Psyllid ID: psy13778
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| 449272525 | 243 | Repetin, partial [Columba livia] | 0.576 | 0.699 | 0.372 | 4e-30 | |
| 269838860 | 408 | circumsporozoite protein [Plasmodium yoe | 0.501 | 0.362 | 0.56 | 9e-29 | |
| 63168791 | 427 | circumsporozoite protein [Plasmodium yoe | 0.501 | 0.346 | 0.56 | 6e-28 | |
| 344248733 | 308 | hypothetical protein I79_018504 [Cricetu | 0.535 | 0.512 | 0.387 | 1e-26 | |
| 195729183 | 1402 | VtaA13 [Haemophilus parasuis str. Nagasa | 0.562 | 0.118 | 0.463 | 8e-24 | |
| 195728822 | 1492 | VtaA18 [Haemophilus parasuis] | 0.454 | 0.089 | 0.5 | 5e-23 | |
| 195729105 | 1500 | VtaA11 [Haemophilus parasuis str. Nagasa | 0.532 | 0.104 | 0.471 | 9e-23 | |
| 423626606 | 210 | hypothetical protein IK3_05202, partial | 0.559 | 0.785 | 0.401 | 9e-23 | |
| 195729025 | 1481 | VtaA30 [Haemophilus parasuis] | 0.454 | 0.090 | 0.5 | 9e-23 | |
| 195728983 | 1492 | VtaA24 [Haemophilus parasuis] | 0.454 | 0.089 | 0.493 | 1e-22 |
| >gi|449272525|gb|EMC82409.1| Repetin, partial [Columba livia] | Back alignment and taxonomy information |
|---|
Score = 138 bits (347), Expect = 4e-30, Method: Compositional matrix adjust.
Identities = 64/172 (37%), Positives = 89/172 (51%), Gaps = 2/172 (1%)
Query: 50 TLLQGPTLLQGPTLPQGPTLLQGPTLLQGPTLPQGPTLPQGPTLLQDPTLPQGPTLLQGP 109
L GP+ +QG L GP+ +QG L GP+ QG L GP+ +Q L GP+ +QG
Sbjct: 9 VLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGH 68
Query: 110 TLPQGPTLPQGPTLPQGPTLPQGPTLLQGPTLLQGPTLLQGPTLLQGPTLPQGPTLLQGP 169
L GP+ QG L GP+ QG L GP+ +QG L GP+ +QG L GP+ +QG
Sbjct: 69 VLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGH 128
Query: 170 TLLQGPR--KGPTLPQGPTLPQGPTLPQDPTLLQDPTLLQGPRYKEKELVER 219
L GP +G L GP+ QG L P+ +Q L GP + + ++
Sbjct: 129 VLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGHVLHHGPSWVQGHVLHH 180
|
Source: Columba livia Species: Columba livia Genus: Columba Family: Columbidae Order: Columbiformes Class: Aves Phylum: Chordata Superkingdom: Eukaryota |
| >gi|269838860|gb|ACZ48692.1| circumsporozoite protein [Plasmodium yoelii yoelii] | Back alignment and taxonomy information |
|---|
| >gi|63168791|gb|AAY34563.1| circumsporozoite protein [Plasmodium yoelii] | Back alignment and taxonomy information |
|---|
| >gi|344248733|gb|EGW04837.1| hypothetical protein I79_018504 [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
| >gi|195729183|gb|ACG50752.1| VtaA13 [Haemophilus parasuis str. Nagasaki] | Back alignment and taxonomy information |
|---|
| >gi|195728822|gb|ACG50732.1| VtaA18 [Haemophilus parasuis] | Back alignment and taxonomy information |
|---|
| >gi|195729105|gb|ACG50749.1| VtaA11 [Haemophilus parasuis str. Nagasaki] | Back alignment and taxonomy information |
|---|
| >gi|423626606|ref|ZP_17602382.1| hypothetical protein IK3_05202, partial [Bacillus cereus VD148] gi|401251898|gb|EJR58167.1| hypothetical protein IK3_05202, partial [Bacillus cereus VD148] | Back alignment and taxonomy information |
|---|
| >gi|195729025|gb|ACG50746.1| VtaA30 [Haemophilus parasuis] | Back alignment and taxonomy information |
|---|
| >gi|195728983|gb|ACG50743.1| VtaA24 [Haemophilus parasuis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| UNIPROTKB|Q81JD7 | 382 | bclA "Uncharacterized protein" | 0.505 | 0.390 | 0.54 | 4.4e-29 | |
| TIGR_CMR|BA_1222 | 382 | BA_1222 "conserved hypothetica | 0.505 | 0.390 | 0.54 | 4.4e-29 | |
| UNIPROTKB|Q81WX2 | 478 | BA_3841 "Uncharacterized prote | 0.508 | 0.313 | 0.422 | 7.1e-18 | |
| TIGR_CMR|BA_3841 | 478 | BA_3841 "conserved hypothetica | 0.508 | 0.313 | 0.422 | 7.1e-18 | |
| UNIPROTKB|F1LT09 | 1327 | Wdr33 "Protein Wdr33" [Rattus | 0.494 | 0.110 | 0.430 | 7.4e-18 | |
| UNIPROTKB|J9P7B0 | 2514 | ZDBF2 "Uncharacterized protein | 0.376 | 0.044 | 0.368 | 2.1e-17 | |
| RGD|628797 | 295 | Prpmp5 "proline-rich protein M | 0.518 | 0.518 | 0.413 | 3.2e-17 | |
| MGI|MGI:1921570 | 1330 | Wdr33 "WD repeat domain 33" [M | 0.494 | 0.109 | 0.440 | 3.3e-17 | |
| UNIPROTKB|I3LTD5 | 1471 | WDR33 "Uncharacterized protein | 0.494 | 0.099 | 0.435 | 1.3e-16 | |
| UNIPROTKB|Q9C0J8 | 1336 | WDR33 "pre-mRNA 3' end process | 0.494 | 0.109 | 0.429 | 1.4e-16 |
| UNIPROTKB|Q81JD7 bclA "Uncharacterized protein" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
Score = 323 (118.8 bits), Expect = 4.4e-29, P = 4.4e-29
Identities = 81/150 (54%), Positives = 82/150 (54%)
Query: 49 WTLLQGPTLLQGPTLPQGPTLLQGPTLLQGPTLPQGPTLPQGPTLLQDPTLPQGPTLLQG 108
+TL GPT GPT P GPT GPT GPT P G T GPT PT P GPT G
Sbjct: 36 FTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTG 95
Query: 109 PTLPQGPTLPQGPTLPQGPTLPQGPTLLQGPTLLQGPTLLQGPTLLQGPTLPQGPTLLQG 168
T P GPT P GPT P GPT P G T GPT GPT GPT G T P GPT G
Sbjct: 96 TTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTG 155
Query: 169 PTLLQGPRKGPTLPQGPTLPQGPTLPQDPT 198
PT GP GPT P GPT P GPT P PT
Sbjct: 156 PTGPTGPT-GPTGPTGPTGPTGPTGPTGPT 184
|
|
| TIGR_CMR|BA_1222 BA_1222 "conserved hypothetical protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81WX2 BA_3841 "Uncharacterized protein" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3841 BA_3841 "conserved hypothetical protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LT09 Wdr33 "Protein Wdr33" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P7B0 ZDBF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|628797 Prpmp5 "proline-rich protein MP5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921570 Wdr33 "WD repeat domain 33" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LTD5 WDR33 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9C0J8 WDR33 "pre-mRNA 3' end processing protein WDR33" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 1e-05 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 2e-05 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 2e-05 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 6e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.003 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.003 | |
| smart00784 | 106 | smart00784, SPT2, SPT2 chromatin protein | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 |
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
Score = 46.6 bits (110), Expect = 1e-05
Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 6/97 (6%)
Query: 67 PTLLQGPTLLQGPTLPQGPTLPQGPTLLQDPTLPQGPTLLQGPTLPQGPTLPQGPTLPQG 126
PTL + P + P P+ P P+ P + P Q PT + P LP+ +P+ P P+
Sbjct: 573 PTLSKKP---EFPKDPKHPKDPEEPKKPKRPRSAQRPTRPKSPKLPELLDIPKSPKRPES 629
Query: 127 PTLPQGPTLLQGPTLLQGPTLLQGPTLLQGPTLPQGP 163
P P+ P Q P+ + P +GP +++ P P+ P
Sbjct: 630 PKSPKRPPPPQRPSSPERP---EGPKIIKSPKPPKSP 663
|
Length = 943 |
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|214818 smart00784, SPT2, SPT2 chromatin protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| KOG3546|consensus | 1167 | 99.66 | ||
| KOG3546|consensus | 1167 | 99.63 | ||
| KOG3544|consensus | 327 | 99.62 | ||
| KOG3544|consensus | 327 | 99.62 |
| >KOG3546|consensus | Back alignment and domain information |
|---|
Probab=99.66 E-value=4.5e-15 Score=144.16 Aligned_cols=16 Identities=25% Similarity=0.108 Sum_probs=6.6
Q ss_pred CCCCCCCCCCCCCCCC
Q psy13778 51 LLQGPTLLQGPTLPQG 66 (295)
Q Consensus 51 ~~~G~~G~~G~~G~~G 66 (295)
+++|++|++|.+|.+|
T Consensus 432 gppgppgppg~pg~pg 447 (1167)
T KOG3546|consen 432 GPPGPPGPPGVPGLPG 447 (1167)
T ss_pred CCCCCCCCCCCCCCCC
Confidence 3444444444433333
|
|
| >KOG3546|consensus | Back alignment and domain information |
|---|
| >KOG3544|consensus | Back alignment and domain information |
|---|
| >KOG3544|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 4e-14 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 5e-13 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 6e-13 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 3e-11 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 2e-09 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 4e-09 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 6e-06 | |
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 7e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-05 | |
| 1rm1_C | 286 | Transcription initiation factor IIA large chain; y | 1e-05 |
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
Score = 69.2 bits (169), Expect = 4e-14
Identities = 46/141 (32%), Positives = 49/141 (34%), Gaps = 10/141 (7%)
Query: 58 LQGPTLPQGPTLLQGPTLLQGPTLPQGPTLPQGPTLLQDPTLPQGPTLLQGPTLPQGPTL 117
+ GPTL P TLP GPT P GPT PT P GPT G T GPT
Sbjct: 1 MAFDPNLVGPTLPPIP----PFTLPTGPTGPTGPTGPTGPTGPTGPT---GDTGTTGPTG 53
Query: 118 PQGPTLPQGPTLPQGPTLLQGPTLLQGPTLLQGPTLLQGPTLPQGPTLLQGPTLLQGPRK 177
P GPT P GPT G T GPT G P L L +
Sbjct: 54 PTGPTGPTGPTGATGLTGPTGPTGPSGLG---LPAGLYAFNSGGISLDLGINDPVPFNTV 110
Query: 178 GPTLPQGPTLPQGPTLPQDPT 198
G + T T
Sbjct: 111 GSQFGTAISQLDADTFVISET 131
|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1rm1_C Transcription initiation factor IIA large chain; yeast TFIIA, TBP protein, ATA-box DNA, transcription/DNA complex; 2.50A {Saccharomyces cerevisiae} Length = 286 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| 1wck_A | 220 | BCLA protein; collagen-like protein, bacterial sur | 98.86 | |
| 1o91_A | 178 | Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext | 87.46 |
| >1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} | Back alignment and structure |
|---|
Probab=98.86 E-value=1.3e-10 Score=102.07 Aligned_cols=21 Identities=19% Similarity=0.215 Sum_probs=13.3
Q ss_pred cCCcccccCCCCCCceEEEee
Q psy13778 231 ESDTEDIRDDDDDDMEIVVCT 251 (295)
Q Consensus 231 ~~~~~~~~~~~~~~~~~~~~~ 251 (295)
..+.+++...++|.+.+.+++
T Consensus 122 ~~~~f~~~~~G~Y~is~~~~t 142 (220)
T 1wck_A 122 DADTFVISETGFYKITVIANT 142 (220)
T ss_dssp ETTEEEECSCEEEEEEEEEEB
T ss_pred cccceEEecCcEEEEEEEEec
Confidence 345666777777766665554
|
| >1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00