Psyllid ID: psy13788

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030----
DVALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALSSKENQNVINRSTSANGNFDFNR
ccccccEEcEEEEEEEEccccccccccEEHHccccccccccHHccccccccccEEEEEccccccccEEEEccccccHHHHHHHHHHHHHHEEccccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHHcccHHHHHHHHccccEEEccccccEEEccHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHcccccEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEccHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHccccHHHHHcccHHHHHHHHccccHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEEEEEccccccccccEEEEEEccccccccccEEEEEEccccccccEEEcccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEcccHHHHHHHcccccccccEEEEEEEEcEEEcccccccHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHcccccccccccccccccccEEEEEccccccccHHHHHcccHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccHHHHHHHHccEEEEEccccHHHHHHHcccHHHHHcccccEEEEEccccEEccccccc
ccHHHHHEHEEEcccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHcccHHHHHHccccEEEEEccHHHHHHHHHcccEEEEEEEEcccccccccccHHHHHcccEEEEccEEEccccccEEcccHHHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHcccccccccccEcccHEEEHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccHccccHHHHHHHHHHHHHHHHHHHHccEEEEEcccccEccccHHHHHHEEEEEHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHcccccHHHHccccccHHHHHHHHHccccHHHHHcccHHHHHHHHcccHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEccccccccccccccccEEEEEEEcccccEEEEEEEEEEEEEEEEccccEEEEEEEEccccccccEEEEEEEccHccccccccccEEEEEccccccccccccccccccHHHcccHHHHHHcccccccHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHccEEEEccccccEEEccccccHHHHEEEEEEEEHEHEccccccHHHHHHHHHHHHHHHHccccEEEEEEccccHcHHHHHHHHcccccccEEccccccccccEEEEEcccccccHHHHHHHcHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHcccEEEcccccHHHHHHHHHHHHHccccccEEEEEEEcEEccccccccc
DVALTELVKLLIIDevhllhgdrgpVIEALVARTLRQIGQEVFKGVKSLNRIQSLvydtayhtnenllicaptgagktNVAMLTIAHQIKQHISQgtemynakhgcyvHIGILDVLQIfgragrpqyntsdlgrtasnyyikhndIELFTEHMtkgtemynakhgcyvHIGILDVLQIfgragrpqyntsghatiitpHEKLNHYLSLLtnqipiesNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMrinpreygisydevatdpdliQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGrtasnyyikhndIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTqecceipirggsenvhGKVNILLQTLLsrgrvnsfSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFEtkqwphetplrqiklvtnrgyqspilkpdiLNKIEQRGLTVEDLREMPAKEISYmlrdphvgdkvkqcaweiPLLEIESKLLPITRTVLKIHLTIKanfswndknkstyaepfwiwvedpdsdfiyhsEYFLLSKKQVITKSEESLimtiplsdplpnqyLIRAMSDRYLGSVVQHSmsfkhlivpelhpphtnllelqplpvsalqqpqyeslykfshfnpiqtQIFHCLyhtdnnvllgaptgsgktIAAEITCFRVFkqcpeakvvyIAPLKALVKERVADWKVKFEARLKKKVVELtgdvtpdiqaiSSASvivttpekwdgvsrswqnrnYVQSVALIIIDEIHllgedrgpVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQgmynfrpsvrpvplevhisgfpgkqycprmakmnKPIYTAikqhspekpvMIFVSSRRQTRLTAIDLITILAcetnpkmwvhtsdaemDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKlaalsskenqnvinrstsangnfdfnr
DVALTELVKLLIidevhllhgdrGPVIEALVARTLRQIGQEvfkgvkslnRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIrggsenvhGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGyqspilkpdilnkiEQRGLTVEDLREMPAKEISymlrdphvgdKVKQCAWEIPLLEIESKLLPITRTVLKIHLTikanfswndknksTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLImtiplsdplpNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKkvveltgdvtpdiqaissasvivttpekwdgvsrswqnRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNfissytkrnvRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAikqhspekpVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALsskenqnvinrstsangnfdfnr
DVALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTiafgigfhhaaaeaaqssaLQMPKLAALSSKENQNVINRSTSANGNFDFNR
***LTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAA****************************************
*VALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQ*****NAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPEL*PPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEM******IKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALSSKENQNVINRSTSANGNFDFN*
DVALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALSSKENQNVINRSTSANGNFDFNR
DVALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALSSKENQNVINRSTSANGNFDFNR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DVALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQEVFKGVKSLNRIQSLVYDTAYHTNENLLICAPTGAGKTNVAMLTIAHQIKQHISQGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFTEHMTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALSSKENQNVINRSTSANGNFDFNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1034 2.2.26 [Sep-21-2011]
F1NTD6 2211 Activating signal cointeg yes N/A 0.770 0.360 0.582 0.0
E1BNG3 2201 Activating signal cointeg yes N/A 0.772 0.363 0.579 0.0
E9PZJ8 2198 Activating signal cointeg yes N/A 0.770 0.362 0.578 0.0
Q8N3C0 2202 Activating signal cointeg yes N/A 0.772 0.362 0.576 0.0
F1LPQ2 2197 Activating signal cointeg yes N/A 0.771 0.363 0.558 0.0
E7F8F4 1534 Activating signal cointeg yes N/A 0.735 0.496 0.547 0.0
Q54G57 2195 Activating signal cointeg yes N/A 0.764 0.360 0.478 0.0
O60072 1935 Putative helicase mug81 O yes N/A 0.766 0.409 0.463 0.0
O75643 2136 U5 small nuclear ribonucl no N/A 0.766 0.371 0.414 0.0
P53327 1967 Antiviral helicase SLH1 O yes N/A 0.766 0.403 0.427 0.0
>sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 Back     alignment and function desciption
 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/840 (58%), Positives = 623/840 (74%), Gaps = 43/840 (5%)

Query: 155  KGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIP 214
            KGT++Y AK G +V +GILDV+QIFGRAGRPQ++  G   IIT H+KL+HYL+LLT Q P
Sbjct: 835  KGTQIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQQNP 894

Query: 215  IESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNIDE 274
            IES F+ +LA                                 DNLNAE+ALGT+ N++E
Sbjct: 895  IESQFLESLA---------------------------------DNLNAEIALGTVTNVEE 921

Query: 275  AVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFNMR 334
            AV+W+SY+YL+VRMR NP  YGIS+     DP L +HR  L+    + LDKA MIRF  R
Sbjct: 922  AVKWISYTYLYVRMRANPLVYGISHKAYQMDPGLEKHREQLVIEVGRKLDKARMIRFEER 981

Query: 335  TRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELH 394
            T   + TDLGRTAS+YYIK+N IE F E       +  IL+++S+A EFEQ+KVR+EE+ 
Sbjct: 982  TGFFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEGDILAIVSKAEEFEQIKVREEEIE 1041

Query: 395  ELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRA 454
            ELD L  + CE+P  GG EN +GK+NILLQT +SRG ++SFSL+SD  YV QN  RI+RA
Sbjct: 1042 ELDTLLNDFCELPAPGGVENNYGKINILLQTYISRGELDSFSLISDSAYVAQNAARIVRA 1101

Query: 455  LFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIE 514
            LFEI L +    M  R L  + + + + W   +PLRQ            +L P +L+K+E
Sbjct: 1102 LFEIALRKRWPAMTYRLLNLSKVIDKRLWGWVSPLRQFS----------VLPPSVLSKLE 1151

Query: 515  QRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHLTI 574
            ++ LTV+ +++M   EI +ML    +G KVKQC  +IP + +E+ + PITRTVL++ L I
Sbjct: 1152 EKNLTVDKMKDMRKDEIGHMLHHVKIGLKVKQCVHQIPSIAMEATIQPITRTVLRVRLNI 1211

Query: 575  KANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDP 634
              +F+WND+   T  EP+WIWVEDP +D IYHSEYF++ KKQVITK  + L+ TIP+ +P
Sbjct: 1212 TPDFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFIIQKKQVITKEPQLLVFTIPIFEP 1271

Query: 635  LPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLY 694
            LP+QY IRA+SDR+LG+     ++F+HLI+PE HPPHT LL+LQPLPV+AL  P+YE LY
Sbjct: 1272 LPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPVTALGHPEYEVLY 1331

Query: 695  KFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLK 754
            KF+HFNPIQTQIFH LYHTD NVLLGAPTGSGKT+AAE+  FRVF + P +K VYIAPLK
Sbjct: 1332 KFTHFNPIQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLK 1391

Query: 755  ALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQNRN 814
            ALV+ER+ DWKV+ E +L KKVVELTGDVTPD++AI+ A +IVTTPEKWDGVSRSWQNR+
Sbjct: 1392 ALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIAQADLIVTTPEKWDGVSRSWQNRS 1451

Query: 815  YVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATW 874
            YVQ V+++IIDEIHLLG++RGPVLEVIVSR NFISS+T++ VR+VGLSTALANA+DLA W
Sbjct: 1452 YVQKVSILIIDEIHLLGDERGPVLEVIVSRTNFISSHTEKPVRVVGLSTALANARDLADW 1511

Query: 875  LNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFV 934
            LNI + G++NFRPSVRPVPLEVHI GFPG+ YCPRMA+MNKP + AI+ HSP KPV+IFV
Sbjct: 1512 LNINQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMARMNKPAFQAIRSHSPAKPVLIFV 1571

Query: 935  SSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAA 994
            SSRRQTRLT++DLI  LA E +PK W+   + EM++I+  ++DSNLKLT+AFGIG HHA 
Sbjct: 1572 SSRRQTRLTSLDLIAFLATEDDPKQWLKMDEREMNDIIGTVRDSNLKLTLAFGIGMHHAG 1631
3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for alkhb3, enabling alkhb3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 Back     alignment and function description
>sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=2 SV=1 Back     alignment and function description
>sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 Back     alignment and function description
>sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=2 SV=1 Back     alignment and function description
>sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 Back     alignment and function description
>sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 Back     alignment and function description
>sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 Back     alignment and function description
>sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 Back     alignment and function description
>sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1034
242020386 2141 activating signal cointegrator 1 complex 0.772 0.373 0.628 0.0
347965554 2181 AGAP001234-PA [Anopheles gambiae str. PE 0.770 0.365 0.620 0.0
170042848 2157 activating signal cointegrator 1 complex 0.772 0.370 0.617 0.0
312372488 1301 hypothetical protein AND_20103 [Anophele 0.769 0.611 0.619 0.0
345493191 2130 PREDICTED: activating signal cointegrato 0.772 0.375 0.612 0.0
307166155 2124 Activating signal cointegrator 1 complex 0.771 0.375 0.610 0.0
332027148 2120 Activating signal cointegrator 1 complex 0.771 0.376 0.612 0.0
307197874 2132 Activating signal cointegrator 1 complex 0.771 0.374 0.604 0.0
350406996 2121 PREDICTED: activating signal cointegrato 0.774 0.377 0.601 0.0
322779508 1232 hypothetical protein SINV_16605 [Solenop 0.773 0.649 0.605 0.0
>gi|242020386|ref|XP_002430636.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Pediculus humanus corporis] gi|212515808|gb|EEB17898.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 1111 bits (2874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/842 (62%), Positives = 645/842 (76%), Gaps = 43/842 (5%)

Query: 153  MTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQ 212
            + +GTE+Y+AKHG +V +GILDVLQIFGRAGRPQ++TSGH  IIT H+KL+HYLSLLT+Q
Sbjct: 794  IIRGTEIYDAKHGSFVDLGILDVLQIFGRAGRPQFDTSGHGIIITSHDKLSHYLSLLTDQ 853

Query: 213  IPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNI 272
             PIESNF                              INF   LADNLNAE+ALGTI N+
Sbjct: 854  FPIESNF------------------------------INF---LADNLNAEIALGTISNV 880

Query: 273  DEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFN 332
            +EAV WLSY++L VRM++NP  YGI+Y++V  DP LI  R   I   A+ LDKA MIR+N
Sbjct: 881  EEAVEWLSYTFLFVRMKVNPLVYGITYNDVQNDPLLITKRQEWIHAVAKALDKARMIRYN 940

Query: 333  MRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEE 392
             RT DL ITDLGRTAS++YIK++ +E+F E M  ++ D  +L++I+ AHEF+QLKVRD+E
Sbjct: 941  ERTEDLNITDLGRTASHFYIKYDTVEIFNEMMKTIMTDSEVLNLIAHAHEFQQLKVRDDE 1000

Query: 393  LHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRII 452
            + ELD LT++ C + + GGSEN+HGK+NILLQT LS GR++SFSL+SD  Y+ QN IRII
Sbjct: 1001 MDELDQLTRDYCPLEVMGGSENLHGKINILLQTYLSCGRIDSFSLISDQAYIIQNAIRII 1060

Query: 453  RALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNK 512
            RALF+I L +  AIM +RFL  + + E + W  ++PL+Q     N          DIL K
Sbjct: 1061 RALFDIALRKKQAIMTSRFLLMSKLLELQMWETDSPLKQFGFFGN----------DILGK 1110

Query: 513  IEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHL 572
            +E + L+VE LREM  +EI  M+R+P  G  V+  A+EIPLL++ES L PITRTVL+I L
Sbjct: 1111 LEAKNLSVEKLREMDHREIGAMIRNPKYGKIVQNKAFEIPLLKLESVLQPITRTVLRIRL 1170

Query: 573  TIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLS 632
             I A+F WNDK      EPFWIW+EDP+S+FIYHSEYFL++KKQVI   E+ LIMTIP+S
Sbjct: 1171 KISADFKWNDKVHGKTTEPFWIWIEDPNSNFIYHSEYFLITKKQVIKNEEQELIMTIPIS 1230

Query: 633  DPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYES 692
            +PLP+QY ++ +SDR+LGS +  ++SF +LI+PE HPPHT+LL LQPLPVS L  P  E 
Sbjct: 1231 EPLPSQYYVKVVSDRWLGSDMTEALSFLNLILPETHPPHTDLLPLQPLPVSVLDDPALEK 1290

Query: 693  LYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAP 752
            LYKFSHFN IQTQIFHCLYHTD NVLLGAPTGSGKT+ AEI  FRVF+  P AKVVYIAP
Sbjct: 1291 LYKFSHFNSIQTQIFHCLYHTDKNVLLGAPTGSGKTVVAEIAMFRVFRVYPGAKVVYIAP 1350

Query: 753  LKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSWQN 812
            LKALV+ER+ DWK++ E  LK+KVVELTGDV+PD++AI++A VIVTTPEKWDG+SRSWQ 
Sbjct: 1351 LKALVRERMEDWKIRLEKNLKRKVVELTGDVSPDVKAINAADVIVTTPEKWDGISRSWQT 1410

Query: 813  RNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLA 872
            RNYV+ VALIIIDEIHLLGEDRGPVLEVIVSR NFISSYT    R+VGLSTALANAKDLA
Sbjct: 1411 RNYVRKVALIIIDEIHLLGEDRGPVLEVIVSRTNFISSYTTNRFRVVGLSTALANAKDLA 1470

Query: 873  TWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMI 932
             WL I + G+YNFRPSVRPVPLEVHISGFPGK YCPRMA MN+P + AI+QHSP +P ++
Sbjct: 1471 DWLGIGQMGLYNFRPSVRPVPLEVHISGFPGKHYCPRMATMNRPTFQAIRQHSPVQPALV 1530

Query: 933  FVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHH 992
            FVSSRRQTRLTA+DLI  LA E NPK W+H  + EMD I+ N KDSNLKLT+AFGIG HH
Sbjct: 1531 FVSSRRQTRLTALDLIAYLAGEDNPKQWLHMKEEEMDQIILNTKDSNLKLTLAFGIGMHH 1590

Query: 993  AA 994
            A 
Sbjct: 1591 AG 1592

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347965554|ref|XP_321922.5| AGAP001234-PA [Anopheles gambiae str. PEST] gi|333470458|gb|EAA01788.6| AGAP001234-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170042848|ref|XP_001849123.1| activating signal cointegrator 1 complex subunit 3 [Culex quinquefasciatus] gi|167866280|gb|EDS29663.1| activating signal cointegrator 1 complex subunit 3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312372488|gb|EFR20440.1| hypothetical protein AND_20103 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|345493191|ref|XP_001605046.2| PREDICTED: activating signal cointegrator 1 complex subunit 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307166155|gb|EFN60404.1| Activating signal cointegrator 1 complex subunit 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332027148|gb|EGI67241.1| Activating signal cointegrator 1 complex subunit 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307197874|gb|EFN78973.1| Activating signal cointegrator 1 complex subunit 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350406996|ref|XP_003487948.1| PREDICTED: activating signal cointegrator 1 complex subunit 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322779508|gb|EFZ09700.1| hypothetical protein SINV_16605 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1034
UNIPROTKB|F1NTD6 2211 ascc3 "Activating signal coint 0.698 0.326 0.601 1.8e-300
MGI|MGI:1925237 2198 Ascc3 "activating signal coint 0.698 0.328 0.595 7.1e-297
UNIPROTKB|E1BNG3 2201 ascc3 "Activating signal coint 0.698 0.328 0.598 1.2e-296
UNIPROTKB|F6Y2F0 2202 ASCC3 "Uncharacterized protein 0.698 0.327 0.594 2.1e-295
UNIPROTKB|Q8N3C0 2202 ASCC3 "Activating signal coint 0.698 0.327 0.596 2.1e-295
UNIPROTKB|E2QVY0 1925 ASCC3 "Uncharacterized protein 0.698 0.375 0.594 2.1e-295
FB|FBgn0038344 2183 CG5205 [Drosophila melanogaste 0.697 0.330 0.601 2e-292
RGD|1307995 2197 Ascc3 "activating signal coint 0.697 0.328 0.573 6.1e-287
DICTYBASE|DDB_G0290389 2195 ascc3 "activating signal coint 0.693 0.326 0.489 5.5e-239
ASPGD|ASPL0000044033 2015 AN2482 [Emericella nidulans (t 0.693 0.355 0.487 1.2e-234
UNIPROTKB|F1NTD6 ascc3 "Activating signal cointegrator 1 complex subunit 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 2337 (827.7 bits), Expect = 1.8e-300, Sum P(3) = 1.8e-300
 Identities = 440/732 (60%), Positives = 563/732 (76%)

Query:   252 FVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQH 311
             F+ +LADNLNAE+ALGT+ N++EAV+W+SY+YL+VRMR NP  YGIS+     DP L +H
Sbjct:   899 FLESLADNLNAEIALGTVTNVEEAVKWISYTYLYVRMRANPLVYGISHKAYQMDPGLEKH 958

Query:   312 RTTLIENAAQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDV 371
             R  L+    + LDKA MIRF  RT   + TDLGRTAS+YYIK+N IE F E       + 
Sbjct:   959 REQLVIEVGRKLDKARMIRFEERTGFFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEG 1018

Query:   372 GILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGR 431
              IL+++S+A EFEQ+KVR+EE+ ELD L  + CE+P  GG EN +GK+NILLQT +SRG 
Sbjct:  1019 DILAIVSKAEEFEQIKVREEEIEELDTLLNDFCELPAPGGVENNYGKINILLQTYISRGE 1078

Query:   432 VNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQ 491
             ++SFSL+SD  YV QN  RI+RALFEI L +    M  R L  + + + + W   +PLRQ
Sbjct:  1079 LDSFSLISDSAYVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWVSPLRQ 1138

Query:   492 IKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEI 551
                         +L P +L+K+E++ LTV+ +++M   EI +ML    +G KVKQC  +I
Sbjct:  1139 FS----------VLPPSVLSKLEEKNLTVDKMKDMRKDEIGHMLHHVKIGLKVKQCVHQI 1188

Query:   552 PLLEIESKLLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFL 611
             P + +E+ + PITRTVL++ L I  +F+WND+   T  EP+WIWVEDP +D IYHSEYF+
Sbjct:  1189 PSIAMEATIQPITRTVLRVRLNITPDFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFI 1248

Query:   612 LSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPH 671
             + KKQVITK  + L+ TIP+ +PLP+QY IRA+SDR+LG+     ++F+HLI+PE HPPH
Sbjct:  1249 IQKKQVITKEPQLLVFTIPIFEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPH 1308

Query:   672 TNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAA 731
             T LL+LQPLPV+AL  P+YE LYKF+HFNPIQTQIFH LYHTD NVLLGAPTGSGKT+AA
Sbjct:  1309 TELLDLQPLPVTALGHPEYEVLYKFTHFNPIQTQIFHTLYHTDCNVLLGAPTGSGKTVAA 1368

Query:   732 EITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAIS 791
             E+  FRVF + P +K VYIAPLKALV+ER+ DWKV+ E +L KKVVELTGDVTPD++AI+
Sbjct:  1369 ELAIFRVFNKYPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIA 1428

Query:   792 SASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSY 851
              A +IVTTPEKWDGVSRSWQNR+YVQ V+++IIDEIHLLG++RGPVLEVIVSR NFISS+
Sbjct:  1429 QADLIVTTPEKWDGVSRSWQNRSYVQKVSILIIDEIHLLGDERGPVLEVIVSRTNFISSH 1488

Query:   852 TKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMA 911
             T++ VR+VGLSTALANA+DLA WLNI + G++NFRPSVRPVPLEVHI GFPG+ YCPRMA
Sbjct:  1489 TEKPVRVVGLSTALANARDLADWLNINQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMA 1548

Query:   912 KMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNI 971
             +MNKP + AI+ HSP KPV+IFVSSRRQTRLT++DLI  LA E +PK W+   + EM++I
Sbjct:  1549 RMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTSLDLIAFLATEDDPKQWLKMDEREMNDI 1608

Query:   972 VDNIKDSNLKLT 983
             +  ++DSNLKLT
Sbjct:  1609 IGTVRDSNLKLT 1620
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006307 "DNA dealkylation involved in DNA repair" evidence=ISS
GO:0008283 "cell proliferation" evidence=ISS
GO:0032508 "DNA duplex unwinding" evidence=ISS
GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=ISS
MGI|MGI:1925237 Ascc3 "activating signal cointegrator 1 complex subunit 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNG3 ascc3 "Activating signal cointegrator 1 complex subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y2F0 ASCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N3C0 ASCC3 "Activating signal cointegrator 1 complex subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVY0 ASCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0038344 CG5205 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1307995 Ascc3 "activating signal cointegrator 1 complex subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290389 ascc3 "activating signal cointegrator 1 complex subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044033 AN2482 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
E7F8F4ASCC3_DANRE3, ., 6, ., 4, ., 1, 20.54760.73590.4960yesN/A
F1NTD6ASCC3_CHICK3, ., 6, ., 4, ., 1, 20.58210.77070.3604yesN/A
Q8N3C0ASCC3_HUMAN3, ., 6, ., 4, ., 1, 20.57600.77270.3628yesN/A
F1LPQ2ASCC3_RAT3, ., 6, ., 4, ., 1, 20.55810.77170.3632yesN/A
E9PZJ8ASCC3_MOUSE3, ., 6, ., 4, ., 1, 20.57850.77070.3626yesN/A
E1BNG3ASCC3_BOVIN3, ., 6, ., 4, ., 1, 20.57950.77270.3630yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1034
pfam02889309 pfam02889, Sec63, Sec63 Brl domain 4e-91
smart00611312 smart00611, SEC63, Domain of unknown function in S 3e-82
smart00973314 smart00973, Sec63, Sec63 Brl domain 9e-81
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 1e-51
COG1204766 COG1204, COG1204, Superfamily II helicase [General 1e-36
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-29
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 2e-25
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 5e-24
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-23
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 1e-20
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 9e-20
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 1e-18
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 7e-16
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 4e-13
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 4e-09
COG1204766 COG1204, COG1204, Superfamily II helicase [General 6e-09
COG1205 851 COG1205, COG1205, Distinct helicase family with a 1e-07
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 1e-06
COG1204766 COG1204, COG1204, Superfamily II helicase [General 5e-06
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 7e-06
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 3e-05
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-05
COG1111 542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 7e-05
COG1204766 COG1204, COG1204, Superfamily II helicase [General 1e-04
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-04
PRK00254720 PRK00254, PRK00254, ski2-like helicase; Provisiona 0.001
smart00611312 smart00611, SEC63, Domain of unknown function in S 0.003
COG1203 733 COG1203, COG1203, CRISPR-associated helicase Cas3 0.003
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 0.003
>gnl|CDD|217270 pfam02889, Sec63, Sec63 Brl domain Back     alignment and domain information 
 Score =  292 bits (751), Expect = 4e-91
 Identities = 123/324 (37%), Positives = 188/324 (58%), Gaps = 21/324 (6%)

Query: 341 TDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLT 400
           T+LGR AS+YYI +  +E F   +        +L ++S A EFE++ VR+EE  EL  L 
Sbjct: 2   TELGRIASHYYILYETMETFNTSLKPNTTLKDLLEILSSASEFEEIPVREEEKKELKKL- 60

Query: 401 QECCEIPIRGGS-ENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEIT 459
            E   IP++  S ++ H KVN+LLQ  LSR ++  FSLVSDL Y+ QN  R++RALFEI 
Sbjct: 61  LERVPIPVKSPSIDDPHAKVNLLLQAYLSRLKLPDFSLVSDLNYILQNAGRLLRALFEIA 120

Query: 460 LHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRG-L 518
           L +     A   L+ + M E + WP ++PLRQ+  +           P++L K+E++G  
Sbjct: 121 LSKGWLSPALNALELSKMIEQRLWPSDSPLRQLPHIP----------PEVLKKLEKKGIS 170

Query: 519 TVEDLREMPAKEISYMLR-DPHVGDKVKQCAWEIPLLEIESKLLPITRTV-LKIHLTIKA 576
           ++EDL ++  +E+  +L  +P  G  + +     P LEIE+++ PITR V L++ +T+  
Sbjct: 171 SLEDLMDLDPEELGELLGNNPKQGKDIAEFVNRFPRLEIEAEVQPITREVSLRVEVTLTR 230

Query: 577 NFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLS-DPL 635
           +F W+++     +E FWI VED D++ +   E F L+KK    K E  L  T+PLS  PL
Sbjct: 231 DFEWDER-FHGKSEGFWIVVEDSDNNELLAIERFTLNKK----KDEHELEFTVPLSGGPL 285

Query: 636 PNQYLIRAMSDRYLGSVVQHSMSF 659
           P Q  IR +SD +LG   +  +S 
Sbjct: 286 PPQLTIRLVSDSWLGCDQEVPVSL 309

This domain (also known as the Brl domain) is required for assembly of functional endoplasmic reticulum translocons. Length = 309
>gnl|CDD|214744 smart00611, SEC63, Domain of unknown function in Sec63p, Brr2p and other proteins Back     alignment and domain information
>gnl|CDD|214946 smart00973, Sec63, Sec63 Brl domain Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|214744 smart00611, SEC63, Domain of unknown function in Sec63p, Brr2p and other proteins Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1034
KOG0952|consensus1230 100.0
KOG0951|consensus 1674 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
smart00611312 SEC63 Domain of unknown function in Sec63p, Brr2p 100.0
KOG0952|consensus 1230 100.0
PF02889314 Sec63: Sec63 Brl domain; InterPro: IPR004179 This 100.0
KOG0951|consensus 1674 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
KOG0950|consensus1008 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0330|consensus 476 100.0
KOG0331|consensus 519 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338|consensus 691 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0340|consensus 442 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0333|consensus673 100.0
KOG0345|consensus 567 100.0
KOG0328|consensus400 100.0
KOG0342|consensus 543 100.0
KOG0348|consensus 708 100.0
KOG0343|consensus 758 99.98
KOG0335|consensus482 99.98
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.97
KOG0326|consensus459 99.97
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.97
KOG0339|consensus 731 99.97
KOG0947|consensus 1248 99.97
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.97
KOG0336|consensus629 99.97
KOG0341|consensus 610 99.97
COG1205 851 Distinct helicase family with a unique C-terminal 99.97
KOG0350|consensus 620 99.96
KOG0948|consensus 1041 99.96
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.96
KOG0334|consensus 997 99.96
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
KOG0346|consensus 569 99.96
KOG0332|consensus477 99.96
KOG0347|consensus 731 99.95
PRK10689 1147 transcription-repair coupling factor; Provisional 99.95
KOG0947|consensus1248 99.95
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.95
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.95
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.95
KOG0344|consensus 593 99.95
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.95
KOG4284|consensus 980 99.94
KOG0950|consensus 1008 99.94
KOG0327|consensus397 99.94
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.94
KOG0337|consensus 529 99.94
KOG0948|consensus1041 99.94
PRK09401 1176 reverse gyrase; Reviewed 99.93
KOG0351|consensus 941 99.93
KOG0352|consensus 641 99.93
PRK14701 1638 reverse gyrase; Provisional 99.92
PHA02558501 uvsW UvsW helicase; Provisional 99.92
KOG0353|consensus 695 99.92
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.91
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.91
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.91
PHA02653 675 RNA helicase NPH-II; Provisional 99.91
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.9
PRK09694 878 helicase Cas3; Provisional 99.89
KOG0354|consensus 746 99.88
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.87
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.87
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.87
PRK13766 773 Hef nuclease; Provisional 99.86
KOG0329|consensus387 99.86
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.86
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.86
PRK05580 679 primosome assembly protein PriA; Validated 99.86
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.83
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.83
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.82
KOG0949|consensus 1330 99.82
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.81
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.81
KOG0349|consensus 725 99.8
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.8
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.8
KOG4434|consensus520 99.79
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.77
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.76
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.76
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.72
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.71
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.68
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.68
PRK04914 956 ATP-dependent helicase HepA; Validated 99.67
smart00487201 DEXDc DEAD-like helicases superfamily. 99.64
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.62
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.59
PRK13767876 ATP-dependent helicase; Provisional 99.57
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.56
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.56
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.56
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.55
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.54
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.51
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.51
COG4096 875 HsdR Type I site-specific restriction-modification 99.51
KOG0922|consensus 674 99.5
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.5
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.49
COG1201814 Lhr Lhr-like helicases [General function predictio 99.46
KOG4150|consensus 1034 99.38
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.34
KOG1123|consensus 776 99.28
KOG0920|consensus 924 99.28
KOG0923|consensus 902 99.27
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.25
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.21
KOG0953|consensus 700 99.18
KOG0924|consensus 1042 99.17
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.17
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.13
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.08
KOG0949|consensus1330 99.07
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.06
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.04
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.02
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.99
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.99
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.97
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.95
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.93
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.9
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.89
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.89
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.89
PTZ00424401 helicase 45; Provisional 98.87
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 98.87
KOG0926|consensus 1172 98.87
PRK05298 652 excinuclease ABC subunit B; Provisional 98.85
COG4889 1518 Predicted helicase [General function prediction on 98.85
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 98.83
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.81
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.81
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.8
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.75
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 98.74
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.73
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.73
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.73
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 98.71
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.7
KOG0925|consensus 699 98.68
KOG0390|consensus 776 98.66
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 98.66
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.64
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.64
PRK14873 665 primosome assembly protein PriA; Provisional 98.62
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 98.62
KOG0953|consensus700 98.6
KOG1000|consensus 689 98.6
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.58
KOG0385|consensus 971 98.55
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.54
PTZ00110545 helicase; Provisional 98.41
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 98.41
PRK15483 986 type III restriction-modification system StyLTI en 98.36
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.35
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 98.32
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.31
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.31
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.3
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 98.2
PHA02653675 RNA helicase NPH-II; Provisional 98.19
KOG0922|consensus674 98.15
KOG0387|consensus 923 98.04
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.03
PRK106891147 transcription-repair coupling factor; Provisional 98.02
KOG1002|consensus 791 98.02
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.0
KOG0923|consensus902 97.96
KOG0384|consensus 1373 97.96
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 97.9
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.9
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.88
KOG4439|consensus 901 97.86
KOG1802|consensus 935 97.79
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.78
KOG0389|consensus 941 97.77
COG0610 962 Type I site-specific restriction-modification syst 97.73
KOG0392|consensus 1549 97.72
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.68
COG1205851 Distinct helicase family with a unique C-terminal 97.62
KOG0326|consensus459 97.51
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.49
PF1324576 AAA_19: Part of AAA domain 97.43
PRK10536262 hypothetical protein; Provisional 97.41
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 97.4
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.39
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 97.36
KOG0924|consensus1042 97.33
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 97.21
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.15
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.11
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 97.07
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 97.06
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.03
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.01
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.95
PRK10875 615 recD exonuclease V subunit alpha; Provisional 96.83
KOG1803|consensus 649 96.82
KOG2340|consensus698 96.8
KOG0920|consensus924 96.78
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 96.78
COG4098441 comFA Superfamily II DNA/RNA helicase required for 96.76
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.75
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.75
KOG0330|consensus476 96.72
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.7
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 96.66
COG1200677 RecG RecG-like helicase [DNA replication, recombin 96.65
KOG0343|consensus758 96.63
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.63
smart0049082 HELICc helicase superfamily c-terminal domain. 96.63
KOG0391|consensus 1958 96.62
TIGR00595505 priA primosomal protein N'. All proteins in this f 96.62
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.61
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.56
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.55
PHA02558501 uvsW UvsW helicase; Provisional 96.52
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.42
KOG1132|consensus 945 96.4
smart0049082 HELICc helicase superfamily c-terminal domain. 96.27
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.23
PRK09694878 helicase Cas3; Provisional 96.15
PHA02533 534 17 large terminase protein; Provisional 96.13
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 96.1
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.06
KOG0345|consensus567 95.99
KOG0921|consensus 1282 95.87
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 95.86
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.84
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.83
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.63
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 95.57
PRK06526254 transposase; Provisional 95.54
COG11971139 Mfd Transcription-repair coupling factor (superfam 95.49
KOG1805|consensus1100 95.44
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.44
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.41
smart00382148 AAA ATPases associated with a variety of cellular 95.34
KOG0298|consensus 1394 95.34
PHA03368 738 DNA packaging terminase subunit 1; Provisional 95.3
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 95.3
KOG0388|consensus 1185 95.28
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 95.19
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.13
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.13
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.11
KOG0328|consensus400 95.06
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.05
KOG0342|consensus543 94.93
PRK14974336 cell division protein FtsY; Provisional 94.92
PRK04296190 thymidine kinase; Provisional 94.9
PRK08181269 transposase; Validated 94.89
KOG0386|consensus 1157 94.88
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 94.87
KOG4150|consensus1034 94.83
KOG0989|consensus346 94.76
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.76
PRK05298652 excinuclease ABC subunit B; Provisional 94.71
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.66
PHA03333 752 putative ATPase subunit of terminase; Provisional 94.65
PRK13833323 conjugal transfer protein TrbB; Provisional 94.58
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.56
PRK06893229 DNA replication initiation factor; Validated 94.5
PRK11054 684 helD DNA helicase IV; Provisional 94.48
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.48
PF00004132 AAA: ATPase family associated with various cellula 94.45
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.44
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.43
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.42
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 94.42
PRK08727233 hypothetical protein; Validated 94.36
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 94.35
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.35
KOG1015|consensus 1567 94.3
PRK07952244 DNA replication protein DnaC; Validated 94.3
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.26
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.23
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.18
PRK12377248 putative replication protein; Provisional 94.18
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 94.15
PRK00149450 dnaA chromosomal replication initiation protein; R 94.11
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.08
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.01
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 94.0
PLN03025319 replication factor C subunit; Provisional 93.97
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.85
PRK14087450 dnaA chromosomal replication initiation protein; P 93.81
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 93.8
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.78
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 93.62
KOG0351|consensus941 93.61
PTZ001121164 origin recognition complex 1 protein; Provisional 93.52
CHL00181287 cbbX CbbX; Provisional 93.51
KOG0925|consensus699 93.47
PRK12402337 replication factor C small subunit 2; Reviewed 93.46
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 93.44
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.31
PRK08084235 DNA replication initiation factor; Provisional 93.31
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.27
PRK14088440 dnaA chromosomal replication initiation protein; P 93.24
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.2
PRK05707328 DNA polymerase III subunit delta'; Validated 93.14
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.09
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 93.01
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 93.01
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.0
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 92.86
KOG0335|consensus482 92.77
KOG4284|consensus980 92.71
KOG1001|consensus 674 92.7
PRK05642234 DNA replication initiation factor; Validated 92.68
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.58
KOG0331|consensus519 92.51
KOG0991|consensus333 92.46
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 92.43
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.34
PRK05973237 replicative DNA helicase; Provisional 92.3
PRK04328249 hypothetical protein; Provisional 92.29
PRK06921266 hypothetical protein; Provisional 92.18
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 92.16
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 92.16
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.15
PRK09200790 preprotein translocase subunit SecA; Reviewed 92.15
PRK12766232 50S ribosomal protein L32e; Provisional 92.14
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 92.08
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.99
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 91.95
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 91.87
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 91.82
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 91.8
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 91.79
PRK14086617 dnaA chromosomal replication initiation protein; P 91.67
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 91.63
PRK11823446 DNA repair protein RadA; Provisional 91.63
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 91.61
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 91.59
COG0593408 DnaA ATPase involved in DNA replication initiation 91.5
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 91.47
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 91.46
PRK07004460 replicative DNA helicase; Provisional 91.45
PRK05748448 replicative DNA helicase; Provisional 91.44
PRK05636505 replicative DNA helicase; Provisional 91.43
PRK08506472 replicative DNA helicase; Provisional 91.4
COG1484254 DnaC DNA replication protein [DNA replication, rec 91.38
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.33
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 91.31
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 91.28
PRK13851344 type IV secretion system protein VirB11; Provision 91.26
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.23
PRK13342413 recombination factor protein RarA; Reviewed 91.11
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 91.11
KOG0332|consensus477 91.09
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.08
PRK06067234 flagellar accessory protein FlaH; Validated 90.97
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 90.93
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.91
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 90.9
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 90.88
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 90.79
KOG0333|consensus673 90.72
TIGR00665434 DnaB replicative DNA helicase. This model describe 90.7
PRK09165497 replicative DNA helicase; Provisional 90.69
KOG0353|consensus695 90.66
PRK12422445 chromosomal replication initiation protein; Provis 90.6
PRK08116268 hypothetical protein; Validated 90.58
PRK08533230 flagellar accessory protein FlaH; Reviewed 90.51
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 90.47
PRK04914956 ATP-dependent helicase HepA; Validated 90.43
PRK08769319 DNA polymerase III subunit delta'; Validated 90.34
KOG0336|consensus629 90.32
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 90.3
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 90.27
PRK06904472 replicative DNA helicase; Validated 90.12
KOG1131|consensus 755 90.1
PRK00440319 rfc replication factor C small subunit; Reviewed 90.09
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 90.06
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 90.05
TIGR02012321 tigrfam_recA protein RecA. This model describes or 90.04
PRK08760476 replicative DNA helicase; Provisional 90.0
PRK00771437 signal recognition particle protein Srp54; Provisi 90.0
PHA02542473 41 41 helicase; Provisional 89.94
PRK06321472 replicative DNA helicase; Provisional 89.94
KOG1133|consensus 821 89.93
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 89.93
PRK04195 482 replication factor C large subunit; Provisional 89.62
PRK04301317 radA DNA repair and recombination protein RadA; Va 89.5
PRK13341 725 recombination factor protein RarA/unknown domain f 89.5
cd00983325 recA RecA is a bacterial enzyme which has roles in 89.37
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 89.2
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 89.19
PHA02544316 44 clamp loader, small subunit; Provisional 89.16
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 89.06
PRK09354349 recA recombinase A; Provisional 88.95
KOG0926|consensus1172 88.89
PF05729166 NACHT: NACHT domain 88.86
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 88.79
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 88.73
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.72
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 88.67
PRK10416318 signal recognition particle-docking protein FtsY; 88.65
COG0556663 UvrB Helicase subunit of the DNA excision repair c 88.48
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 88.47
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 88.46
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 88.45
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 88.43
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 88.36
PRK08006471 replicative DNA helicase; Provisional 88.23
PRK05595444 replicative DNA helicase; Provisional 88.16
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 87.96
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.96
PRK13766773 Hef nuclease; Provisional 87.89
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 87.88
KOG2228|consensus408 87.81
TIGR02237209 recomb_radB DNA repair and recombination protein R 87.77
COG0552340 FtsY Signal recognition particle GTPase [Intracell 87.65
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 87.61
PRK08840464 replicative DNA helicase; Provisional 87.5
PRK06964342 DNA polymerase III subunit delta'; Validated 87.49
KOG0739|consensus439 87.42
PRK09112351 DNA polymerase III subunit delta'; Validated 87.4
PHA03372 668 DNA packaging terminase subunit 1; Provisional 87.29
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 87.22
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 87.22
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 87.21
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 87.19
cd01393226 recA_like RecA is a bacterial enzyme which has rol 87.0
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 86.96
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 86.83
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 86.82
COG2255332 RuvB Holliday junction resolvasome, helicase subun 86.78
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 86.72
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 86.56
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 86.39
PRK09183259 transposase/IS protein; Provisional 86.29
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 86.12
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 86.05
KOG0344|consensus593 85.93
TIGR0195450 nusA_Cterm_rpt transcription termination factor Nu 85.91
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 85.89
KOG1513|consensus 1300 85.89
KOG2373|consensus514 85.85
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 85.84
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 85.65
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 85.62
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 85.58
PRK07940394 DNA polymerase III subunit delta'; Validated 85.54
PRK06871325 DNA polymerase III subunit delta'; Validated 85.5
KOG2028|consensus554 85.48
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 85.45
TIGR00959428 ffh signal recognition particle protein. This mode 85.36
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 85.28
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 85.25
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 85.13
KOG0339|consensus731 85.12
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 85.08
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 85.06
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 85.05
PRK09361225 radB DNA repair and recombination protein RadB; Pr 85.03
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 84.97
TIGR02236310 recomb_radA DNA repair and recombination protein R 84.9
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 84.88
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 84.6
PRK13897 606 type IV secretion system component VirD4; Provisio 84.47
COG3973 747 Superfamily I DNA and RNA helicases [General funct 84.44
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 84.4
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 84.34
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 84.34
>KOG0952|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.7e-144  Score=1239.45  Aligned_cols=928  Identities=51%  Similarity=0.813  Sum_probs=846.8

Q ss_pred             CccccccccEEEEeeeecccCCCCchHHHHHHhhhhcccc----ceeecccchhh----h----------hhHHHhhccc
Q psy13788          1 DVALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQIGQ----EVFKGVKSLNR----I----------QSLVYDTAYH   62 (1034)
Q Consensus         1 ~~~~~~~v~~vViDEvH~l~d~RG~~le~li~~~~~~~~~----~~~~~~~~~~~----~----------~~~~~~~~~~   62 (1034)
                      |+++.+.|++|||||||||+|+|||++|.+++|++|+++.    .+|+|+|++.+    +          +-+.|+..||
T Consensus       232 d~~l~~~V~LviIDEVHlLhd~RGpvlEtiVaRtlr~vessqs~IRivgLSATlPN~eDvA~fL~vn~~~glfsFd~~yR  311 (1230)
T KOG0952|consen  232 DSALFSLVRLVIIDEVHLLHDDRGPVLETIVARTLRLVESSQSMIRIVGLSATLPNYEDVARFLRVNPYAGLFSFDQRYR  311 (1230)
T ss_pred             chhhhhheeeEEeeeehhhcCcccchHHHHHHHHHHHHHhhhhheEEEEeeccCCCHHHHHHHhcCCCccceeeeccccc
Confidence            5678999999999999999999999999999999998864    67899988443    1          1223567777


Q ss_pred             c------------------------------------CCc--eEEeccCCcchhHHHHHHHHHHHHHH---hhcc--ccc
Q psy13788         63 T------------------------------------NEN--LLICAPTGAGKTNVAMLTIAHQIKQH---ISQG--TEM   99 (1034)
Q Consensus        63 ~------------------------------------~~~--~~v~~~~~~~k~~~~~~~~~~~~~~~---~~~~--~~~   99 (1034)
                      |                                    +.+  |||++|+++.+++..+.+.+....+.   +.+.  ..+
T Consensus       312 PvpL~~~~iG~k~~~~~~~~~~~d~~~~~kv~e~~~~g~qVlvFvhsR~~Ti~tA~~l~~~a~~~g~~~~f~~~~~~k~l  391 (1230)
T KOG0952|consen  312 PVPLTQGFIGIKGKKNRQQKKNIDEVCYDKVVEFLQEGHQVLVFVHSRNETIRTAKKLRERAETNGEKDLFLPSPRNKQL  391 (1230)
T ss_pred             ccceeeeEEeeecccchhhhhhHHHHHHHHHHHHHHcCCeEEEEEecChHHHHHHHHHHHHHHhcCcccccCCChhhHHH
Confidence            5                                    223  55666777777776655544332110   1100  000


Q ss_pred             ee-ccccc-eecchhH-----HHHHHhhh-cCCCccccccccccccchhhhccCcccce-EEEecCceeecCCCCeeeec
Q psy13788        100 YN-AKHGC-YVHIGIL-----DVLQIFGR-AGRPQYNTSDLGRTASNYYIKHNDIELFT-EHMTKGTEMYNAKHGCYVHI  170 (1034)
Q Consensus       100 ~~-~~~g~-~~h~~~~-----~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~gvn~pa-~vii~~~~~~~~~~~~~~~~  170 (1034)
                      .. -++|+ +||||++     -++..|.. ...+.+||+||++          |||||| .||||||+.||++.|++.++
T Consensus       392 ~elf~~g~~iHhAGm~r~DR~l~E~~F~~G~i~vL~cTaTLAw----------GVNLPA~aViIKGT~~ydsskg~f~dl  461 (1230)
T KOG0952|consen  392 KELFQQGMGIHHAGMLRSDRQLVEKEFKEGHIKVLCCTATLAW----------GVNLPAYAVIIKGTQVYDSSKGSFVDL  461 (1230)
T ss_pred             HHHHHhhhhhcccccchhhHHHHHHHHhcCCceEEEecceeee----------ccCCcceEEEecCCcccccccCceeee
Confidence            00 13677 8899998     24556644 3455668888877          899999 99999999999999999999


Q ss_pred             ChhhHHHHhhccCCCCccccceEEEECCcccHHHHHHHhcCCcceecccccchHHHHhhhhhcccccchhhHHHHHHHHH
Q psy13788        171 GILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYI  250 (1034)
Q Consensus       171 ~~~~~~Qm~GRAGR~~~d~~G~~~i~~~~~~~~~y~~~~~~~~~i~s~l~~~~~~~ln~e~~~~~~~~~~~~~~~~~~~~  250 (1034)
                      +++|++||+|||||||||+.|++||||+.+++++|.++++++.||||+|+.+|.|+|||||                   
T Consensus       462 gilDVlQifGRAGRPqFd~~G~giIiTt~dkl~~Y~sLl~~~~piES~~~~~L~dnLnAEi-------------------  522 (1230)
T KOG0952|consen  462 GILDVLQIFGRAGRPQFDSSGEGIIITTRDKLDHYESLLTGQNPIESQLLPCLIDNLNAEI-------------------  522 (1230)
T ss_pred             hHHHHHHHHhccCCCCCCCCceEEEEecccHHHHHHHHHcCCChhHHHHHHHHHHhhhhhe-------------------
Confidence            9999999999999999999999999999999999999999999999999999999999999                   


Q ss_pred             HHHHHHhhhcccchhcccccCHHHHHHHhccccceeecccCccccCCCccccCCChhHHHHHHHHHHHHHHHhhhcCceE
Q psy13788        251 NFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIR  330 (1034)
Q Consensus       251 ~~~~~~~~~il~~i~~~~~~~~~~~~~~l~~T~~~~r~~~~p~~y~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~~~~i~  330 (1034)
                                    ++||++|+++|++||+|||+|+||+|||..||+.++++..||.++.+..++|..++..|.+..||.
T Consensus       523 --------------~LgTVt~VdeAVeWL~yTylYVRm~KNP~~Ygi~~~~l~~dp~l~s~~~~l~~~~~~~L~~~qmi~  588 (1230)
T KOG0952|consen  523 --------------SLGTVTNVDEAVEWLKYTYLYVRMRKNPMAYGISYEELEPDPRLESHRRELCLVAAMELDKVQMIR  588 (1230)
T ss_pred             --------------eeceeecHHHHHHHhhceeEEEEeccChHHhhhhhhcccCCchHHHHHHHHHHHHHHHhhhhheEE
Confidence                          999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCCcccChHHHHHHhhccChHhHHHHHHhcCCCCCHHHHHHhhccccccccCcCChhhhHHHHHHhhhccccCCCC
Q psy13788        331 FNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRG  410 (1034)
Q Consensus       331 ~~~~~~~~~~T~lG~~~s~~yl~~~t~~~~~~~l~~~~~~~~lL~ll~~s~EF~~i~~r~~E~~~l~~l~~~~~~~~~~~  410 (1034)
                      +|..++.+.+|++||+||+|||+++||+.|++..++.+++.++|+++|+|.||+.+++|++|++++++|+...+.....+
T Consensus       589 ~D~~t~~~~stdlGR~aS~yYik~ETme~~nn~~k~~~se~~iL~lis~aeEfs~ik~R~eE~k~l~el~~~~~~~~~~~  668 (1230)
T KOG0952|consen  589 FDERTGYLKSTDLGRVASNYYIKYETMETFNNLPKSFYSEDDILALISMAEEFSQIKVREEEKKELKELNEDSCEKYPFG  668 (1230)
T ss_pred             EecccceEcccchhhhhhhhhhhhHHHHHHHhcccccCCHHHHHHHHHhhHhhhhhhhhhhhHHHHHHHHhccccccccc
Confidence            99999999999999999999999999999999998899999999999999999999999999999999998755544433


Q ss_pred             CCCCcchhHHHHHHHHHhCCCCCCcChHhhHHHHHHhHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHhccCCCCCccc
Q psy13788        411 GSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLR  490 (1034)
Q Consensus       411 ~~~~~~~Kv~~LLqa~i~~~~~~~~~l~gd~~~i~~~a~rll~al~ei~~~~~~~~~~~~~l~L~k~l~~~~w~~~~~L~  490 (1034)
                      .   ...|+++++|+||++..+.+|+|.+|..|+.+|+.||.+++++++...+|+..+..++.||+||+.++|...+||.
T Consensus       669 ~---~~gk~nil~q~~Is~~~~~~f~L~sD~~yv~qna~ri~ralf~i~~~~~~~~~~~~~l~l~k~ier~mw~~~~~l~  745 (1230)
T KOG0952|consen  669 G---EKGKVNILLQAYISRTEVKDFSLMSDSLYVAQNAGRISRALFQIVLRQNWHLLSNRMLNLCKRIERRMWDFFIPLK  745 (1230)
T ss_pred             c---cchhHHHHHHhhhhccceeeeeeccCcccccccHHHHHHHHHHHHHHhCchHHHHHHHHHHHHHHHHHHhhhhhhh
Confidence            3   2899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCCCCCCCHHHHHHHHhcCCCHHHHhcCCHHHHHhhhcCchhHHHHHHHhhcCCcceEEEEEEeeccceEEE
Q psy13788        491 QIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKI  570 (1034)
Q Consensus       491 ql~~~~~~~~~~p~i~~~~~~~L~~~g~t~~~l~~~~~~el~~~l~~~~~g~~i~~~~~~~P~l~~~~~~~pit~~~l~v  570 (1034)
                      |+          +.+..   ++ ++.+.   .+..+..++++.+..+.+.|   .+.+..+|.+++++.++|+|++++++
T Consensus       746 qf----------~~~~~---~~-~~~~~---~l~~L~~~~~g~~w~~~~~~---~k~l~~ip~v~v~a~~~p~t~~vlri  805 (1230)
T KOG0952|consen  746 QF----------TLLLN---RK-ERKKL---TLLLLRKDELGELWHNVPYG---LKQLSGIPLVNVEALIQPITRNVLRI  805 (1230)
T ss_pred             cC----------Ccccc---hh-hhhcc---hHHhhhhhhhccccccCchh---hhhhccCCceehhhhhccchhhhhee
Confidence            99          55444   33 33333   67777888999999888787   89999999999999999999999999


Q ss_pred             EEEEEeCCCCCccCCCCCCCcEEEEEEcCCCCeeEEEeeEEeecccccccCceeEEEEeecCCCCCCceEEEeecccccc
Q psy13788        571 HLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQYLIRAMSDRYLG  650 (1034)
Q Consensus       571 ~l~~~~~~~~~~~~~~~~~e~~~l~v~D~~~~~i~~~~~~~l~~~~~~~~~~~~l~f~vpl~~p~p~~~~i~~~Sd~wlg  650 (1034)
                      .+.++|+|.|+.++||+..+.  +|++|++.+.++|.+.+.+++++.  ++.+.+.|++|+++|+|+++.++..|+.|++
T Consensus       806 ~~~~~~~f~w~~~~hg~~g~~--i~~ed~~~~~i~h~e~~~~~~~~~--~~s~~lvf~ipis~pLps~~~~~~~s~~~l~  881 (1230)
T KOG0952|consen  806 EVAITPDFEWNDGIHGKAGQP--IFKEDSSLLPILHIEVFLVNCKKV--NESQLLVFTIPISDPLPSQIRHRAVSDNWLG  881 (1230)
T ss_pred             eeccCCceEEecccccccCce--eEeecCCCCcceeeeeehhhhhhh--hhhhheeEEeecccCCccceEEeeecccccC
Confidence            999999999999999985444  899999999999999999999886  5789999999999999999999999999999


Q ss_pred             ccccccccccccccCCCCCCCCccccCCCCCCCccCccccccccccCCCChhHHHHHHHHhcCCCcEEEEcCCCChhhHH
Q psy13788        651 SVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIA  730 (1034)
Q Consensus       651 ~e~~~~vs~~~l~~p~~~~~~~~ll~l~~~~~~~l~~~~~~~~~~~~~~~~~Q~~ai~~l~~~~~~vll~apTGsGKT~~  730 (1034)
                      ++...++++.++++|...++.++++++.|++..+|....++..++  .++|.|++.|..+++.+.++++.+|||+|||.+
T Consensus       882 ~e~~~~~s~~~~il~~~~~~~t~ll~l~plp~~~L~~~~~e~~~~--~fn~~q~~if~~~y~td~~~~~g~ptgsgkt~~  959 (1230)
T KOG0952|consen  882 AETVYPLSFQHLILPDNEPPLTELLDLRPLPSSALKNVVFEALYK--YFNPIQTQIFHCLYHTDLNFLLGAPTGSGKTVV  959 (1230)
T ss_pred             CceeccccccceeccccccccccccccCCCcchhhccccHHHhhc--ccCCccceEEEEEeecchhhhhcCCccCcchhH
Confidence            999999999999999999999999999999999999999999887  789999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCeEEEEcCcHHHHHHHHHHHHHHhhhhcCCeEEEEcCCCCccccccCCCcEEEECHhhHHHHHhcc
Q psy13788        731 AEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSW  810 (1034)
Q Consensus       731 ~~l~il~~l~~~~~~~~lvi~Pt~~L~~q~~~~~~~~~~~~~~~~v~~~~g~~~~~~~~~~~~~IiV~Tpe~l~~l~~~~  810 (1034)
                      |.+++++.+...++.+++|++|.++|+....++|.+++... |+++..++|+..++......++++|+||++|+...|+|
T Consensus       960 ae~a~~~~~~~~p~~kvvyIap~kalvker~~Dw~~r~~~~-g~k~ie~tgd~~pd~~~v~~~~~~ittpek~dgi~Rsw 1038 (1230)
T KOG0952|consen  960 AELAIFRALSYYPGSKVVYIAPDKALVKERSDDWSKRDELP-GIKVIELTGDVTPDVKAVREADIVITTPEKWDGISRSW 1038 (1230)
T ss_pred             HHHHHHHHhccCCCccEEEEcCCchhhcccccchhhhcccC-CceeEeccCccCCChhheecCceEEcccccccCccccc
Confidence            99999999999999999999999999999999999888775 99999999999999888889999999999999999999


Q ss_pred             ccccccCcccEEEEecccccCCCChhHHHHHHHHHHHhhhccCCCeEEEEEccCCCCHHHHHhHhcccCCceeecCCCCc
Q psy13788        811 QNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVR  890 (1034)
Q Consensus       811 ~~~~~l~~l~~lViDEaH~l~~~~~~~~~~il~rl~~l~~~~~~~~~iv~lSATl~~~~~l~~~l~~~~~~~~~~~~~~r  890 (1034)
                      ..+..+++++++|+||.|++++++||.++.+.++..+++.+.+..+|++++|..+.|+.++++|++..+.  ++|.|..|
T Consensus      1039 ~~r~~v~~v~~iv~de~hllg~~rgPVle~ivsr~n~~s~~t~~~vr~~glsta~~na~dla~wl~~~~~--~nf~~svr 1116 (1230)
T KOG0952|consen 1039 QTRKYVQSVSLIVLDEIHLLGEDRGPVLEVIVSRMNYISSQTEEPVRYLGLSTALANANDLADWLNIKDM--YNFRPSVR 1116 (1230)
T ss_pred             cchhhhccccceeecccccccCCCcceEEEEeeccccCccccCcchhhhhHhhhhhccHHHHHHhCCCCc--CCCCcccc
Confidence            9999999999999999999999999999999999999888999999999999999999999999999887  99999999


Q ss_pred             ccccEEEEecCCCCCCchhhhhccHHHHHHHHhhCCCCCeEEEecChHHHHHHHHHHHHHHhccCCCCcccCCChHHHHH
Q psy13788        891 PVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDN  970 (1034)
Q Consensus       891 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~lVF~~s~~~~~~~a~~L~~~~~~~~~~~~~~~~~~~~~~~  970 (1034)
                      |+|+++++.+|++.++++++.+|+++.+++++.+++.+|++||+.++++.+..|..|+..+..+.+|..|++.+..+++.
T Consensus      1117 pvp~~~~i~gfp~~~~cprm~smnkpa~qaik~~sp~~p~lifv~srrqtrlta~~li~~~~~~~~p~~fl~~de~e~e~ 1196 (1230)
T KOG0952|consen 1117 PVPLEVHIDGFPGQHYCPRMMSMNKPAFQAIKTHSPIKPVLIFVSSRRQTRLTALDLIASCATEDNPKQFLNMDELELEI 1196 (1230)
T ss_pred             cCCceEeecCCCchhcchhhhhcccHHHHHHhcCCCCCceEEEeecccccccchHhHHhhccCCCCchhccCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCHHHHHHhhhchhhhcCCCCHHHHHHh
Q psy13788        971 IVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSAL 1003 (1034)
Q Consensus       971 ~~~~i~d~~l~~~l~~gv~~~h~~~~~~~R~~i 1003 (1034)
                      +...++|.+|+.++++|++.||+|+...||..+
T Consensus      1197 ~~~~~~d~~Lk~tl~Fgi~lhhagl~~~dr~~~ 1229 (1230)
T KOG0952|consen 1197 IMSKVRDTNLKLTLPFGIGLHHAGLIENDRKIV 1229 (1230)
T ss_pred             HHHHhcccchhhhhhhhhhhhhhhccccccccC
Confidence            999999999999999999999999999998765

>KOG0951|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>smart00611 SEC63 Domain of unknown function in Sec63p, Brr2p and other proteins Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF02889 Sec63: Sec63 Brl domain; InterPro: IPR004179 This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG4434|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12766 50S ribosomal protein L32e; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR01954 nusA_Cterm_rpt transcription termination factor NusA, C-terminal duplication Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1034
4f91_B 1724 Brr2 Helicase Region Length = 1724 0.0
4f91_B 1724 Brr2 Helicase Region Length = 1724 7e-49
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 0.0
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 6e-49
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 5e-22
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 2e-21
2va8_A 715 Dna Repair Helicase Hel308 Length = 715 2e-19
4a4z_A 997 Crystal Structure Of The S. Cerevisiae Dexh Helicas 5e-13
3l9o_A 1108 Crystal Structure Of Mtr4, A Co-Factor Of The Nucle 5e-10
2xgj_A 1010 Structure Of Mtr4, A Dexh Helicase Involved In Nucl 6e-10
2q0z_X339 Crystal Structure Of Q9p172SEC63 FROM HOMO SAPIENS. 2e-09
1wp9_A 494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 3e-06
3im1_A328 Structure Of The C-Terminal Sec63 Unit Of Yeast Brr 3e-04
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure 
Iteration: 1

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/833 (41%), Positives = 521/833 (62%), Gaps = 49/833 (5%)
Query: 153  MTKGTEMYNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQ 212
            + KGT++Y+ + G +  +G LD+LQ+ GRAGRPQY+T G   +IT H +L +YLSLL  Q
Sbjct: 426  IIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQ 485
Query: 213  IPIESNFVANLADNLNAEVALGTIGNIDEAVRWLIIYINFVANLADNLNAEVALGTIGNI 272
            +PIES  V+ L D L                                 NAE+ LG + N 
Sbjct: 486  LPIESQMVSKLPDML---------------------------------NAEIVLGNVQNA 512
Query: 273  DEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENAAQILDKAHMIRFN 332
             +AV WL Y+YL++RM  +P  YGIS+D++  DP L Q R  L+  AA +LDK ++++++
Sbjct: 513  KDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYD 572
Query: 333  MRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEE 392
             +T +  +T+LGR AS+YYI ++ ++ + + +   L ++ +  + S + EF+ + VR+EE
Sbjct: 573  KKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEE 632
Query: 393  LHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRII 452
              EL  L  E   IP++   E    K+N+LLQ  +S+ ++  F+L++D+ YV Q+  R++
Sbjct: 633  KLELQKLL-ERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLM 691
Query: 453  RALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQIKLVTNRGYQSPILKPDILNK 512
            RA+FEI L+R  A +  + L    M + + W    PLRQ +           L  +++ K
Sbjct: 692  RAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRK----------LPEEVVKK 741
Query: 513  IEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESKLLPITRTVLKIHL 572
            IE++    E L ++   EI  ++R P +G  + +     P LE+   L PITR+ LK+ L
Sbjct: 742  IEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVEL 801
Query: 573  TIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLS 632
            TI  +F W++K   + +E FWI VED DS+ I H EYFLL  K    + E  +   +P+ 
Sbjct: 802  TITPDFQWDEKVHGS-SEAFWILVEDVDSEVILHHEYFLLKAK--YAQDEHLITFFVPVF 858
Query: 633  DPLPNQYLIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYES 692
            +PLP QY IR +SDR+L    Q  +SF+HLI+PE +PP T LL+LQPLPVSAL+   +ES
Sbjct: 859  EPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFES 918
Query: 693  LY--KFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYI 750
            LY  KF  FNPIQTQ+F+ +Y++D+NV +GAPTGSGKTI AE    R+  Q  E + VYI
Sbjct: 919  LYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYI 978
Query: 751  APLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIVTTPEKWDGVSRSW 810
             P++AL ++   DW  KF+ RL KKVV LTG+ + D++ +   ++I++TPEKWD +SR W
Sbjct: 979  TPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRW 1038
Query: 811  QNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKD 870
            + R  VQ++ L ++DE+HL+G + GPVLEVI SR+ +ISS  +R +R+V LS++L+NAKD
Sbjct: 1039 KQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKD 1098
Query: 871  LATWLNITKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPV 930
            +A WL  +    +NF P+VRPVPLE+HI GF       R+  M KP+Y AI +HSP+KPV
Sbjct: 1099 VAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPV 1158
Query: 931  MIFVSSRRQTRLTAIDLITILACETNPKMWVHTSDAEMDNIVDNIKDSNLKLT 983
            ++FV SR+QTRLTAID++T  A +   + ++H ++ ++   ++ + DS LK T
Sbjct: 1159 IVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET 1211
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure
>pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 Back     alignment and structure
>pdb|4A4Z|A Chain A, Crystal Structure Of The S. Cerevisiae Dexh Helicase Ski2 Bound To Amppnp Length = 997 Back     alignment and structure
>pdb|3L9O|A Chain A, Crystal Structure Of Mtr4, A Co-Factor Of The Nuclear Exosome Length = 1108 Back     alignment and structure
>pdb|2XGJ|A Chain A, Structure Of Mtr4, A Dexh Helicase Involved In Nuclear Rna Processing And Surveillance Length = 1010 Back     alignment and structure
>pdb|2Q0Z|X Chain X, Crystal Structure Of Q9p172SEC63 FROM HOMO SAPIENS. Northeast Structural Genomics Target Hr1979 Length = 339 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure
>pdb|3IM1|A Chain A, Structure Of The C-Terminal Sec63 Unit Of Yeast Brr2, P212121 Form Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1034
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-110
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 4e-43
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 6e-16
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-07
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-05
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-99
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 1e-59
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 9e-12
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 8e-06
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-04
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 7e-98
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-54
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-09
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 5e-07
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 7e-05
2q0z_X339 Protein Pro2281; SEC63, SEC, NESG, HR1979, structu 3e-46
3im1_A328 Protein SNU246, PRE-mRNA-splicing helicase BRR2; A 3e-40
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 1e-22
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 1e-22
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 1e-19
3b6e_A216 Interferon-induced helicase C domain-containing P; 7e-16
3b6e_A216 Interferon-induced helicase C domain-containing P; 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 6e-14
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-04
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-12
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 6e-04
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-05
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 8e-11
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-10
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 9e-04
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-09
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-05
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 1e-04
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
 Score =  357 bits (917), Expect = e-110
 Identities = 87/336 (25%), Positives = 149/336 (44%), Gaps = 35/336 (10%)

Query: 675 LELQPLPVSALQQPQ--YESLYK--FSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIA 730
           LEL+ +P+  L+ P    E + K      NP QT+         N +LL +PTGSGKT+ 
Sbjct: 3   LELEWMPIEDLKLPSNVIEIIKKRGIKKLNPPQTEAVKKGLLEGNRLLLTSPTGSGKTLI 62

Query: 731 AEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAI 790
           AE+       +    K +Y+ PL+AL  E+   +K  +E  +  KV   +GD   D   +
Sbjct: 63  AEMGIISFLLK-NGGKAIYVTPLRALTNEKYLTFK-DWEL-IGFKVAMTSGDYDTDDAWL 119

Query: 791 SSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGE-DRGPVLEVIVSRVNFIS 849
            +  +I+TT EK D + R      ++  V   ++DE+H L + +RGPV+E +  R     
Sbjct: 120 KNYDIIITTYEKLDSLWRHR--PEWLNEVNYFVLDELHYLNDPERGPVVESVTIRA---- 173

Query: 850 SYTKRNVRLVGLSTALANAKDLATWLNITKQGMYNFRPSVRPVPLEVHISGFPGK----- 904
               +   L+ LS  ++N K +A WL            + RPVPL   +     K     
Sbjct: 174 ----KRRNLLALSATISNYKQIAKWLGA-----EPVATNWRPVPLIEGVIYPERKKKEYN 224

Query: 905 -----QYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNPKM 959
                    ++   +  I   +   S    V++F +SR+    TA+ +   +   +  + 
Sbjct: 225 VIFKDNTTKKVHGDDAIIAYTLDSLSKNGQVLVFRNSRKMAESTALKIANYMNFVSLDEN 284

Query: 960 WVHTSDAEMDNI--VDNIKDSNLKLTIAFGIGFHHA 993
            +     ++D+I    + +   LK  I+ G+ +HHA
Sbjct: 285 ALSEILKQLDDIEEGGSDEKELLKSLISKGVAYHHA 320
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2q0z_X Protein Pro2281; SEC63, SEC, NESG, HR1979, structural genomics, translocase, northeast structural genomics consortium, PSI-2; 2.00A {Homo sapiens} SCOP: a.289.1.1 b.1.18.22 Length = 339 Back     alignment and structure
>3im1_A Protein SNU246, PRE-mRNA-splicing helicase BRR2; ATPase, RNA helicase, rnpase, RNA unwindase, molecular model mRNA splicing; 1.65A {Saccharomyces cerevisiae} PDB: 3im2_A* 3hib_A Length = 328 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1034
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2q0z_X339 Protein Pro2281; SEC63, SEC, NESG, HR1979, structu 100.0
3im1_A328 Protein SNU246, PRE-mRNA-splicing helicase BRR2; A 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.98
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.98
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.98
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.98
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.97
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.97
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.97
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.97
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.97
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.96
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.96
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.95
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.95
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.94
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.94
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.94
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.94
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.94
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.94
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.93
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.92
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.92
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.92
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.92
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.92
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.92
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.92
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.91
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.91
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.91
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.91
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.9
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.9
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.9
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.9
3h1t_A590 Type I site-specific restriction-modification syst 99.9
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.9
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.9
3bor_A237 Human initiation factor 4A-II; translation initiat 99.9
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.9
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.9
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.9
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.89
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.89
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.89
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.89
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.89
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.88
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.83
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.82
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.8
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.79
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.77
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.75
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.71
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.69
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.68
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.68
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.68
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.64
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.61
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.61
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.59
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.57
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.56
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.45
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.44
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.44
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.33
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.1
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.9
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.88
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.85
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.85
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.83
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.82
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 98.77
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.76
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.74
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.73
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.72
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.68
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.68
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.66
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.66
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.65
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.65
1yks_A440 Genome polyprotein [contains: flavivirin protease 98.64
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.63
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.62
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.61
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 98.61
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.61
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.6
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 98.53
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 98.51
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 98.47
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 98.44
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 98.43
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.42
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.4
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.4
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 97.76
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 98.37
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.36
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.28
4gl2_A699 Interferon-induced helicase C domain-containing P; 98.22
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.21
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 98.15
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.08
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.06
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.05
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.03
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.02
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.94
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 97.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.9
3h1t_A590 Type I site-specific restriction-modification syst 97.9
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.88
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.87
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.87
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.82
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.72
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.66
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.65
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 97.65
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.64
4ddu_A1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.64
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 97.61
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 97.6
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 97.51
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.49
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.48
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.4
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 97.39
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.45
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 97.2
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.8
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.51
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.42
1wcn_A70 Transcription elongation protein NUSA; RNA-binding 95.99
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.69
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.27
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.12
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.67
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.22
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.02
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.85
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 93.79
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 93.77
3jux_A822 Protein translocase subunit SECA; protein transloc 93.76
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.73
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.72
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.7
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.48
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.37
3bos_A242 Putative DNA replication factor; P-loop containing 92.98
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 92.89
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 92.86
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.77
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.58
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 92.39
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 92.33
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 92.04
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 92.01
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 91.98
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 91.93
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.85
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.81
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 91.69
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 91.62
2v1u_A387 Cell division control protein 6 homolog; DNA repli 91.54
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.5
1b22_A114 DNA repair protein RAD51; DNA binding, riken struc 91.22
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 91.18
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 91.15
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 90.86
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 90.54
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 90.45
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 90.1
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 89.96
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 89.96
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 89.77
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 89.71
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.68
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 89.66
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.62
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 89.6
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 89.47
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 89.37
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 89.19
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 89.18
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 89.17
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 88.86
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 88.53
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 88.52
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 88.49
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 88.17
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 88.17
1xp8_A366 RECA protein, recombinase A; recombination, radior 88.12
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 87.96
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 87.95
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 87.71
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.61
1u9l_A70 Transcription elongation protein NUSA; escherichia 87.58
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 87.54
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 87.43
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.38
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.21
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 87.19
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 87.13
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 87.03
2kz3_A83 Putative uncharacterized protein RAD51L3; RAD51D, 86.9
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 86.88
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 86.58
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 86.52
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.42
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 86.29
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 86.05
2gno_A305 DNA polymerase III, gamma subunit-related protein; 85.89
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 85.78
3bor_A237 Human initiation factor 4A-II; translation initiat 85.72
2chq_A319 Replication factor C small subunit; DNA-binding pr 85.67
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 85.66
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 85.46
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 85.39
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 85.38
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 85.13
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 84.53
3pvs_A447 Replication-associated recombination protein A; ma 84.38
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 84.28
3io5_A333 Recombination and repair protein; storage dimer, i 83.9
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 83.66
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 83.08
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 82.7
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 82.19
3co5_A143 Putative two-component system transcriptional RES 81.9
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 81.58
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 81.31
1p9r_A418 General secretion pathway protein E; bacterial typ 80.25
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
Probab=100.00  E-value=1e-152  Score=1498.82  Aligned_cols=971  Identities=41%  Similarity=0.732  Sum_probs=890.7

Q ss_pred             ccccccccEEEEeeeecccCCCCchHHHHHHhhhhcc----ccceeecccchhh----hhhH----------HHhhcccc
Q psy13788          2 VALTELVKLLIIDEVHLLHGDRGPVIEALVARTLRQI----GQEVFKGVKSLNR----IQSL----------VYDTAYHT   63 (1034)
Q Consensus         2 ~~~~~~v~~vViDEvH~l~d~RG~~le~li~~~~~~~----~~~~~~~~~~~~~----~~~~----------~~~~~~~~   63 (1034)
                      ..++++|++|||||+|||+|+||++||.+++|+++..    ...|+||+||+-+    +...          .++..|||
T Consensus       202 ~~~l~~v~~vIiDEvH~l~d~RG~~lE~~l~rl~~~~~~~~~~~riI~LSATl~N~~dvA~wL~~~~~~~~~~~~~~~RP  281 (1724)
T 4f92_B          202 RTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRP  281 (1724)
T ss_dssp             HHHHTTEEEEEETTGGGGGSTTHHHHHHHHHHHHHHHHHHTCCCEEEEEECSCTTHHHHHHHTTCCHHHHEEECCGGGCS
T ss_pred             chhhcCcCEEEEecchhcCCccHHHHHHHHHHHHHHHHhCCCCCcEEEEecccCCHHHHHHHhCCCCCCCeEEECCCCcc
Confidence            3578899999999999999999999999999987654    3478999988532    1110          23445553


Q ss_pred             -----------------------------------CCceEEe--ccCCcchhHHHHHHHHHHHHH---Hhhcc-------
Q psy13788         64 -----------------------------------NENLLIC--APTGAGKTNVAMLTIAHQIKQ---HISQG-------   96 (1034)
Q Consensus        64 -----------------------------------~~~~~v~--~~~~~~k~~~~~~~~~~~~~~---~~~~~-------   96 (1034)
                                                         +.+++||  +|++|++.+..+.+.+.+...   .....       
T Consensus       282 vpL~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~LVF~~sR~~~~~~A~~l~~~~~~~~~~~~~~~~~~~~~~~~  361 (1724)
T 4f92_B          282 VPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVL  361 (1724)
T ss_dssp             SCEEEECCEECCCCHHHHHHHHHHHHHHHHTTCCSSCCEEEECSSTTTTHHHHHHHHHHHHHTTSTTCCSSCCTTCSSHH
T ss_pred             CccEEEEeccCCcchhhhhHHHHHHHHHHHHHHhcCCcEEEECCCHHHHHHHHHHHHHHHhhccchhhhcccchhHHHHH
Confidence                                               2235554  567777766555443322100   00000       


Q ss_pred             ---------ccce-eccccc-eecchhH-----HHHHHhhhcCCCccccccccccccchhhhccCcccce-EEEecCcee
Q psy13788         97 ---------TEMY-NAKHGC-YVHIGIL-----DVLQIFGRAGRPQYNTSDLGRTASNYYIKHNDIELFT-EHMTKGTEM  159 (1034)
Q Consensus        97 ---------~~~~-~~~~g~-~~h~~~~-----~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~gvn~pa-~vii~~~~~  159 (1034)
                               ..+. -...|+ +||+|+.     .+++.|.++        .+.+.++|.+++ +|||||| +|||+||++
T Consensus       362 ~~~~~~~~~~~l~~~l~~Gva~HHagL~~~~R~~vE~~F~~G--------~i~vlvaTsTLa-~GVNlPa~~vVI~~~~~  432 (1724)
T 4f92_B          362 RTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADK--------HIQVLVSTATLA-WGVNLPAHTVIIKGTQV  432 (1724)
T ss_dssp             HHTTSCCSTHHHHHHTTTTEEEECSSSCTHHHHHHHHHHHTT--------CCCEEEECHHHH-HHSCCCBSEEEEECCEE
T ss_pred             HhhhcccccHHHHHHhhcCEEEEcCCCCHHHHHHHHHHHHCC--------CCeEEEEcchhH-hhCCCCCceEEEeCCEE
Confidence                     0000 024788 8899987     244444333        556666677777 3899999 999999999


Q ss_pred             ecCCCCeeeecChhhHHHHhhccCCCCccccceEEEECCcccHHHHHHHhcCCcceecccccchHHHHhhhhhcccccch
Q psy13788        160 YNAKHGCYVHIGILDVLQIFGRAGRPQYNTSGHATIITPHEKLNHYLSLLTNQIPIESNFVANLADNLNAEVALGTIGNI  239 (1034)
Q Consensus       160 ~~~~~~~~~~~~~~~~~Qm~GRAGR~~~d~~G~~~i~~~~~~~~~y~~~~~~~~~i~s~l~~~~~~~ln~e~~~~~~~~~  239 (1034)
                      |||..|++.++++.+|+||+|||||||+|+.|++|++|+.+++.+|..+++++.||||+|..++.|+||+||        
T Consensus       433 ~~~~~~~~~~ls~~~~~Qm~GRAGR~g~d~~G~~ii~~~~~~~~~~~~ll~~~~pieS~l~~~l~d~L~aeI--------  504 (1724)
T 4f92_B          433 YSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEI--------  504 (1724)
T ss_dssp             EETTTTEEEECCHHHHHHHHTTBSCTTTCSCEEEEEEEESTTCCHHHHHTTTCSCCCCCTTTTHHHHHHHHH--------
T ss_pred             ecCcCCCcccCCHHHHHHhhhhccCCCCCCccEEEEEecchhHHHHHHHHcCCCcchhhccccHHHHHHHHH--------
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999        


Q ss_pred             hhHHHHHHHHHHHHHHHhhhcccchhcccccCHHHHHHHhccccceeecccCccccCCCccccCCChhHHHHHHHHHHHH
Q psy13788        240 DEAVRWLIIYINFVANLADNLNAEVALGTIGNIDEAVRWLSYSYLHVRMRINPREYGISYDEVATDPDLIQHRTTLIENA  319 (1034)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~il~~i~~~~~~~~~~~~~~l~~T~~~~r~~~~p~~y~~~~~~~~~~~~~~~~~~~~~~~~  319 (1034)
                                               ++|++++.+|+++|+++||+|+||++||.+||++.++...|+.+++.+.++|.++
T Consensus       505 -------------------------~~g~i~~~~~a~~~l~~T~~~~r~~~~p~~y~~~~~~~~~d~~l~~~~~~~i~~~  559 (1724)
T 4f92_B          505 -------------------------VLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA  559 (1724)
T ss_dssp             -------------------------HHTSCCBHHHHHHHHHHSHHHHHHHHCTTTTTCCHHHHHHCTTCHHHHHHHHHHH
T ss_pred             -------------------------HHhhcCCHHHHHHHHhccHHHHHhhhChhhhccCccccccchHHHHHHHHHHHHH
Confidence                                     9999999999999999999999999999999999888777888899999999999


Q ss_pred             HHHhhhcCceEEecCCCCcccChHHHHHHhhccChHhHHHHHHhcCCCCCHHHHHHhhccccccccCcCChhhhHHHHHH
Q psy13788        320 AQILDKAHMIRFNMRTRDLAITDLGRTASNYYIKHNDIELFTEHMTKVLDDVGILSMISQAHEFEQLKVRDEELHELDNL  399 (1034)
Q Consensus       320 l~~L~~~~~i~~~~~~~~~~~T~lG~~~s~~yl~~~t~~~~~~~l~~~~~~~~lL~ll~~s~EF~~i~~r~~E~~~l~~l  399 (1034)
                      +..|.++|||++|++++.+.+|++||+||+|||+|.|+..|.+.+++.+++.++|+++|.+.||+++++|.+|+.++.++
T Consensus       560 ~~~L~~~~li~~d~~~~~~~~T~lGr~~s~~yi~~~t~~~~~~~l~~~~~~~~ll~~is~s~ef~~i~~R~~E~~~l~~l  639 (1724)
T 4f92_B          560 ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL  639 (1724)
T ss_dssp             HHHHHHTTSEEECTTTCBEEECHHHHHHHHTTCCHHHHHHHHHHCCTTCCHHHHHHHHHTCGGGTTCCCCGGGHHHHHHH
T ss_pred             HHHHHHCCCeeeecCCCccccchHHHHHHHhcCCHHHHHHHHhhcCCCCCHHHHHHHHhCChhhccCCcCHHHHHHHHHH
Confidence            99999999999998889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccccCCCCCCCCcchhHHHHHHHHHhCCCCCCcChHhhHHHHHHhHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHH
Q psy13788        400 TQECCEIPIRGGSENVHGKVNILLQTLLSRGRVNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFE  479 (1034)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~Kv~~LLqa~i~~~~~~~~~l~gd~~~i~~~a~rll~al~ei~~~~~~~~~~~~~l~L~k~l~  479 (1034)
                      .+. +++++++..+++..|+++|||+||++.+++++++.+|+.+|.++|.||++|+++||..+||+..+..++.|+||++
T Consensus       640 ~~~-~~~~~~~~~~~~~~Kv~~Llq~~i~~~~~~~~~l~~D~~~i~~~a~ri~ra~~ei~~~~~~~~~~~~~l~l~k~i~  718 (1724)
T 4f92_B          640 LER-VPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQLAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMID  718 (1724)
T ss_dssp             HHH-SSSCCCSCCSSHHHHHHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTBHHHHHHHHHHHHHHH
T ss_pred             Hhc-CCCCcCCCCCChHHHHHHHHHHHHcCCCcccccHHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH
Confidence            987 7889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCCCCCcccccccccccCCCCCCCCHHHHHHHHhcCCCHHHHhcCCHHHHHhhhcCchhHHHHHHHhhcCCcceEEEE
Q psy13788        480 TKQWPHETPLRQIKLVTNRGYQSPILKPDILNKIEQRGLTVEDLREMPAKEISYMLRDPHVGDKVKQCAWEIPLLEIESK  559 (1034)
Q Consensus       480 ~~~w~~~~~L~ql~~~~~~~~~~p~i~~~~~~~L~~~g~t~~~l~~~~~~el~~~l~~~~~g~~i~~~~~~~P~l~~~~~  559 (1034)
                      +|+|++.+||+||          |++++.++++|+++|+|+++|.++++.||+.++++|++|+.+++++++||+++++++
T Consensus       719 ~~~w~~~~~L~q~----------~~i~~~~~~~l~~~~~~~~~l~~~~~~~l~~~~~~~~~g~~i~~~~~~~P~~~~~~~  788 (1724)
T 4f92_B          719 KRMWQSMCPLRQF----------RKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVH  788 (1724)
T ss_dssp             HTSCTTSCGGGGS----------TTSCHHHHHHHHTSSCCGGGGGGCCHHHHHHHHTCSTTHHHHHHHHTTSCCEEEEEE
T ss_pred             hCCCCCCCceecC----------CCCCHHHHHHHHhcCCCHHHHHhCCHHHHHHHHCCchHHHHHHHHHHHCCCceEEEE
Confidence            9999999999999          999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeccceEEEEEEEEeCCCCCccCCCCCCCcEEEEEEcCCCCeeEEEeeEEeecccccccCceeEEEEeecCCCCCCce
Q psy13788        560 LLPITRTVLKIHLTIKANFSWNDKNKSTYAEPFWIWVEDPDSDFIYHSEYFLLSKKQVITKSEESLIMTIPLSDPLPNQY  639 (1034)
Q Consensus       560 ~~pit~~~l~v~l~~~~~~~~~~~~~~~~~e~~~l~v~D~~~~~i~~~~~~~l~~~~~~~~~~~~l~f~vpl~~p~p~~~  639 (1034)
                      +||+|+++++|+++++|+|.|++++||+ .|+||+||+|++++.|+|+++|.++++..  ++++.++|++|+.+|+||+|
T Consensus       789 ~~p~~~~~~~~~~~~~~~~~w~~~~h~~-~~~~~~~v~d~~~~~i~~~~~~~~~~~~~--~~~~~~~~~~p~~~~~p~~~  865 (1724)
T 4f92_B          789 LQPITRSTLKVELTITPDFQWDEKVHGS-SEAFWILVEDVDSEVILHHEYFLLKAKYA--QDEHLITFFVPVFEPLPPQY  865 (1724)
T ss_dssp             EEESSSSEEEEEEEEEECSCCCTTTTTT-EEEEEEEEECTTSCBEEEEEEEEEEGGGT--TSCEEEEEEEECCSSCCSEE
T ss_pred             EEecCCceEEEEEEEeeccccchhhcCC-ceeEEEEEEecCCCeEEEEEEEEeeeecc--CCceEEEEEEECCCCCCCeE
Confidence            9999999999999999999999999998 99999999999999999999999999876  56899999999999999999


Q ss_pred             EEEeeccccccccccccccccccccCCCCCCCCccccCCCCCCCccCcccccccc--ccCCCChhHHHHHHHHhcCCCcE
Q psy13788        640 LIRAMSDRYLGSVVQHSMSFKHLIVPELHPPHTNLLELQPLPVSALQQPQYESLY--KFSHFNPIQTQIFHCLYHTDNNV  717 (1034)
Q Consensus       640 ~i~~~Sd~wlg~e~~~~vs~~~l~~p~~~~~~~~ll~l~~~~~~~l~~~~~~~~~--~~~~~~~~Q~~ai~~l~~~~~~v  717 (1034)
                      +++++||+|+|++...+++|.++++|+..+++|+++|++|+|+++|.++.++.+|  +|++|+|+|+++|+.++++++|+
T Consensus       866 ~i~~~sd~w~~~~~~~~~~~~~~~~p~~~~~~t~lldl~plp~s~L~~~~~e~l~~~~f~~fnpiQ~q~~~~l~~~~~nv  945 (1724)
T 4f92_B          866 FIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNV  945 (1724)
T ss_dssp             EEEEEESSSTTCEEEEEEECTTCCCCCCCCCCCCCCCCCCCBGGGSCCHHHHTTTTTTCSBCCHHHHHHHHHHHSCCSCE
T ss_pred             EEEEEEccccCCCceeeeccccccCCCCCCCCCccccCCCCCcccccCHHHHHHHHhcCCCCCHHHHHHHHHHhcCCCcE
Confidence            9999999999999999999999999999999999999999999999999999998  49999999999999999889999


Q ss_pred             EEEcCCCChhhHHHHHHHHHHHHhCCCCeEEEEcCcHHHHHHHHHHHHHHhhhhcCCeEEEEcCCCCccccccCCCcEEE
Q psy13788        718 LLGAPTGSGKTIAAEITCFRVFKQCPEAKVVYIAPLKALVKERVADWKVKFEARLKKKVVELTGDVTPDIQAISSASVIV  797 (1034)
Q Consensus       718 ll~apTGsGKT~~~~l~il~~l~~~~~~~~lvi~Pt~~L~~q~~~~~~~~~~~~~~~~v~~~~g~~~~~~~~~~~~~IiV  797 (1034)
                      +++||||||||++|++|+++.+.+.++.++||++|++||+.|++++|.+.|++.+|++++.++|+...+.+...+++|+|
T Consensus       946 lv~APTGSGKTliaelail~~l~~~~~~kavyi~P~raLa~q~~~~~~~~f~~~~g~~V~~ltGd~~~~~~~~~~~~IiV 1025 (1724)
T 4f92_B          946 FVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIII 1025 (1724)
T ss_dssp             EEECCTTSCCHHHHHHHHHHHHHHCTTCCEEEECSCHHHHHHHHHHHHHHHTTTSCCCEEECCSCHHHHHHHHHHCSEEE
T ss_pred             EEEeCCCCCchHHHHHHHHHHHHhCCCCEEEEEcChHHHHHHHHHHHHHHhchhcCCEEEEEECCCCcchhhcCCCCEEE
Confidence            99999999999999999999999888899999999999999999999999998889999999999887766667899999


Q ss_pred             ECHhhHHHHHhccccccccCcccEEEEecccccCCCChhHHHHHHHHHHHhhhccCCCeEEEEEccCCCCHHHHHhHhcc
Q psy13788        798 TTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLGEDRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANAKDLATWLNI  877 (1034)
Q Consensus       798 ~Tpe~l~~l~~~~~~~~~l~~l~~lViDEaH~l~~~~~~~~~~il~rl~~l~~~~~~~~~iv~lSATl~~~~~l~~~l~~  877 (1034)
                      +|||+|+.++++|.....+++++++|+||+|++++.+|+.++.++.+++++..+.+.++|+|+||||++|++++++|++.
T Consensus      1026 ~TPEkld~llr~~~~~~~l~~v~lvViDE~H~l~d~rg~~le~il~rl~~i~~~~~~~~riI~lSATl~N~~dla~WL~~ 1105 (1724)
T 4f92_B         1026 STPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGC 1105 (1724)
T ss_dssp             ECHHHHHHHHTTTTTCHHHHSCSEEEECCGGGGGSTTHHHHHHHHHHHHHHHHTTSSCCEEEEEESCBTTHHHHHHHHTC
T ss_pred             ECHHHHHHHHhCcccccccceeeEEEeechhhcCCCCCccHHHHHHHHHHHHhhcCCCceEEEEeCCCCCHHHHHHHhCC
Confidence            99999999999888888899999999999999998899999999999999988889999999999999999999999999


Q ss_pred             cCCceeecCCCCcccccEEEEecCCCCCCchhhhhccHHHHHHHHhhCCCCCeEEEecChHHHHHHHHHHHHHHhccCCC
Q psy13788        878 TKQGMYNFRPSVRPVPLEVHISGFPGKQYCPRMAKMNKPIYTAIKQHSPEKPVMIFVSSRRQTRLTAIDLITILACETNP  957 (1034)
Q Consensus       878 ~~~~~~~~~~~~r~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~lVF~~s~~~~~~~a~~L~~~~~~~~~~  957 (1034)
                      ....+++|.++.||++++.++.+++..+...+...+.++++..+.....++++||||+|+++|+.+|..|...+.....+
T Consensus      1106 ~~~~~~~~~~~~RPvpL~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lVF~~sR~~~~~~A~~L~~~~~~~~~~ 1185 (1724)
T 4f92_B         1106 SATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQR 1185 (1724)
T ss_dssp             CSTTEEECCGGGCSSCEEEEEEEECCCSHHHHHHTTHHHHHHHHHHHCSSSCEEEEESSHHHHHHHHHHHHHHHHHTTCT
T ss_pred             CCCCeEEeCCCCCCCCeEEEEEeccCCCchhhhhhhcchHHHHHHHhcCCCCeeeeCCCHHHHHHHHHHHHHHHhhccch
Confidence            99999999999999999999999999988888999999999999999999999999999999999999999999888888


Q ss_pred             CcccCCChHHHHHHHhhcCCHHHHHHhhhchhhhcCCCCHHHHHHhcccchhHhhcCCceEEEechhhhhccCCCC
Q psy13788        958 KMWVHTSDAEMDNIVDNIKDSNLKLTIAFGIGFHHAAAEAAQSSALQMPKLAALSSKENQNVINRSTSANGNFDFN 1033 (1034)
Q Consensus       958 ~~~~~~~~~~~~~~~~~i~d~~l~~~l~~gv~~~h~~~~~~~R~~ie~~~l~~f~~g~i~VLVaT~~l~~Gv~Dfs 1033 (1034)
                      ..++....+++...++.+.|+.|..++..||++|||||++++|+.+|+  +  |++|.++|||||+++++|| |+.
T Consensus      1186 ~~~~~~~~~~l~~~l~~~~d~~L~~~l~~GIa~hHagL~~~~R~~VE~--l--F~~G~i~VLvaT~tlA~GV-nlP 1256 (1724)
T 4f92_B         1186 QRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQ--L--FSSGAIQVVVASRSLCWGM-NVA 1256 (1724)
T ss_dssp             TTTBCSCHHHHHHHHTTCCCHHHHHHHHTTEEEECTTSCHHHHHHHHH--H--HHHTSBCEEEEEGGGSSSC-CCC
T ss_pred             hhhhcccHHHHHHHHhhcccHHHHHHHhCCEEEECCCCCHHHHHHHHH--H--HHCCCCeEEEEChHHHcCC-CCC
Confidence            888999999999999999999999999999999999999999999999  9  9999999999999999999 873
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2q0z_X Protein Pro2281; SEC63, SEC, NESG, HR1979, structural genomics, translocase, northeast structural genomics consortium, PSI-2; 2.00A {Homo sapiens} SCOP: a.289.1.1 b.1.18.22 Back     alignment and structure
>3im1_A Protein SNU246, PRE-mRNA-splicing helicase BRR2; ATPase, RNA helicase, rnpase, RNA unwindase, molecular model mRNA splicing; 1.65A {Saccharomyces cerevisiae} PDB: 3im2_A* 3hib_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} SCOP: a.60.4.2 PDB: 1wcl_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2kz3_A Putative uncharacterized protein RAD51L3; RAD51D, homologous recombination, unknown function; NMR {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1034
d2q0zx1176 a.289.1.1 (X:33-208) Protein pro2281 {Human (Homo 2e-33
d2p6ra185 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobu 5e-16
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 7e-15
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 1e-11
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 7e-09
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 2e-07
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 3e-04
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 9e-06
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 7e-04
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 9e-05
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 2e-04
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 5e-04
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 0.002
>d2q0zx1 a.289.1.1 (X:33-208) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure

class: All alpha proteins
fold: Sec63 N-terminal domain-like
superfamily: Sec63 N-terminal domain-like
family: Sec63 N-terminal domain
domain: Protein pro2281
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  124 bits (313), Expect = 2e-33
 Identities = 44/183 (24%), Positives = 81/183 (44%), Gaps = 13/183 (7%)

Query: 372 GILSMISQAHEFEQLKVRDEELHELDNLTQECCEIPIRGGSENVHGKVNILLQTLLSRGR 431
           G++ +IS A E+E + +R  E + L  L Q+           + H K N+LLQ  LSR +
Sbjct: 5   GLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQ 64

Query: 432 VNSFSLVSDLEYVNQNVIRIIRALFEITLHRNNAIMAARFLKFALMFETKQWPHETPLRQ 491
           +++  L SD E +    IR+I+A  ++         A   ++ A M     W  ++ L+Q
Sbjct: 65  LSA-ELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQ 123

Query: 492 IKLVTNRGYQSPILKPDILNKIEQRGL-TVEDLREMPAKEISYMLR-DPHVGDKVKQCAW 549
           +          P    + + +   +G+ +V D+ EM  +E + +L+        V +   
Sbjct: 124 L----------PHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCN 173

Query: 550 EIP 552
             P
Sbjct: 174 RYP 176
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 85 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1034
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.94
d2q0zx1176 Protein pro2281 {Human (Homo sapiens) [TaxId: 9606 99.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.94
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.92
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.91
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.89
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.89
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.87
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.83
d2p6ra2198 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.72
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.67
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.65
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.63
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.63
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.63
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.62
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.62
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.56
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.38
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.01
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.9
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 98.88
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 98.86
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.85
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.75
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.72
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.71
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.69
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 98.69
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.66
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.61
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 98.42
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.41
d2q0zx2114 Protein pro2281 {Human (Homo sapiens) [TaxId: 9606 98.4
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.09
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 98.04
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 97.94
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.88
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.83
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.8
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.76
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.73
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.73
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 97.66
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 97.65
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.62
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.6
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 97.44
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 97.38
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 97.26
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.23
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.15
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.01
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 96.99
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.86
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.77
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 96.75
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 96.7
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.66
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 96.65
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.38
d1szpa164 DNA repair protein Rad51, N-terminal domain {Baker 96.12
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.01
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 95.98
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.95
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.84
d1b22a_70 DNA repair protein Rad51, N-terminal domain {Human 95.72
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 95.6
d2qy9a2211 GTPase domain of the signal recognition particle r 95.32
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 95.27
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.24
d1okkd2207 GTPase domain of the signal recognition particle r 95.06
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 94.89
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.6
d1vmaa2213 GTPase domain of the signal recognition particle r 94.32
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.11
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.99
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 93.9
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.74
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 93.44
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.12
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 93.02
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.83
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.64
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.55
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.5
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 92.02
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 91.98
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.56
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.5
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 91.24
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.1
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.68
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.55
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.22
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.21
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 90.06
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.03
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 89.01
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 88.73
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.04
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 87.7
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.25
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 87.0
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 86.21
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 84.95
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 84.77
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 84.42
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 84.34
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.87
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 83.77
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 83.41
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 83.26
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.22
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 82.99
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 82.01
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 80.59
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 80.2
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=4e-28  Score=250.99  Aligned_cols=181  Identities=13%  Similarity=0.195  Sum_probs=150.7

Q ss_pred             cCCCCCCCccCccccccccccCCCChhHHHHHHHHhcCCCcEEEEcCCCChhhHHHHHHHHHHHHhC-CCCeEEEEcCcH
Q psy13788        676 ELQPLPVSALQQPQYESLYKFSHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIAAEITCFRVFKQC-PEAKVVYIAPLK  754 (1034)
Q Consensus       676 ~l~~~~~~~l~~~~~~~~~~~~~~~~~Q~~ai~~l~~~~~~vll~apTGsGKT~~~~l~il~~l~~~-~~~~~lvi~Pt~  754 (1034)
                      +|++.+..+|.+.+|      ..|+|+|.+|+|.++ .|+|+++.||||||||++|++|+++.+... ...+++|++||+
T Consensus        23 ~L~~~l~~~L~~~g~------~~pt~IQ~~aIp~il-~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~Ptr   95 (222)
T d2j0sa1          23 GLREDLLRGIYAYGF------EKPSAIQQRAIKQII-KGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTR   95 (222)
T ss_dssp             CCCHHHHHHHHHHTC------CSCCHHHHHHHHHHH-TTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECSSH
T ss_pred             CCCHHHHHHHHHCCC------CCCCHHHHHHHHHHH-CCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecchH
Confidence            778888888876554      459999999999998 799999999999999999999999988654 467899999999


Q ss_pred             HHHHHHHHHHHHHhhhhcCCeEEEEcCCCCccccc---cCCCcEEEECHhhHHHHHhccccccccCcccEEEEecccccC
Q psy13788        755 ALVKERVADWKVKFEARLKKKVVELTGDVTPDIQA---ISSASVIVTTPEKWDGVSRSWQNRNYVQSVALIIIDEIHLLG  831 (1034)
Q Consensus       755 ~L~~q~~~~~~~~~~~~~~~~v~~~~g~~~~~~~~---~~~~~IiV~Tpe~l~~l~~~~~~~~~l~~l~~lViDEaH~l~  831 (1034)
                      +|+.|+++.+. .+++..++++..+.|+.......   ..+++|+|+||+++..+..  .....+++++++|+||||.+.
T Consensus        96 eLa~Qi~~~~~-~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~--~~~~~~~~l~~lVlDEaD~ll  172 (222)
T d2j0sa1          96 ELAVQIQKGLL-ALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIR--RRSLRTRAIKMLVLDEADEML  172 (222)
T ss_dssp             HHHHHHHHHHH-HHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHH--TTSSCCTTCCEEEEETHHHHT
T ss_pred             HHHHHHHHHHH-HHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhccc--ccccccccceeeeecchhHhh
Confidence            99999988877 56666889999999987755433   3478999999999988876  455678999999999999998


Q ss_pred             C-CChhHHHHHHHHHHHhhhccCCCeEEEEEccCCCCH-HHHHh
Q psy13788        832 E-DRGPVLEVIVSRVNFISSYTKRNVRLVGLSTALANA-KDLAT  873 (1034)
Q Consensus       832 ~-~~~~~~~~il~rl~~l~~~~~~~~~iv~lSATl~~~-~~l~~  873 (1034)
                      + +|...+..++.       ..+.+.|++++|||+++. .++++
T Consensus       173 ~~~f~~~i~~I~~-------~l~~~~Q~ilfSAT~~~~v~~l~~  209 (222)
T d2j0sa1         173 NKGFKEQIYDVYR-------YLPPATQVVLISATLPHEILEMTN  209 (222)
T ss_dssp             STTTHHHHHHHHT-------TSCTTCEEEEEESCCCHHHHTTGG
T ss_pred             hcCcHHHHHHHHH-------hCCCCCEEEEEEEeCCHHHHHHHH
Confidence            8 78887777763       456788999999999762 44444
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q0zx1 a.289.1.1 (X:33-208) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2q0zx2 b.1.18.22 (X:209-322) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure