****************SGTGGILLMFPSNP******************GGILQDEAEDDLYN
*ISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAG********ETEDEDDPVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQSQSGGPNS****ESGTGGILLMFPSNPNQSQSGGPNSAPANESGTGGILQDEAE****N
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDEDDPVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQSQSGGPNSAPANESGTGGILLMFPSNPNQSQSGGPNSAPANESGTGGILQDEAEDDLYN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query299 2.2.26 [Sep-21-2011]
P54812810 Transitional endoplasmic yes N/A 0.772 0.285 0.474 1e-59
Q7KN62801 Transitional endoplasmic yes N/A 0.444 0.166 0.702 4e-47
P23787805 Transitional endoplasmic N/A N/A 0.367 0.136 0.758 8e-43
P54811809 Transitional endoplasmic no N/A 0.424 0.156 0.679 4e-41
Q6GL04805 Transitional endoplasmic yes N/A 0.217 0.080 0.929 3e-36
Q7ZU99806 Transitional endoplasmic no N/A 0.110 0.040 0.929 3e-36
P03974806 Transitional endoplasmic yes N/A 0.227 0.084 0.891 3e-36
Q3ZBT1806 Transitional endoplasmic yes N/A 0.227 0.084 0.891 3e-36
Q01853806 Transitional endoplasmic yes N/A 0.227 0.084 0.891 3e-36
P55072806 Transitional endoplasmic yes N/A 0.227 0.084 0.891 3e-36
>sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 Back     alignment and function desciption
 Score =  229 bits (585), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 172/291 (59%), Gaps = 60/291 (20%)

Query: 2   ISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIAN------------------ 43
           +  YPVEHPEK+LKFGMQPSRGVLFYGPPGCGKTLLAKAIAN                  
Sbjct: 497 LVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMW 556

Query: 44  --ECQAN----FISVKGPELLTMWFGESEA---------------------NVRDIFDKV 76
             E +AN    F   +      ++F E ++                      V    D +
Sbjct: 557 FGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGM 616

Query: 77  TMENFRYAMGKSS------PSALR----ETIVEVPNITWEDIGGLEGVKRELQE--LVQD 124
             +   + +G ++      P+ LR    + ++ +P    ++   L+  K  L++  L  D
Sbjct: 617 NAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIP--LPDEASRLQIFKASLRKTPLSAD 674

Query: 125 VDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDE 184
           +DLN++AK T GFSGADLTEICQRACKLAIR+SIE EIR+E+E+   +      ME E  
Sbjct: 675 LDLNFLAKNTVGFSGADLTEICQRACKLAIRESIEREIRQEKERQDRSARGEELMEDELA 734

Query: 185 DDPVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFP 235
           D PVPEITRAHFEEAM+FARRSV D DIRKYEMFAQTLQQSRGFG NF+FP
Sbjct: 735 D-PVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTLQQSRGFGNNFKFP 784





Caenorhabditis elegans (taxid: 6239)
>sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 Back     alignment and function description
>sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 Back     alignment and function description
>sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 Back     alignment and function description
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function description
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 Back     alignment and function description
>sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 Back     alignment and function description
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
47226685 797 unnamed protein product [Tetraodon nigro 0.769 0.288 0.567 3e-76
302686514 814 hypothetical protein SCHCODRAFT_85085 [S 0.769 0.282 0.547 3e-74
384250485 818 AAA ATPase [Coccomyxa subellipsoidea C-1 0.775 0.283 0.554 4e-74
443694341 812 hypothetical protein CAPTEDRAFT_161400, 0.869 0.320 0.484 2e-72
218184617 755 hypothetical protein OsI_33786 [Oryza sa 0.725 0.287 0.620 6e-71
159476808 817 flagellar associated protein [Chlamydomo 0.752 0.275 0.529 2e-69
242036965 712 hypothetical protein SORBIDRAFT_01g04744 0.775 0.325 0.505 2e-68
242042265 780 hypothetical protein SORBIDRAFT_01g04741 0.775 0.297 0.501 3e-67
268532274 807 Hypothetical protein CBG03070 [Caenorhab 0.762 0.282 0.508 2e-66
308509910 809 CRE-CDC-48.1 protein [Caenorhabditis rem 0.762 0.281 0.505 2e-66
>gi|47226685|emb|CAG07844.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 160/282 (56%), Positives = 197/282 (69%), Gaps = 52/282 (18%)

Query: 5   YPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGE 64
           YPVEHP+KFLKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWFGE
Sbjct: 489 YPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGE 548

Query: 65  SEANVRDIFDKVTM--------------------------ENFRYAMGKSS------PSA 92
           SEANVR+IFDK  M                          +   + +G ++      P+ 
Sbjct: 549 SEANVREIFDKARMLESEELAQWWQVFAQQILTEMDGMSSKKNVFIIGATNRPDIIDPAI 608

Query: 93  LR----ETIVEVPNITWEDIGGLEGVKRELQE--LVQDVDLNYIAKVTNGFSGADLTEIC 146
           LR    + ++ +P    ++   +  +K  L++  + QDVDL+++AK+TNGFSGADLTEIC
Sbjct: 609 LRPGRLDQLIYIP--LPDEKSRISILKANLRKSPISQDVDLDFLAKMTNGFSGADLTEIC 666

Query: 147 QRACKLAIRQSIETEIRRE-REKLAGNPAASAAM-------ETE---DEDDPVPEITRAH 195
           QRACKLAIR+SIE+EIRR  R +    P + A +       +T+   +EDDPVPEI + H
Sbjct: 667 QRACKLAIRESIESEIRRRGRGRPTLRPWSVALLSLLPLPEQTDREVEEDDPVPEIRKDH 726

Query: 196 FEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSN 237
           FEEAMRFARRSV+D DIRKYEMFAQTLQQSRGFG+ FRFPS+
Sbjct: 727 FEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGS-FRFPSS 767




Source: Tetraodon nigroviridis

Species: Tetraodon nigroviridis

Genus: Tetraodon

Family: Tetraodontidae

Order: Tetraodontiformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|302686514|ref|XP_003032937.1| hypothetical protein SCHCODRAFT_85085 [Schizophyllum commune H4-8] gi|300106631|gb|EFI98034.1| hypothetical protein SCHCODRAFT_85085 [Schizophyllum commune H4-8] Back     alignment and taxonomy information
>gi|384250485|gb|EIE23964.1| AAA ATPase [Coccomyxa subellipsoidea C-169] Back     alignment and taxonomy information
>gi|443694341|gb|ELT95504.1| hypothetical protein CAPTEDRAFT_161400, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|218184617|gb|EEC67044.1| hypothetical protein OsI_33786 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|159476808|ref|XP_001696503.1| flagellar associated protein [Chlamydomonas reinhardtii] gi|158282728|gb|EDP08480.1| flagellar associated protein [Chlamydomonas reinhardtii] Back     alignment and taxonomy information
>gi|242036965|ref|XP_002465877.1| hypothetical protein SORBIDRAFT_01g047440 [Sorghum bicolor] gi|241919731|gb|EER92875.1| hypothetical protein SORBIDRAFT_01g047440 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|242042265|ref|XP_002468527.1| hypothetical protein SORBIDRAFT_01g047410 [Sorghum bicolor] gi|241922381|gb|EER95525.1| hypothetical protein SORBIDRAFT_01g047410 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|268532274|ref|XP_002631265.1| Hypothetical protein CBG03070 [Caenorhabditis briggsae] Back     alignment and taxonomy information
>gi|308509910|ref|XP_003117138.1| CRE-CDC-48.1 protein [Caenorhabditis remanei] gi|308242052|gb|EFO86004.1| CRE-CDC-48.1 protein [Caenorhabditis remanei] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
FB|FBgn0261014801 TER94 "TER94" [Drosophila mela 0.444 0.166 0.710 1.6e-83
UNIPROTKB|G3X757806 VCP "Transitional endoplasmic 0.428 0.158 0.717 2.7e-80
UNIPROTKB|Q3ZBT1806 VCP "Transitional endoplasmic 0.428 0.158 0.717 2.7e-80
UNIPROTKB|P55072806 VCP "Transitional endoplasmic 0.428 0.158 0.717 2.7e-80
MGI|MGI:99919806 Vcp "valosin containing protei 0.428 0.158 0.717 2.7e-80
RGD|621595806 Vcp "valosin-containing protei 0.428 0.158 0.717 2.7e-80
UNIPROTKB|E2RLQ9822 VCP "Uncharacterized protein" 0.428 0.155 0.717 3.4e-80
UNIPROTKB|H9KYT1538 LOC430766 "Uncharacterized pro 0.428 0.237 0.710 3.6e-80
UNIPROTKB|F1SIH8808 VCP "Transitional endoplasmic 0.418 0.154 0.733 4.7e-80
UNIPROTKB|P03974806 VCP "Transitional endoplasmic 0.428 0.158 0.717 5.5e-80
FB|FBgn0261014 TER94 "TER94" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 473 (171.6 bits), Expect = 1.6e-83, Sum P(3) = 1.6e-83
 Identities = 98/138 (71%), Positives = 110/138 (79%)

Query:   121 LVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAME 180
             L ++VDL YIAKVT GFSGADLTEICQRACKLAIRQ+IE EIRRE+E+ A N   ++AM+
Sbjct:   663 LAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKER-AENQ--NSAMD 719

Query:   181 TEDEDDPVPEITRAHFEEAMRFARRSVNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQ 240
               DEDDPVPEIT AHFEEAM+FARRSV+D DIRKYEMFAQTLQQSRGFG NFRFP     
Sbjct:   720 M-DEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFPGQTGN 778

Query:   241 SQSGGPNSAPANESGTGG 258
             + SG  N+ P N  G  G
Sbjct:   779 T-SGSGNNLPVNSPGDNG 795


GO:0045169 "fusome" evidence=IDA;NAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0016887 "ATPase activity" evidence=NAS
GO:0005783 "endoplasmic reticulum" evidence=NAS
GO:0007030 "Golgi organization" evidence=IMP
GO:0007317 "regulation of pole plasm oskar mRNA localization" evidence=IMP
GO:0016320 "endoplasmic reticulum membrane fusion" evidence=ISS
GO:0000226 "microtubule cytoskeleton organization" evidence=IMP
GO:0007029 "endoplasmic reticulum organization" evidence=IMP
GO:0045451 "pole plasm oskar mRNA localization" evidence=IMP
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IMP
GO:0008104 "protein localization" evidence=IMP
GO:0042052 "rhabdomere development" evidence=IMP
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0032436 "positive regulation of proteasomal ubiquitin-dependent protein catabolic process" evidence=IMP
GO:0000502 "proteasome complex" evidence=NAS
GO:0006508 "proteolysis" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0030433 "ER-associated protein catabolic process" evidence=IMP
GO:0006200 "ATP catabolic process" evidence=IGI
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0043523 "regulation of neuron apoptotic process" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IMP
UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99919 Vcp "valosin containing protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621595 Vcp "valosin-containing protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLQ9 VCP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H9KYT1 LOC430766 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIH8 VCP "Transitional endoplasmic reticulum ATPase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P03974 VCP "Transitional endoplasmic reticulum ATPase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7KN62TERA_DROMENo assigned EC number0.70280.44480.1660yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 6e-40
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-28
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-26
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 4e-23
pfam00004131 pfam00004, AAA, ATPase family associated with vari 5e-23
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 4e-22
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 8e-21
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 4e-20
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 8e-20
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 6e-18
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 1e-16
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-15
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 2e-15
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 5e-15
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 6e-13
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 8e-13
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 9e-13
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-11
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 7e-11
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-07
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 2e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-07
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 5e-07
PRK13342413 PRK13342, PRK13342, recombination factor protein R 6e-07
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 7e-07
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 4e-06
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 4e-06
pfam0933662 pfam09336, Vps4_C, Vps4 C terminal oligomerisation 8e-06
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 2e-05
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 2e-05
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 3e-05
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 3e-05
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 3e-05
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 6e-05
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 7e-05
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 1e-04
pfam13207114 pfam13207, AAA_17, AAA domain 2e-04
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 3e-04
COG0467260 COG0467, RAD55, RecA-superfamily ATPases implicate 3e-04
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 3e-04
pfam00910105 pfam00910, RNA_helicase, RNA helicase 4e-04
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 6e-04
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 6e-04
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 0.001
pfam13238128 pfam13238, AAA_18, AAA domain 0.001
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 0.001
pfam01057271 pfam01057, Parvo_NS1, Parvovirus non-structural pr 0.001
PRK12402337 PRK12402, PRK12402, replication factor C small sub 0.002
PRK06835329 PRK06835, PRK06835, DNA replication protein DnaC; 0.003
COG0593408 COG0593, DnaA, ATPase involved in DNA replication 0.003
pfam13401124 pfam13401, AAA_22, AAA domain 0.004
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 0.004
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  145 bits (367), Expect = 6e-40
 Identities = 74/272 (27%), Positives = 112/272 (41%), Gaps = 93/272 (34%)

Query: 5   YPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGE 64
            P++ PE F K G++P +GVL YGPPG GKTLLAKA+A E ++ FISVKG ELL+ W GE
Sbjct: 260 TPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGE 319

Query: 65  SEANVRDIFDKVTME------------------------------NFRYAMGKSSPS--- 91
           SE N+R++F+K                                       +     +   
Sbjct: 320 SEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSEDGSGRRVVGQLLTELDGIEKAEGV 379

Query: 92  -ALRET------------------IVEVPNITWEDIGGLEGVKRELQE----LVQDVDLN 128
             +  T                  ++ VP    E    LE  K  L++    L +DVDL 
Sbjct: 380 LVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLE--ERLEIFKIHLRDKKPPLAEDVDLE 437

Query: 129 YIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDEDDPV 188
            +A++T G+SGAD+  + + A   A+R++                               
Sbjct: 438 ELAEITEGYSGADIAALVREAALEALREARRR---------------------------- 469

Query: 189 PEITRAHFEEAMRFARRSVNDADIRKYEMFAQ 220
            E+T   F +A++  + SV       YE + +
Sbjct: 470 -EVTLDDFLDALKKIKPSVT------YEEWKE 494


Length = 494

>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|204202 pfam09336, Vps4_C, Vps4 C terminal oligomerisation domain Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|223543 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|222000 pfam13238, AAA_18, AAA domain Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1 Back     alignment and domain information
>gnl|CDD|237090 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed Back     alignment and domain information
>gnl|CDD|235871 PRK06835, PRK06835, DNA replication protein DnaC; Validated Back     alignment and domain information
>gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 299
KOG0733|consensus 802 100.0
KOG0736|consensus 953 100.0
KOG0730|consensus 693 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0730|consensus693 100.0
KOG0738|consensus491 100.0
KOG0733|consensus802 99.98
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.97
KOG0735|consensus 952 99.97
KOG0739|consensus439 99.96
KOG0736|consensus953 99.95
KOG0741|consensus 744 99.95
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.93
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.92
KOG0737|consensus386 99.92
KOG0728|consensus404 99.9
KOG0735|consensus952 99.9
KOG0729|consensus435 99.89
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.89
KOG0727|consensus408 99.89
KOG0740|consensus428 99.88
KOG0726|consensus440 99.88
KOG0652|consensus424 99.88
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.88
CHL00195489 ycf46 Ycf46; Provisional 99.86
PRK03992389 proteasome-activating nucleotidase; Provisional 99.86
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.84
KOG0731|consensus 774 99.83
KOG0734|consensus752 99.8
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.8
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.77
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.77
KOG0651|consensus388 99.76
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.76
CHL00206 2281 ycf2 Ycf2; Provisional 99.74
KOG0732|consensus 1080 99.71
CHL00176 638 ftsH cell division protein; Validated 99.71
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.67
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.66
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.66
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.52
KOG0739|consensus 439 99.5
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.41
KOG0737|consensus 386 99.4
KOG0738|consensus 491 99.37
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.37
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.34
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.34
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.32
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.32
KOG0728|consensus 404 99.31
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.3
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.29
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.25
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.23
KOG0727|consensus 408 99.22
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.22
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.21
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.2
KOG0726|consensus 440 99.2
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.2
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.2
KOG0729|consensus 435 99.18
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.18
KOG0652|consensus 424 99.16
KOG0744|consensus423 99.16
COG1123539 ATPase components of various ABC-type transport sy 99.15
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.07
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.05
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.05
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.04
CHL00195 489 ycf46 Ycf46; Provisional 99.04
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.04
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.02
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.01
COG4619223 ABC-type uncharacterized transport system, ATPase 99.01
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.99
COG1127263 Ttg2A ABC-type transport system involved in resist 98.98
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.98
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 98.97
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 98.96
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.95
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 98.94
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.94
COG1123 539 ATPase components of various ABC-type transport sy 98.93
PRK09473330 oppD oligopeptide transporter ATP-binding componen 98.93
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.93
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.93
KOG0651|consensus 388 98.92
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 98.92
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.91
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.91
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 98.91
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.9
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.9
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.9
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.9
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 98.9
PRK11153343 metN DL-methionine transporter ATP-binding subunit 98.9
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 98.9
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.89
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 98.89
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.88
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 98.88
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 98.88
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 98.88
PRK10908222 cell division protein FtsE; Provisional 98.88
CHL00095 821 clpC Clp protease ATP binding subunit 98.88
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.87
PF00004132 AAA: ATPase family associated with various cellula 98.87
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.87
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.87
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.87
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.85
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.85
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.85
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 98.85
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.85
PRK11607377 potG putrescine transporter ATP-binding subunit; P 98.85
KOG0742|consensus630 98.85
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.84
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.84
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.84
COG4172534 ABC-type uncharacterized transport system, duplica 98.84
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.84
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 98.84
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.84
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.83
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.83
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.83
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.83
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.83
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.82
COG4559259 ABC-type hemin transport system, ATPase component 98.82
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.82
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 98.82
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.82
COG4181228 Predicted ABC-type transport system involved in ly 98.82
KOG0740|consensus 428 98.81
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.81
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.81
KOG0734|consensus 752 98.81
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.81
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.81
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 98.81
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 98.8
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 98.8
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.8
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.8
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 98.8
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 98.79
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.79
PRK13537306 nodulation ABC transporter NodI; Provisional 98.78
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.78
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.78
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.78
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 98.78
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 98.78
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 98.78
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 98.78
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 98.77
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 98.77
KOG0732|consensus 1080 98.77
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.77
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 98.77
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.77
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.77
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.76
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 98.76
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.76
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 98.76
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.76
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.76
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 98.76
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 98.75
COG4987573 CydC ABC-type transport system involved in cytochr 98.75
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 98.75
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 98.75
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.75
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.75
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 98.75
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 98.74
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 98.74
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.74
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.74
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 98.74
COG0411250 LivG ABC-type branched-chain amino acid transport 98.74
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 98.73
PRK13536340 nodulation factor exporter subunit NodI; Provision 98.73
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 98.73
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 98.73
PRK14235267 phosphate transporter ATP-binding protein; Provisi 98.73
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.73
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.73
PRK14241258 phosphate transporter ATP-binding protein; Provisi 98.73
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.73
PRK10253265 iron-enterobactin transporter ATP-binding protein; 98.72
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 98.72
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.72
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 98.72
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 98.72
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 98.72
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 98.72
PRK10938 490 putative molybdenum transport ATP-binding protein 98.72
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 98.72
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 98.71
PRK14240250 phosphate transporter ATP-binding protein; Provisi 98.71
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 98.71
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 98.71
cd03299235 ABC_ModC_like Archeal protein closely related to M 98.71
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 98.71
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 98.7
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 98.7
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 98.7
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 98.7
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.7
PRK09984262 phosphonate/organophosphate ester transporter subu 98.69
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 98.69
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.69
cd03234226 ABCG_White The White subfamily represents ABC tran 98.69
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 98.69
COG0410237 LivF ABC-type branched-chain amino acid transport 98.69
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 98.69
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 98.68
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 98.68
PRK10790592 putative multidrug transporter membrane\ATP-bindin 98.68
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.68
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.68
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 98.68
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.67
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 98.67
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 98.67
PRK14242253 phosphate transporter ATP-binding protein; Provisi 98.67
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 98.67
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 98.67
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 98.67
PRK03695248 vitamin B12-transporter ATPase; Provisional 98.67
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.66
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 98.66
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.66
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 98.66
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 98.66
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 98.66
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.66
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 98.65
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 98.65
PRK14237267 phosphate transporter ATP-binding protein; Provisi 98.65
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.65
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 98.65
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 98.65
PRK14239252 phosphate transporter ATP-binding protein; Provisi 98.65
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 98.65
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.65
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 98.64
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 98.64
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 98.64
KOG0731|consensus 774 98.64
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 98.64
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 98.64
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 98.64
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.64
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 98.64
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 98.64
COG4598256 HisP ABC-type histidine transport system, ATPase c 98.63
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 98.63
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 98.63
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 98.63
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 98.63
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.63
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 98.62
PRK10619257 histidine/lysine/arginine/ornithine transporter su 98.62
COG4167267 SapF ABC-type antimicrobial peptide transport syst 98.62
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 98.62
PRK14243264 phosphate transporter ATP-binding protein; Provisi 98.61
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 98.61
PRK14236272 phosphate transporter ATP-binding protein; Provisi 98.61
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 98.61
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 98.61
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.6
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 98.6
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 98.6
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 98.6
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 98.59
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 98.59
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 98.59
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 98.59
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 98.59
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 98.59
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 98.59
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 98.58
PLN03211 659 ABC transporter G-25; Provisional 98.58
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 98.58
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 98.58
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.57
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.57
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.57
cd03246173 ABCC_Protease_Secretion This family represents the 98.57
COG4525259 TauB ABC-type taurine transport system, ATPase com 98.57
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 98.57
PTZ002651466 multidrug resistance protein (mdr1); Provisional 98.57
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 98.57
CHL00176 638 ftsH cell division protein; Validated 98.57
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.56
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 98.56
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 98.56
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 98.56
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.56
PRK09580248 sufC cysteine desulfurase ATPase component; Review 98.56
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.56
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 98.56
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 98.55
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 98.55
PRK14238271 phosphate transporter ATP-binding protein; Provisi 98.55
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.55
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 98.54
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.54
COG4148352 ModC ABC-type molybdate transport system, ATPase c 98.54
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.54
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.54
COG4618580 ArpD ABC-type protease/lipase transport system, AT 98.54
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 98.54
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.54
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 98.54
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.53
PRK10789569 putative multidrug transporter membrane\ATP-bindin 98.53
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.52
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.52
COG4172 534 ABC-type uncharacterized transport system, duplica 98.52
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 98.52
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 98.51
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.5
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.5
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.5
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.5
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 98.5
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 98.5
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 98.49
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.49
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.48
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 98.47
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 98.47
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 98.46
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.45
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.45
KOG0057|consensus591 98.45
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 98.45
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 98.45
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 98.45
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 98.44
PF00005137 ABC_tran: ABC transporter This structure is on hol 98.44
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.44
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 98.44
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.44
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.43
PRK10938490 putative molybdenum transport ATP-binding protein 98.43
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.43
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.42
PRK13409 590 putative ATPase RIL; Provisional 98.41
PRK10762501 D-ribose transporter ATP binding protein; Provisio 98.41
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 98.41
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.4
COG4988559 CydD ABC-type transport system involved in cytochr 98.4
PLN03130 1622 ABC transporter C family member; Provisional 98.4
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 98.4
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 98.39
COG4586325 ABC-type uncharacterized transport system, ATPase 98.39
PRK10535 648 macrolide transporter ATP-binding /permease protei 98.39
KOG0055|consensus 1228 98.38
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.38
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.38
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.38
PRK13546264 teichoic acids export protein ATP-binding subunit; 98.38
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.38
PLN03140 1470 ABC transporter G family member; Provisional 98.38
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.38
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 98.37
PRK10522547 multidrug transporter membrane component/ATP-bindi 98.37
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.37
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.37
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.37
COG0488 530 Uup ATPase components of ABC transporters with dup 98.36
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 98.36
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.36
COG4170330 SapD ABC-type antimicrobial peptide transport syst 98.35
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.35
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.35
PLN032321495 ABC transporter C family member; Provisional 98.35
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.34
PLN03073 718 ABC transporter F family; Provisional 98.34
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.34
PRK13409590 putative ATPase RIL; Provisional 98.34
COG4178604 ABC-type uncharacterized transport system, permeas 98.34
PRK10636638 putative ABC transporter ATP-binding protein; Prov 98.34
COG4161242 ArtP ABC-type arginine transport system, ATPase co 98.34
COG0488530 Uup ATPase components of ABC transporters with dup 98.33
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.33
PRK11147 635 ABC transporter ATPase component; Reviewed 98.32
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 98.32
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 98.32
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 98.31
PTZ002431560 ABC transporter; Provisional 98.31
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 98.3
PRK11147635 ABC transporter ATPase component; Reviewed 98.3
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.3
COG1101263 PhnK ABC-type uncharacterized transport system, AT 98.3
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 98.28
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.27
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.27
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 98.27
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.27
PRK11819556 putative ABC transporter ATP-binding protein; Revi 98.26
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 98.26
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 98.25
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.24
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 98.24
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.22
COG4133209 CcmA ABC-type transport system involved in cytochr 98.22
KOG0055|consensus1228 98.21
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.21
KOG0056|consensus790 98.21
CHL00181 287 cbbX CbbX; Provisional 98.2
KOG0060|consensus659 98.2
KOG0058|consensus716 98.19
PLN03073718 ABC transporter F family; Provisional 98.19
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.17
CHL00181287 cbbX CbbX; Provisional 98.17
COG4136213 ABC-type uncharacterized transport system, ATPase 98.17
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 98.14
KOG0927|consensus 614 98.13
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.12
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.1
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.1
KOG0061|consensus 613 98.09
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.07
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 98.06
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.04
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 98.0
KOG0743|consensus457 97.98
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.98
KOG0064|consensus728 97.97
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.96
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 97.95
KOG0059|consensus885 97.94
KOG0989|consensus 346 97.94
COG4674249 Uncharacterized ABC-type transport system, ATPase 97.94
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.93
COG4152300 ABC-type uncharacterized transport system, ATPase 97.91
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.9
PF0933662 Vps4_C: Vps4 C terminal oligomerisation domain; In 97.9
smart00382148 AAA ATPases associated with a variety of cellular 97.88
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.86
PRK08118167 topology modulation protein; Reviewed 97.83
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.79
PLN03130 1622 ABC transporter C family member; Provisional 97.79
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 97.78
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.78
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.74
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.74
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.72
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 97.72
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.71
PRK00131175 aroK shikimate kinase; Reviewed 97.7
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.69
PRK07261171 topology modulation protein; Provisional 97.66
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 97.66
KOG0062|consensus 582 97.65
COG3845 501 ABC-type uncharacterized transport systems, ATPase 97.63
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 97.62
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.62
PRK14086617 dnaA chromosomal replication initiation protein; P 97.62
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.62
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.6
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.6
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.57
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 97.57
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 97.55
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.55
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.54
PLN03232 1495 ABC transporter C family member; Provisional 97.54
PRK06762166 hypothetical protein; Provisional 97.52
PRK04195 482 replication factor C large subunit; Provisional 97.52
PRK13949169 shikimate kinase; Provisional 97.52
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 97.51
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.49
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.49
KOG0927|consensus614 97.48
PRK03839180 putative kinase; Provisional 97.48
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.47
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.47
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.46
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.45
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.45
PRK06217183 hypothetical protein; Validated 97.45
PRK09825176 idnK D-gluconate kinase; Provisional 97.45
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.44
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.43
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.43
COG4615546 PvdE ABC-type siderophore export system, fused ATP 97.43
PF13173128 AAA_14: AAA domain 97.41
>KOG0733|consensus Back     alignment and domain information
Probab=100.00  E-value=4.1e-47  Score=360.47  Aligned_cols=265  Identities=29%  Similarity=0.419  Sum_probs=209.8

Q ss_pred             CcChhhhhcCCCCCCcEEEEEcCCCChHHHHHHHHHHhhcCCeecccchhhhhccccccHHHHHHHHHHHHHH-------
Q psy13773          7 VEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTME-------   79 (299)
Q Consensus         7 l~~p~~~~sl~i~~~~~vLL~Gp~GsGKTtLlr~La~~l~~~~i~i~~~~l~~~~~g~~~~~i~~~f~~a~~~-------   79 (299)
                      +++|+.|.++++.|+++||||||||||||+|+++||++++.+++.|...++++.+.|+++++++++|+.|...       
T Consensus       209 i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~vPf~~isApeivSGvSGESEkkiRelF~~A~~~aPcivFi  288 (802)
T KOG0733|consen  209 IKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELGVPFLSISAPEIVSGVSGESEKKIRELFDQAKSNAPCIVFI  288 (802)
T ss_pred             hcCchhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhcCCceEeecchhhhcccCcccHHHHHHHHHHHhccCCeEEEe
Confidence            8999999999999999999999999999999999999999999999999999999999999999999999865       


Q ss_pred             ----HHhhhhcCCCchhhh----HHHhhc---------------------CccchhhcCC-----------CccHHHHHh
Q psy13773         80 ----NFRYAMGKSSPSALR----ETIVEV---------------------PNITWEDIGG-----------LEGVKRELQ  119 (299)
Q Consensus        80 ----~~~~~~~~~~~~~~~----~~l~~l---------------------~~~l~~~~~r-----------~p~~~~R~~  119 (299)
                          ++.+.|........+    ++++.|                     |+.++++++|           .|++.+|.+
T Consensus       289 DeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~  368 (802)
T KOG0733|consen  289 DEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREE  368 (802)
T ss_pred             ecccccccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCCCcccCHHHhccccccceeeecCCchHHHHH
Confidence                445555443333333    333322                     8888888866           688888876


Q ss_pred             ---------hhcccCCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHH--------------H--hcCCc
Q psy13773        120 ---------ELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIR-RERE--------------K--LAGNP  173 (299)
Q Consensus       120 ---------~l~~~v~l~~LA~~t~glSggDl~~Lv~~A~~~a~~r~~~~~~~-~~~~--------------~--~~~~~  173 (299)
                               .+..++++..||+.|+||+|+||++||.+|+..|++|..+...+ ....              +  +....
T Consensus       369 IL~~~~~~lrl~g~~d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~  448 (802)
T KOG0733|consen  369 ILRIICRGLRLSGDFDFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITS  448 (802)
T ss_pred             HHHHHHhhCCCCCCcCHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCC
Confidence                     34568899999999999999999999999999999998753221 0000              0  00000


Q ss_pred             cccccccc-----------CC----CCCCcccccHHHHHHHHHhccCC-----------CCHHHHHHHHHHHHHHHHhhc
Q psy13773        174 AASAAMET-----------ED----EDDPVPEITRAHFEEAMRFARRS-----------VNDADIRKYEMFAQTLQQSRG  227 (299)
Q Consensus       174 ~~~~~~~~-----------~~----~~~~~~~it~~Df~~AL~~~~Ps-----------Vsw~DIggL~~vk~~i~~ti~  227 (299)
                      +.+..++.           .+    +......|+.+||++|+..+||+           |+|+|||+|++++.+|...|.
T Consensus       449 ~~~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~  528 (802)
T KOG0733|consen  449 NAERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAIL  528 (802)
T ss_pred             cccccccHHHHHHHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcchhcccceecCCCChhhcccHHHHHHHHHHHHh
Confidence            11100111           01    22233468999999999999976           999999999999999999999


Q ss_pred             CCCCCCCCCCCCC-CCCCCCcccccCCCCCCCeeeeccCCCCCCCCCCCCCCCCCCCCCCC
Q psy13773        228 FGTNFRFPSNPNQ-SQSGGPNSAPANESGTGGILLMFPSNPNQSQSGGPNSAPANESGTGG  287 (299)
Q Consensus       228 ~~~Plk~Pe~~~~-~~~k~s~~l~~g~~gtg~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~  287 (299)
                      |  |.||||+|.. |+.--+|||||||||.|||||-              -|-|||+|..=
T Consensus       529 ~--PiK~pd~~k~lGi~~PsGvLL~GPPGCGKTLlA--------------KAVANEag~NF  573 (802)
T KOG0733|consen  529 A--PIKRPDLFKALGIDAPSGVLLCGPPGCGKTLLA--------------KAVANEAGANF  573 (802)
T ss_pred             h--hccCHHHHHHhCCCCCCceEEeCCCCccHHHHH--------------HHHhhhccCce
Confidence            9  9999999864 7888999999999999999985              36677777543



>KOG0736|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>KOG0064|consensus Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-37
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 8e-36
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-37
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 8e-36
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 4e-37
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-29
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 9e-20
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 5e-18
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 1e-16
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 2e-10
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 1e-16
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 2e-10
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-16
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 1e-16
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 2e-10
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 3e-15
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 6e-15
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 6e-15
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 7e-15
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 4e-13
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 4e-13
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 4e-13
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 7e-13
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 7e-13
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 8e-13
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 8e-13
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 5e-12
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 6e-12
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-11
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 3e-11
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 3e-11
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-11
3b9p_A297 Spastin Length = 297 7e-11
2ce7_A 476 Edta Treated Length = 476 9e-11
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 1e-10
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-10
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-10
1xwi_A322 Crystal Structure Of Vps4b Length = 322 3e-10
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 4e-10
2c9o_A 456 3d Structure Of The Human Ruvb-Like Helicase Ruvbl1 5e-05
2xsz_A367 The Dodecameric Human Ruvbl1:ruvbl2 Complex With Tr 4e-04
1in5_A334 Thermogota Maritima Ruvb A156s Mutant Length = 334 8e-04
1in4_A334 Thermotoga Maritima Ruvb Holliday Junction Branch M 8e-04
1j7k_A334 Thermotoga Maritima Ruvb P216g Mutant Length = 334 8e-04
1in7_A334 Thermotoga Maritima Ruvb R170a Length = 334 8e-04
1in8_A334 Thermotoga Maritima Ruvb T158v Length = 334 8e-04
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure

Iteration: 1

Score = 152 bits (384), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 66/74 (89%), Positives = 71/74 (95%) Query: 2 ISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMW 61 + YPVEHP+KFLKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMW Sbjct: 492 LVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMW 551 Query: 62 FGESEANVRDIFDK 75 FGESEANVR+IFDK Sbjct: 552 FGESEANVREIFDK 565
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2C9O|A Chain A, 3d Structure Of The Human Ruvb-Like Helicase Ruvbl1 Length = 456 Back     alignment and structure
>pdb|2XSZ|A Chain A, The Dodecameric Human Ruvbl1:ruvbl2 Complex With Truncated Domains Ii Length = 367 Back     alignment and structure
>pdb|1IN5|A Chain A, Thermogota Maritima Ruvb A156s Mutant Length = 334 Back     alignment and structure
>pdb|1IN4|A Chain A, Thermotoga Maritima Ruvb Holliday Junction Branch Migration Motor Length = 334 Back     alignment and structure
>pdb|1J7K|A Chain A, Thermotoga Maritima Ruvb P216g Mutant Length = 334 Back     alignment and structure
>pdb|1IN7|A Chain A, Thermotoga Maritima Ruvb R170a Length = 334 Back     alignment and structure
>pdb|1IN8|A Chain A, Thermotoga Maritima Ruvb T158v Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 6e-50
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-19
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 4e-09
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-49
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-31
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-12
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 7e-43
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-34
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-26
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-16
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-10
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-06
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 2e-36
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 8e-27
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 8e-10
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 9e-33
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 8e-24
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 8e-08
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 2e-31
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-05
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 5e-31
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 3e-05
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-04
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-30
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 3e-17
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 6e-10
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-05
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 6e-29
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 8e-26
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 1e-10
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 9e-28
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-14
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 2e-07
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-26
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-14
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 7e-07
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 2e-25
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 7e-14
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 4e-08
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 9e-25
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-21
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 1e-08
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-16
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 6e-16
2r62_A268 Cell division protease FTSH homolog; ATPase domain 8e-16
2r62_A268 Cell division protease FTSH homolog; ATPase domain 3e-04
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 8e-16
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-04
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-15
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-04
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-15
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 4e-04
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-13
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 6e-04
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-13
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 8e-04
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-08
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 2e-07
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 4e-07
3pvs_A 447 Replication-associated recombination protein A; ma 5e-07
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 6e-07
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 7e-07
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 7e-07
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 9e-07
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 1e-06
2krk_A86 26S protease regulatory subunit 8; structural geno 1e-06
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 1e-06
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 2e-06
2qgz_A308 Helicase loader, putative primosome component; str 2e-06
3kw6_A78 26S protease regulatory subunit 8; structural geno 2e-06
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 2e-06
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 2e-05
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 3e-05
2chg_A226 Replication factor C small subunit; DNA-binding pr 4e-05
2chq_A319 Replication factor C small subunit; DNA-binding pr 6e-05
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 6e-05
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 6e-04
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
 Score =  165 bits (421), Expect = 6e-50
 Identities = 43/71 (60%), Positives = 51/71 (71%)

Query: 5  YPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGE 64
           PV +P++F   G+    GVL  GPPGCGKTLLAKA+ANE   NFISVKGPELL M+ GE
Sbjct: 28 APVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGE 87

Query: 65 SEANVRDIFDK 75
          SE  VR +F +
Sbjct: 88 SERAVRQVFQR 98


>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.97
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.96
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.96
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.95
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.95
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.95
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.94
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.92
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.91
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.91
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.9
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.89
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.89
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.89
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.87
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.79
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.79
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.76
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.74
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.73
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.72
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.71
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.69
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.64
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.64
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.64
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.57
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.57
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.56
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.56
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.54
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.54
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.37
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.31
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.28
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.22
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.22
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.21
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.2
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.16
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.15
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.15
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.12
2krk_A86 26S protease regulatory subunit 8; structural geno 99.12
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.07
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.07
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.07
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.05
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.02
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.0
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.98
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.98
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.96
1b0u_A262 Histidine permease; ABC transporter, transport pro 98.96
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 98.95
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.95
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.95
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 98.95
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 98.94
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 98.93
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 98.93
1g6h_A257 High-affinity branched-chain amino acid transport 98.92
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 98.92
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.92
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.91
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.9
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 98.9
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.89
1ji0_A240 ABC transporter; ATP binding protein, structural g 98.87
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.86
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.86
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 98.86
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 98.84
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 98.84
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 98.84
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.82
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.82
2ghi_A260 Transport protein; multidrug resistance protein, M 98.82
1sgw_A214 Putative ABC transporter; structural genomics, P p 98.82
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.81
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 98.81
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.8
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.78
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 98.78
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 98.76
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.75
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 98.73
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 98.69
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 98.68
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 98.67
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 98.67
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.6
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.6
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 98.6
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.57
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.56
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.56
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.55
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 98.54
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.49
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.44
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.43
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.43
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 98.39
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.37
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.36
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.35
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.33
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.3
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.3
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.27
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.25
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.23
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.23
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.22
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 98.21
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.21
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.16
3bos_A242 Putative DNA replication factor; P-loop containing 98.16
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.15
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.09
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.06
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.04
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.03
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.03
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.02
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.02
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.01
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.0
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.0
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.99
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.97
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.96
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 97.9
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 97.89
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.89
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.88
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 97.87
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.85
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.85
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.84
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.82
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.81
3co5_A143 Putative two-component system transcriptional RES 97.8
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.79
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.79
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.79
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.79
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.77
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.76
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.76
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.76
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.75
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.73
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.73
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.73
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.73
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.72
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.7
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.69
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.68
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.67
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.66
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.66
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.66
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.64
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.64
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.64
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.63
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.62
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.62
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.61
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.59
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.59
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.58
3pvs_A 447 Replication-associated recombination protein A; ma 97.58
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.57
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.57
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.56
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.56
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.55
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.55
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.54
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.54
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.54
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.53
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.53
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.51
2r44_A331 Uncharacterized protein; putative ATPase, structur 97.51
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.51
2og2_A359 Putative signal recognition particle receptor; nuc 97.5
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.5
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.5
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.5
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.49
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.49
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.49
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.49
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.48
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.47
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.46
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.46
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.46
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.44
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.44
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.44
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.43
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.43
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.43
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.43
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.42
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.42
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.42
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 97.42
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.41
1via_A175 Shikimate kinase; structural genomics, transferase 97.4
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.39
1tue_A212 Replication protein E1; helicase, replication, E1E 97.39
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.39
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.39
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.37
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.37
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.37
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.36
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.36
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.36
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.35
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.34
3kta_A182 Chromosome segregation protein SMC; structural mai 97.34
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.34
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.34
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.33
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.33
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.33
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.32
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.32
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.32
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.31
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.3
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.29
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.29
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 97.29
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.29
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.28
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.27
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.27
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.26
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.26
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.25
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.25
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.25
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.25
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.25
1tue_A212 Replication protein E1; helicase, replication, E1E 97.23
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.22
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.22
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.22
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.22
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.21
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 97.21
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.2
2qgz_A308 Helicase loader, putative primosome component; str 97.2
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.2
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.19
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.19
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.19
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.19
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 97.18
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.18
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.17
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.16
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.16
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.16
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.16
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.15
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.14
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.14
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.14
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.12
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.12
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 97.11
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.11
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.11
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.1
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.1
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 97.09
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.08
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.08
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.07
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.06
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.06
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.04
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.04
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.03
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.02
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.02
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.01
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.01
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.01
1p9r_A418 General secretion pathway protein E; bacterial typ 96.99
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.99
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.98
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.97
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.96
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.96
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.95
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.95
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.95
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.95
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.94
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.93
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.93
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.92
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 96.91
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.9
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.89
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.86
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.86
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.85
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.85
4aby_A415 DNA repair protein RECN; hydrolase, double strand 96.85
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.85
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.82
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.82
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.81
3pvs_A 447 Replication-associated recombination protein A; ma 96.81
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.8
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.8
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.79
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.79
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.78
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.78
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.78
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 96.77
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 96.77
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.76
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.76
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.76
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.76
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.76
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.76
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.76
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.75
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.74
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.74
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.73
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.73
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.71
2z43_A324 DNA repair and recombination protein RADA; archaea 96.7
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.69
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.68
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.67
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.62
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.61
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 96.58
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.58
2fna_A357 Conserved hypothetical protein; structural genomic 96.58
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.58
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 96.56
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.56
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.55
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.54
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 96.54
3co5_A143 Putative two-component system transcriptional RES 96.51
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 96.49
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.49
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.49
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.48
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.48
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.47
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.47
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.46
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.46
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.45
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.44
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.44
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 96.42
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.41
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.39
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.39
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.39
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.37
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.36
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.35
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 96.34
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.34
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 96.32
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.31
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.3
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 96.27
3bos_A 242 Putative DNA replication factor; P-loop containing 96.26
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.26
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 96.25
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 96.2
1e69_A322 Chromosome segregation SMC protein; structural mai 96.14
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.13
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.12
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.11
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 96.08
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.05
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 96.03
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.0
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.0
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.0
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.0
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.99
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.99
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 95.99
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.97
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 95.97
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.95
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 95.94
3io5_A333 Recombination and repair protein; storage dimer, i 95.91
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.9
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 95.88
2qgz_A 308 Helicase loader, putative primosome component; str 95.87
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 95.87
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.86
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.86
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.86
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 95.84
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 95.81
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.81
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 95.8
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.78
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.77
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 95.76
3ice_A422 Transcription termination factor RHO; transcriptio 95.75
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.67
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.62
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.61
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.59
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.57
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 95.57
2ged_A193 SR-beta, signal recognition particle receptor beta 95.54
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.52
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.52
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.52
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 95.51
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.49
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.49
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 95.47
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.45
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.43
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.43
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.43
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.42
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 95.38
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 95.37
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.37
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.36
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.34
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 95.33
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.32
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.32
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 95.32
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.32
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.31
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.31
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.31
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.3
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.3
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.3
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.29
1nrj_B218 SR-beta, signal recognition particle receptor beta 95.26
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 95.26
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.25
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.24
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.23
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.23
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.23
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.22
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.2
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 95.18
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.17
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.17
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.17
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.17
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.16
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 95.15
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.13
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.12
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.12
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 95.11
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.09
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.09
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.08
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.07
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 95.06
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.05
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.05
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.04
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.03
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.03
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.02
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.02
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.0
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=7.1e-44  Score=360.54  Aligned_cols=246  Identities=30%  Similarity=0.460  Sum_probs=200.8

Q ss_pred             eeeccCcChhhhhcCCCCCCcEEEEEcCCCChHHHHHHHHHHhhcCCeecccchhhhhccccccHHHHHHHHHHHHHH--
Q psy13773          2 ISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTME--   79 (299)
Q Consensus         2 ~v~~pl~~p~~~~sl~i~~~~~vLL~Gp~GsGKTtLlr~La~~l~~~~i~i~~~~l~~~~~g~~~~~i~~~f~~a~~~--   79 (299)
                      .|.+|+++|++|..+++.++++||||||||||||+|+|+||++++.+++.++|.++.+++.|++++.++.+|..|...  
T Consensus       219 ~v~~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l~sk~~gese~~lr~lF~~A~~~~P  298 (806)
T 3cf2_A          219 MVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAP  298 (806)
T ss_dssp             HHHHHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHHHSSCTTHHHHHHHHHHHHHTTSCS
T ss_pred             HHHHHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHhhcccchHHHHHHHHHHHHHHHcCC
Confidence            467899999999999999999999999999999999999999999999999999999999999999999999998754  


Q ss_pred             ---------HHhhhhcCCCchhhh----HHHhhc-----------------CccchhhcCC-----------CccHHHHH
Q psy13773         80 ---------NFRYAMGKSSPSALR----ETIVEV-----------------PNITWEDIGG-----------LEGVKREL  118 (299)
Q Consensus        80 ---------~~~~~~~~~~~~~~~----~~l~~l-----------------~~~l~~~~~r-----------~p~~~~R~  118 (299)
                               .++..+........+    +++..+                 ++.++++++|           .|+..+|.
T Consensus       299 sIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~LD~ALrR~GRFd~~I~i~~Pd~~~R~  378 (806)
T 3cf2_A          299 AIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRL  378 (806)
T ss_dssp             EEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTTSCTTTTSTTSSCEEEECCCCCHHHHH
T ss_pred             eEEEEehhcccccccCCCCChHHHHHHHHHHHHHhcccccCCEEEEEecCChhhcCHHHhCCcccceEEecCCCCHHHHH
Confidence                     455555444332222    222222                 6777777754           68998887


Q ss_pred             h---------hhcccCCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccccccCCCCCCcc
Q psy13773        119 Q---------ELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDEDDPVP  189 (299)
Q Consensus       119 ~---------~l~~~v~l~~LA~~t~glSggDl~~Lv~~A~~~a~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  189 (299)
                      +         .+..++++..||.+|+||||+||+.||.+|++.|++|......      ......       ..+.....
T Consensus       379 ~IL~~~l~~~~~~~dvdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~------~~~~~~-------~~e~~~~~  445 (806)
T 3cf2_A          379 EILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLID------LEDETI-------DAEVMNSL  445 (806)
T ss_dssp             HHHHHTCSSSEECTTCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGG------GTCCCC-------SHHHHHHC
T ss_pred             HHHHHHhcCCCCCcccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhcccccc------cccccc-------chhhhccc
Confidence            6         3457889999999999999999999999999999998764210      000000       00001124


Q ss_pred             cccHHHHHHHHHhccCC-----------CCHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCC-CCCCCCcccccCCCCCC
Q psy13773        190 EITRAHFEEAMRFARRS-----------VNDADIRKYEMFAQTLQQSRGFGTNFRFPSNPNQ-SQSGGPNSAPANESGTG  257 (299)
Q Consensus       190 ~it~~Df~~AL~~~~Ps-----------Vsw~DIggL~~vk~~i~~ti~~~~Plk~Pe~~~~-~~~k~s~~l~~g~~gtg  257 (299)
                      .|+.+||..|+++++|+           |+|+|||||+++|+++.++|+|  |++||++|.. |.+...|+|||||||||
T Consensus       446 ~v~~~Df~~Al~~~~ps~~r~~~~~~p~v~w~diggl~~~k~~l~e~v~~--p~~~p~~f~~~g~~~~~gvLl~GPPGtG  523 (806)
T 3cf2_A          446 AVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQY--PVEHPDKFLKFGMTPSKGVLFYGPPGCG  523 (806)
T ss_dssp             EECTTHHHHHHSSSSCCCCCCCCCBCCCCCSTTCCSCHHHHHHHTTTTTT--TTTCSGGGSSSCCCCCSCCEEESSTTSS
T ss_pred             eeeHHHHHHHHHhCCCcccccccccCCCCCHHHhCCHHHHHHHHHHHHHh--hhhCHHHHHhcCCCCCceEEEecCCCCC
Confidence            68899999999998864           9999999999999999999999  9999999976 78889999999999999


Q ss_pred             Ceeee
Q psy13773        258 GILLM  262 (299)
Q Consensus       258 ~~ll~  262 (299)
                      ||+|-
T Consensus       524 KT~lA  528 (806)
T 3cf2_A          524 KTLLA  528 (806)
T ss_dssp             HHHHH
T ss_pred             chHHH
Confidence            99874



>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 299
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-31
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 4e-05
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-25
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 8e-08
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 7e-07
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 6e-24
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 2e-04
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 5e-22
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 9e-07
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 3e-21
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 8e-18
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 9e-16
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-10
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 2e-08
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-08
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-07
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-06
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-06
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 8e-06
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 1e-05
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 1e-05
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 2e-05
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 2e-05
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 5e-05
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 6e-05
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 7e-05
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 8e-05
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 1e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 2e-04
d2gnoa2198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 2e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 3e-04
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 5e-04
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 7e-04
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 8e-04
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 9e-04
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 0.001
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.002
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 0.002
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 0.002
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.002
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 0.003
d1v5wa_258 c.37.1.11 (A:) Meiotic recombination protein DMC1/ 0.003
d1e4va1179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 0.003
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.003
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 0.004
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
 Score =  115 bits (290), Expect = 2e-31
 Identities = 53/210 (25%), Positives = 71/210 (33%), Gaps = 55/210 (26%)

Query: 6   PVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGES 65
            +  P +F K G +  +GVL  GPPG GKTLLAKAIA E +  F ++ G + + M+ G  
Sbjct: 30  YLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVG 89

Query: 66  EANVR----------------DIFDKVTMENFRYAMGKSS-------------------- 89
            + VR                D  D V  +      G                       
Sbjct: 90  ASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNE 149

Query: 90  --------------PSALR-----ETIVEVPNITWEDIGGLEGVKRELQELVQDVDLNYI 130
                           AL      +  V V          +  V      L  D+D   I
Sbjct: 150 GIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAII 209

Query: 131 AKVTNGFSGADLTEICQRACKLAIRQSIET 160
           A+ T GFSGADL  +   A   A R +   
Sbjct: 210 ARGTPGFSGADLANLVNEAALFAARGNKRV 239


>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.93
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.9
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.89
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.87
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.41
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.36
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.33
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.28
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.25
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.24
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.21
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.16
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.15
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.14
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.1
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.1
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.08
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.06
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.01
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.96
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.96
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.95
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.95
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.94
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.92
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.92
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.9
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.9
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.88
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 98.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.62
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.6
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 98.56
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.56
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 98.53
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 98.48
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.32
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.26
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.24
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 98.23
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.21
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.18
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.15
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.07
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.05
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.99
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.98
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.97
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.94
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.94
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.94
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.88
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.87
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.84
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.8
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.77
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.75
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.72
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.7
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.7
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.68
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.66
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.65
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 97.63
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.61
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.58
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.57
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.57
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.56
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.54
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.53
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.53
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.49
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 97.49
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 97.48
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.48
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.45
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.45
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.43
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.42
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 97.4
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.39
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.39
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.38
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.38
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.35
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.34
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.34
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.34
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 97.33
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.32
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 97.32
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.27
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.24
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.22
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.22
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.17
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.11
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.11
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 97.01
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.0
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.98
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.97
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.94
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.94
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.92
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.9
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.84
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.78
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.77
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.76
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.75
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.7
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.67
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.67
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.63
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.57
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.55
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.55
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.48
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.48
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.47
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.33
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.27
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.26
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.22
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.22
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.19
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.18
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.14
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.1
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.01
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.99
d1vmaa2213 GTPase domain of the signal recognition particle r 95.99
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.99
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.96
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.96
d1okkd2207 GTPase domain of the signal recognition particle r 95.92
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.92
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.92
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.91
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.83
d2qy9a2211 GTPase domain of the signal recognition particle r 95.81
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.81
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.79
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.79
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.78
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.74
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.74
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.73
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.71
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.68
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.66
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.66
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.65
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.63
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.58
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.57
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.54
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.49
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.47
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.45
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.42
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.42
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.38
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.35
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.34
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.33
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.33
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.29
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.28
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.27
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.22
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.18
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.17
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.17
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.15
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.14
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.11
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.1
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.06
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.06
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.04
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.03
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.03
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.03
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.02
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.01
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.99
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.96
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.96
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.94
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.94
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.93
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.92
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 94.92
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.91
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.89
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.88
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.85
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.83
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.83
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.83
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.82
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.82
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.8
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 94.75
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.75
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.74
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 94.74
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.72
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.69
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 94.66
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.64
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.56
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 94.55
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.55
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.52
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.51
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.5
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.49
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.48
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.45
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.41
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.4
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.38
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 94.27
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.25
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.21
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.17
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.17
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.15
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.14
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.11
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.1
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.06
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.03
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.01
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.0
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.97
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.93
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.86
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.83
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.78
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.74
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 93.73
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.58
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.51
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.49
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.41
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.38
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.3
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.22
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.19
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.15
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.1
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 93.09
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 92.82
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.58
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.35
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.27
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.07
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.85
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.78
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.52
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 91.51
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 91.3
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 91.24
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.23
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.1
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.09
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.06
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 90.61
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.47
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 90.4
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.12
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.98
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.73
d1j8yf2 211 GTPase domain of the signal sequence recognition p 89.68
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 89.59
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 89.34
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 89.28
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 89.27
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.25
d2iyva1 165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.2
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.1
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.07
d1viaa_ 161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 88.91
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 88.48
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 88.45
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.96
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.81
d1ls1a2 207 GTPase domain of the signal sequence recognition p 87.56
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 87.42
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 87.4
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 87.39
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.13
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.11
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 87.03
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 86.89
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 86.87
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 86.84
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 86.83
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 86.15
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 85.95
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 85.8
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 85.38
d1okkd2 207 GTPase domain of the signal recognition particle r 85.17
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 84.92
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.85
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 83.93
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 83.66
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 83.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 82.67
d2qy9a2 211 GTPase domain of the signal recognition particle r 82.34
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 82.16
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 82.1
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 82.02
d1xjca_ 165 Molybdopterin-guanine dinucleotide biosynthesis pr 82.0
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 81.99
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 81.9
d1r8sa_ 160 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.85
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 81.84
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 81.52
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 81.32
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 81.21
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.17
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 80.89
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 80.35
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 80.19
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.08
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=1.1e-25  Score=198.86  Aligned_cols=188  Identities=32%  Similarity=0.529  Sum_probs=141.4

Q ss_pred             eeeccCcChhhhhcCCCCCCcEEEEEcCCCChHHHHHHHHHHhhcCCeecccchhhhhccccccHHHHHHHHHHHHHH--
Q psy13773          2 ISTYPVEHPEKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKVTME--   79 (299)
Q Consensus         2 ~v~~pl~~p~~~~sl~i~~~~~vLL~Gp~GsGKTtLlr~La~~l~~~~i~i~~~~l~~~~~g~~~~~i~~~f~~a~~~--   79 (299)
                      .|.+|+++|+.|..+++++++++|||||||||||++++++|.+++.+++.+++.++.+.+.++.+..++.+|..|...  
T Consensus        19 ~i~~~l~~~~~~~~~g~~~~~giLL~GppGtGKT~l~~ala~~~~~~~~~i~~~~l~~~~~g~~~~~l~~~f~~A~~~~p   98 (258)
T d1e32a2          19 MVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAP   98 (258)
T ss_dssp             HHHHHHHCHHHHHHCCCCCCCEEEEECCTTSSHHHHHHHHHHHTTCEEEEECHHHHTTSCTTHHHHHHHHHHHHHHHTCS
T ss_pred             HHHHHhcCHHHHHhCCCCCCceeEEecCCCCCchHHHHHHHHHhCCeEEEEEchhhcccccccHHHHHHHHHHHHHhcCC
Confidence            366799999999999999999999999999999999999999999999999999999999999999999999998765  


Q ss_pred             ---------HHhhhhcCCCchhhh----HHHhh-----------------cCccchhhcCC-----------CccHHHHH
Q psy13773         80 ---------NFRYAMGKSSPSALR----ETIVE-----------------VPNITWEDIGG-----------LEGVKREL  118 (299)
Q Consensus        80 ---------~~~~~~~~~~~~~~~----~~l~~-----------------l~~~l~~~~~r-----------~p~~~~R~  118 (299)
                               .+...+.........    ..+..                 .++.+++++.|           .|+.++|.
T Consensus        99 ~il~iDeid~l~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~vlvi~tTn~~~~ld~al~r~gRfd~~i~~~~P~~~~R~  178 (258)
T d1e32a2          99 AIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRL  178 (258)
T ss_dssp             EEEEESSGGGTCCHHHHCCCTTHHHHHHHHHHHHHTCCCSSCEEEEEEESCGGGSCGGGTSTTSSCEEEECCCCCHHHHH
T ss_pred             eEEEehhhhhhccCCCCCCCchHHHHHHHhccccccccccCCccEEEeCCCccccchhhhhcccccceeECCCCCHHHHH
Confidence                     233333222221111    11111                 16777777743           68888888


Q ss_pred             h---------hhcccCCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccccccCCCCCCcc
Q psy13773        119 Q---------ELVQDVDLNYIAKVTNGFSGADLTEICQRACKLAIRQSIETEIRREREKLAGNPAASAAMETEDEDDPVP  189 (299)
Q Consensus       119 ~---------~l~~~v~l~~LA~~t~glSggDl~~Lv~~A~~~a~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  189 (299)
                      .         .+..++++..||++|+||||+||+.+|++|++.|++|.....        .....    . .........
T Consensus       179 ~il~~~l~~~~~~~~~~~~~la~~t~G~s~adl~~lv~~A~~~a~~~~~~~~--------~~~~~----~-~~~~~~~~~  245 (258)
T d1e32a2         179 EILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLI--------DLEDE----T-IDAEVMNSL  245 (258)
T ss_dssp             HHHHHTTTTSCBCTTCCHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHH--------CCCSS----C-CBHHHHHHC
T ss_pred             HHhhhhccCcccccccchhhhhhcccCCCHHHHHHHHHHHHHHHHHhhcccc--------chhhh----h-hhhhhhccC
Confidence            6         335678999999999999999999999999999998865320        00000    0 000001224


Q ss_pred             cccHHHHHHHHHh
Q psy13773        190 EITRAHFEEAMRF  202 (299)
Q Consensus       190 ~it~~Df~~AL~~  202 (299)
                      +||++||+.||++
T Consensus       246 ~it~~Df~~AL~~  258 (258)
T d1e32a2         246 AVTMDDFRWALSQ  258 (258)
T ss_dssp             CBCHHHHHHHHTC
T ss_pred             ccCHHHHHHHhCc
Confidence            6999999999964



>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure