Psyllid ID: psy14441

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MSSRALTSLASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKALLPVIGSQMVQQVRRSHAYSKKPPVTIDDLPVPQGSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSFPAKDLSMLNSVDSDHSQVMNSFSNSMEVDQNSSQSSTQSPAAQVMQKTNMPSSTPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKKY
ccHHHHHHHHHHHHccccccEEEccccccccccccccHHHEEHHHHHHccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHEEEEHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHccccccHHHHHHHHHHHHHHccccccHHHHcccccccccccccEcccccccccccHHHHHHHHHHHHcHEEHEHHHHHHHHHcccccccEEEEEcccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHccccEccccccccccccccccccHHHHHHHHHHHHHHHcc
MSSRALTSLASCARkylpcdillkiqsvptipqveQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHslkahshghasihdmhmPVACHFVLSSLLKALLPVIGSQMVQQVRRshayskkppvtiddlpvpqgswkahydkqNTKYNIQLLVGTVSLAATIGYLAVSDVfiwnffpptlpknevlsfpakdlsmlnsvdsdhsQVMNSFsnsmevdqnssqsstqspaaqvmqktnmpsstpndqilgkdKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLakhrgsstldpkdLQFVLAkdwnisipgygtdelkpykrpmatEAHKQRLALIRKHLKKY
MSSRALTSLASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKALLPVIGSQMVQQVRRShayskkppvtiddlpvpqgSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSFPAKDLSMLNSVDSDHSQVMNSFSNSMEVDQNSSQSSTQSPAAQVMQktnmpsstpndqILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAkhrgsstldpkDLQFVLAkdwnisipgygtdelkpykrpMATEAHKQRLALIRKHLKKY
MSSRALTSLASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKALLPVIGSQMVQQVRRSHAYSKKPPVTIDDLPVPQGSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSFPAKDLSMLNSVDSDHSQVMNSFSNSMEVDqnssqsstqsPAAQVMQKTNMPSSTPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKKY
********LASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKALLPVIGSQMVQQVRRSHAY*****VTIDDLPVPQGSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSF***********************************************************************VDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDEL**************************
*********ASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKA*************************TIDDLPVPQGSWK*********YNIQLLVGTVSLAATIGYLAVSDVFIWNF*****************************************************************************LDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGY************************RKHL***
********LASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKALLPVIGSQMVQQVRRSHAYSKKPPVTIDDLPVPQGSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSFPAKDLSMLNSVDSDHSQVMNSFSN*****************************TPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKKY
*****LTSLASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAH*HGHASIHDMHMPVACHFVLSSLLKALLPVIG*****************PVTIDDLPVPQGSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSFPAKD******************************************************ILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKKY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRALTSLASCARKYLPCDILLKIQSVPTIPQVEQNITYRIQNITQHFNSHSFLFRKQRNVYLHCLLVMLNFMSFNLCQHSLKAHSHGHASIHDMHMPVACHFVLSSLLKALLPVIGSQMVQQVRRSHAYSKKPPVTIDDLPVPQGSWKAHYDKQNTKYNIQLLVGTVSLAATIGYLAVSDVFIWNFFPPTLPKNEVLSFPAKDLSMLNSVDSDHSQVMNSFSNSMEVDQNSSQSSTQSPAAQVMQKTNMPSSTPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q8VE65161 Transcription initiation yes N/A 0.304 0.689 0.531 5e-30
Q16514161 Transcription initiation yes N/A 0.304 0.689 0.531 6e-30
Q3T174161 Transcription initiation yes N/A 0.304 0.689 0.531 6e-30
Q91858164 Transcription initiation N/A N/A 0.306 0.682 0.5 3e-28
P49905196 Transcription initiation yes N/A 0.345 0.642 0.452 1e-26
Q555L9627 Transcription initiation yes N/A 0.284 0.165 0.457 2e-21
Q03761539 Transcription initiation yes N/A 0.405 0.274 0.3 6e-15
O13722450 Transcription initiation yes N/A 0.276 0.224 0.392 2e-13
>sp|Q8VE65|TAF12_MOUSE Transcription initiation factor TFIID subunit 12 OS=Mus musculus GN=Taf12 PE=1 SV=1 Back     alignment and function desciption
 Score =  132 bits (331), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 85/111 (76%)

Query: 254 STPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSST 313
           S  N+Q+L K KL +L+R+VD   Q+DE+V +   +IA+DF++++V  ACQLA+HR SST
Sbjct: 51  SPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSST 110

Query: 314 LDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKK 364
           L+ KD+Q  L + WN+ IPG+G++E++PYK+   TEAHKQR+ALIRK  KK
Sbjct: 111 LEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
Mus musculus (taxid: 10090)
>sp|Q16514|TAF12_HUMAN Transcription initiation factor TFIID subunit 12 OS=Homo sapiens GN=TAF12 PE=1 SV=1 Back     alignment and function description
>sp|Q3T174|TAF12_BOVIN Transcription initiation factor TFIID subunit 12 OS=Bos taurus GN=TAF12 PE=2 SV=1 Back     alignment and function description
>sp|Q91858|TAF12_XENLA Transcription initiation factor TFIID subunit 12 OS=Xenopus laevis GN=taf12 PE=2 SV=1 Back     alignment and function description
>sp|P49905|TAF12_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster GN=Taf12 PE=1 SV=1 Back     alignment and function description
>sp|Q555L9|TAF12_DICDI Transcription initiation factor TFIID subunit 12 OS=Dictyostelium discoideum GN=TAF12 PE=3 SV=2 Back     alignment and function description
>sp|Q03761|TAF12_YEAST Transcription initiation factor TFIID subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF12 PE=1 SV=1 Back     alignment and function description
>sp|O13722|TAF12_SCHPO Transcription initiation factor TFIID subunit 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf12 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
307173607191 Transcription initiation factor TFIID su 0.347 0.664 0.534 4e-31
443688398186 hypothetical protein CAPTEDRAFT_162600 [ 0.419 0.822 0.439 3e-30
332018940190 Transcription initiation factor TFIID su 0.342 0.657 0.523 4e-30
410032576199 PREDICTED: transcription initiation fact 0.441 0.809 0.412 9e-30
431891174213 Transcription initiation factor TFIID su 0.441 0.755 0.412 1e-29
296207258213 PREDICTED: transcription initiation fact 0.441 0.755 0.412 1e-29
242021130260 transcription initiation factor TFIID su 0.326 0.457 0.521 1e-29
198431447234 PREDICTED: similar to TFIID subunit p22 0.345 0.538 0.496 1e-29
119628086199 TAF12 RNA polymerase II, TATA box bindin 0.441 0.809 0.418 1e-29
119628085213 TAF12 RNA polymerase II, TATA box bindin 0.441 0.755 0.418 2e-29
>gi|307173607|gb|EFN64464.1| Transcription initiation factor TFIID subunit 12 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  142 bits (357), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 98/129 (75%), Gaps = 2/129 (1%)

Query: 238 TQSPAAQVMQKTNMPSSTPN-DQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVD 296
           +QSP  QV+Q+++ PSS  +  Q L K +L +L+R+VD T Q+DEEV +   ++A+DFV+
Sbjct: 64  SQSPK-QVLQQSSTPSSFSDFPQFLTKTRLQDLVREVDPTEQLDEEVEEMLLQLADDFVE 122

Query: 297 NIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLA 356
             V+ AC LAKHR ++T++ KD+Q  L ++WN+ IPG+GTDE++PYKR   TEAHKQRLA
Sbjct: 123 TTVNAACLLAKHRHANTVEVKDVQLHLERNWNMWIPGFGTDEVRPYKRATVTEAHKQRLA 182

Query: 357 LIRKHLKKY 365
           LIRK +KKY
Sbjct: 183 LIRKSIKKY 191

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|443688398|gb|ELT91102.1| hypothetical protein CAPTEDRAFT_162600 [Capitella teleta] Back     alignment and taxonomy information
>gi|332018940|gb|EGI59486.1| Transcription initiation factor TFIID subunit 12 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|410032576|ref|XP_003949389.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Pan troglodytes] Back     alignment and taxonomy information
>gi|431891174|gb|ELK02051.1| Transcription initiation factor TFIID subunit 12 [Pteropus alecto] Back     alignment and taxonomy information
>gi|296207258|ref|XP_002750565.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Callithrix jacchus] gi|297282716|ref|XP_001113189.2| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 2 [Macaca mulatta] gi|301755126|ref|XP_002913380.1| PREDICTED: transcription initiation factor TFIID subunit 12-like [Ailuropoda melanoleuca] gi|397515833|ref|XP_003828147.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Pan paniscus] Back     alignment and taxonomy information
>gi|242021130|ref|XP_002430999.1| transcription initiation factor TFIID subunit, putative [Pediculus humanus corporis] gi|212516223|gb|EEB18261.1| transcription initiation factor TFIID subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198431447|ref|XP_002130711.1| PREDICTED: similar to TFIID subunit p22 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|119628086|gb|EAX07681.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa, isoform CRA_b [Homo sapiens] Back     alignment and taxonomy information
>gi|119628085|gb|EAX07680.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa, isoform CRA_a [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
UNIPROTKB|Q3T174161 TAF12 "Transcription initiatio 0.304 0.689 0.531 7.1e-29
UNIPROTKB|E2QVZ3161 TAF12 "Uncharacterized protein 0.304 0.689 0.531 7.1e-29
UNIPROTKB|Q16514161 TAF12 "Transcription initiatio 0.304 0.689 0.531 7.1e-29
MGI|MGI:1913714161 Taf12 "TAF12 RNA polymerase II 0.304 0.689 0.531 7.1e-29
RGD|1592841161 Taf12 "TAF12 RNA polymerase II 0.304 0.689 0.531 7.1e-29
ZFIN|ZDB-GENE-031030-5162 taf12 "TAF12 RNA polymerase II 0.304 0.685 0.522 1.5e-28
UNIPROTKB|Q5ZKX3161 TAF12 "Uncharacterized protein 0.304 0.689 0.513 5e-28
UNIPROTKB|I3LKU2161 TAF12 "Uncharacterized protein 0.304 0.689 0.513 5.7e-27
FB|FBgn0011290196 Taf12 "TBP-associated factor 1 0.416 0.775 0.423 2.5e-26
UNIPROTKB|G3MXQ4161 G3MXQ4 "Uncharacterized protei 0.304 0.689 0.450 1.1e-23
UNIPROTKB|Q3T174 TAF12 "Transcription initiation factor TFIID subunit 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
 Identities = 59/111 (53%), Positives = 85/111 (76%)

Query:   254 STPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSST 313
             S  N+Q+L K KL +L+R+VD   Q+DE+V +   +IA+DF++++V  ACQLA+HR SST
Sbjct:    51 SPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSST 110

Query:   314 LDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKK 364
             L+ KD+Q  L + WN+ IPG+G++E++PYK+   TEAHKQR+ALIRK  KK
Sbjct:   111 LEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0006352 "DNA-dependent transcription, initiation" evidence=IEA
GO:0005669 "transcription factor TFIID complex" evidence=IEA
UNIPROTKB|E2QVZ3 TAF12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q16514 TAF12 "Transcription initiation factor TFIID subunit 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913714 Taf12 "TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1592841 Taf12 "TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031030-5 taf12 "TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKX3 TAF12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKU2 TAF12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0011290 Taf12 "TBP-associated factor 12" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXQ4 G3MXQ4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3T174TAF12_BOVINNo assigned EC number0.53150.30410.6894yesN/A
Q16514TAF12_HUMANNo assigned EC number0.53150.30410.6894yesN/A
Q8VE65TAF12_MOUSENo assigned EC number0.53150.30410.6894yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
cd0798172 cd07981, TAF12, TATA Binding Protein (TBP) Associa 2e-29
pfam0384767 pfam03847, TFIID_20kDa, Transcription initiation f 9e-23
COG5624505 COG5624, TAF61, Transcription initiation factor TF 6e-13
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 0.002
pfam0080865 pfam00808, CBFD_NFYB_HMF, Histone-like transcripti 0.002
>gnl|CDD|173964 cd07981, TAF12, TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information 
 Score =  107 bits (270), Expect = 2e-29
 Identities = 38/72 (52%), Positives = 53/72 (73%)

Query: 260 ILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDL 319
           IL K KL EL++++D   Q+D +V +   EIA+DFVD++V  AC+LAKHR S TL+ KD+
Sbjct: 1   ILTKRKLQELLKEIDPREQLDPDVEELLLEIADDFVDDVVEDACRLAKHRKSDTLEVKDV 60

Query: 320 QFVLAKDWNISI 331
           Q  L ++WNISI
Sbjct: 61  QLHLERNWNISI 72

The TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and are involved in forming the TFIID complex. TFIID is one of the seven General Transcription Factors (GTFs) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the pre-initiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs are named after their electrophoretic mobility in polyacrylamide gels in different species. A new, unified nomenclature has been suggested for the pol II TAFs to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs function such as serving as activator-binding sites, core-promoter recognition or a role in essential catalytic activity. These TAFs, with the help of specific activators, are required only for expression of a subset of genes and are not universally involved for transcription as are GTFs. In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. Several TAFs interact via histone-fold (HFD) motifs; the HFD is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamers. The minimal HFD contains three alpha-helices linked by two loops and is found in core histones, TAFs and many other transcription factors. TFIID has a histone octamer-like substructure. TAF12 domain interacts with TAF4 and makes a novel histone-like heterodimer that binds DNA and has a core promoter function of a subset of genes. Length = 72
>gnl|CDD|112650 pfam03847, TFIID_20kDa, Transcription initiation factor TFIID subunit A Back     alignment and domain information
>gnl|CDD|227911 COG5624, TAF61, Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
KOG1142|consensus258 100.0
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 99.96
COG5624505 TAF61 Transcription initiation factor TFIID, subun 99.93
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 99.9
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 98.07
PLN00035103 histone H4; Provisional 98.05
PTZ00015102 histone H4; Provisional 97.9
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 97.75
cd0007685 H4 Histone H4, one of the four histones, along wit 97.71
smart0080365 TAF TATA box binding protein associated factor. TA 97.59
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 97.59
smart00428105 H3 Histone H3. 97.47
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 97.3
smart0041774 H4 Histone H4. 97.12
PLN00161135 histone H3; Provisional 96.96
PLN00121136 histone H3; Provisional 96.68
PLN0016097 histone H3; Provisional 96.56
PTZ00018136 histone H3; Provisional 96.55
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 96.54
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 96.3
smart0057677 BTP Bromodomain transcription factors and PHD doma 96.13
smart0042789 H2B Histone H2B. 96.13
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 95.44
PTZ00463117 histone H2B; Provisional 95.41
PLN00158116 histone H2B; Provisional 95.39
PF0296966 TAF: TATA box binding protein associated factor (T 94.6
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 94.6
KOG3467|consensus103 94.51
KOG0869|consensus168 94.45
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 94.38
KOG1744|consensus127 93.75
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 93.59
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 92.67
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 91.87
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 91.63
KOG0871|consensus156 90.52
KOG3334|consensus148 88.59
KOG3423|consensus176 87.07
PF0354051 TFIID_30kDa: Transcription initiation factor TFIID 85.14
KOG0870|consensus172 83.32
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 83.31
PF05236 264 TAF4: Transcription initiation factor TFIID compon 83.29
cd08045212 TAF4 TATA Binding Protein (TBP) Associated Factor 83.1
KOG1745|consensus137 82.19
PF0539280 COX7B: Cytochrome C oxidase chain VIIB; InterPro: 81.39
>KOG1142|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.3e-43  Score=328.55  Aligned_cols=111  Identities=50%  Similarity=0.855  Sum_probs=109.0

Q ss_pred             CCCCCCCCChhHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCCCCchhhHHHhhhccCcccCC
Q psy14441        254 STPNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPG  333 (365)
Q Consensus       254 s~~~~~VL~KrkLqeLVrqIDp~e~LD~dVEElLLeLADDFVdsVvs~AC~LAKHRkSdtLEvkDVql~LER~wNI~IPG  333 (365)
                      ..+++++++|++|+|||++||+++.||+||||+|++||||||++|+++||+|||||||++||+|||+|||||+|||+|||
T Consensus       148 ~~~~~~il~k~kl~dLvqqId~~~~LD~dVedlLleiADdFV~sii~~sC~LAKHRKsdtlEvrDIqLhLEr~~Nm~iPg  227 (258)
T KOG1142|consen  148 EPGNNPILSKRKLDDLVQQIDGTTKLDDDVEDLLLEIADDFVSSIIHRSCKLAKHRKSDTVEVRDIQLHLERNFNMEIPG  227 (258)
T ss_pred             cCCCCccccccchhHHHHhhcCcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCccchhheeeeeeccccccCCC
Confidence            35799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCcHHHHHHHHHHHHHhhc
Q psy14441        334 YGTDELKPYKRPMATEAHKQRLALIRKHLKK  364 (365)
Q Consensus       334 fgsDeirp~rK~~~teaHkqRMAlIrKtiKK  364 (365)
                      |++||+++++|+.|||+|+||||+|||++||
T Consensus       228 f~sd~~~~~~k~~pTe~hkqr~a~i~k~~~k  258 (258)
T KOG1142|consen  228 FSSDEKRSKKKALPTEEHKQRLALIRKQIKK  258 (258)
T ss_pred             ccccccccccccCCcHHHHHHHHHHHHhhcC
Confidence            9999999999999999999999999999997

>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>COG5624 TAF61 Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>KOG3467|consensus Back     alignment and domain information
>KOG0869|consensus Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1744|consensus Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>KOG0871|consensus Back     alignment and domain information
>KOG3334|consensus Back     alignment and domain information
>KOG3423|consensus Back     alignment and domain information
>PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors Back     alignment and domain information
>KOG0870|consensus Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site Back     alignment and domain information
>cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>PF05392 COX7B: Cytochrome C oxidase chain VIIB; InterPro: IPR008433 Cytochrome oxidase subunit VIIB is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1h3o_B76 Crystal Structure Of The Human Taf4-Taf12 (Tafii135 8e-14
>pdb|1H3O|B Chain B, Crystal Structure Of The Human Taf4-Taf12 (Tafii135-Tafii20) Complex Length = 76 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/72 (48%), Positives = 52/72 (72%)
Query: 260 ILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDL 319
           +L K KL +L+R+VD   Q+DE+V +   +IA+DF++++V  ACQLA+HR SSTL+ KD+
Sbjct: 5   VLTKKKLQDLVREVDPNEQLDEDVEEXLLQIADDFIESVVTAACQLARHRKSSTLEVKDV 64
Query: 320 QFVLAKDWNISI 331
           Q  L + WN  I
Sbjct: 65  QLHLERQWNXWI 76

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 7e-30
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 5e-04
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Length = 76 Back     alignment and structure
 Score =  108 bits (272), Expect = 7e-30
 Identities = 35/75 (46%), Positives = 54/75 (72%)

Query: 257 NDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDP 316
           +  +L K KL +L+R+VD   Q+DE+V +   +IA+DF++++V  ACQLA+HR SSTL+ 
Sbjct: 2   SHMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEV 61

Query: 317 KDLQFVLAKDWNISI 331
           KD+Q  L + WN+ I
Sbjct: 62  KDVQLHLERQWNMWI 76
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 99.97
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 98.37
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 98.35
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 98.31
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 98.27
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 98.26
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 98.19
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 98.15
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 97.99
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 97.97
1taf_A68 TFIID TBP associated factor 42; transcription init 97.87
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 97.71
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 97.65
1f1e_A154 Histone fold protein; archaeal histone protein, DN 97.64
3r45_A156 Histone H3-like centromeric protein A; histone fol 97.6
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 97.54
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 97.46
1taf_B70 TFIID TBP associated factor 62; transcription init 97.39
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 97.37
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 97.35
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.26
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 97.15
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 97.13
1f1e_A154 Histone fold protein; archaeal histone protein, DN 97.07
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 97.06
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 96.97
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 96.89
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 96.87
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 96.77
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 96.69
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 96.32
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 96.29
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 96.2
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 96.15
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 96.11
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 95.92
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 95.86
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 94.13
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 94.04
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 93.85
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 93.64
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 93.57
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 92.45
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 92.3
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 91.91
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 91.78
1v54_K56 IHQ, cytochrome C oxidase polypeptide VIIB; oxidor 86.32
2y69_K80 Cytochrome C oxidase polypeptide 7B; electron tran 82.47
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
Probab=99.97  E-value=1.9e-32  Score=217.13  Aligned_cols=76  Identities=46%  Similarity=0.786  Sum_probs=73.1

Q ss_pred             CCCCCCChhHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCCCCchhhHHHhhhccCccc
Q psy14441        256 PNDQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISI  331 (365)
Q Consensus       256 ~~~~VL~KrkLqeLVrqIDp~e~LD~dVEElLLeLADDFVdsVvs~AC~LAKHRkSdtLEvkDVql~LER~wNI~I  331 (365)
                      ++++||+|++|++||++|||+++|||||||+|+++|||||++|+++||+|||||||++||+|||||||||+|||+|
T Consensus         1 ~s~~vl~k~~L~~Lv~~idp~~~ld~~vee~ll~lADdFV~~V~~~ac~lAKhR~s~~le~kDvql~Ler~wni~i   76 (76)
T 1h3o_B            1 GSHMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI   76 (76)
T ss_dssp             --CCSSCHHHHHHHHHHHCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEECHHHHHHHHHHHTCCCC
T ss_pred             CCcccccHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCccHHHHHHHHHhhcCCcC
Confidence            3679999999999999999999999999999999999999999999999999999999999999999999999986
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>1v54_K IHQ, cytochrome C oxidase polypeptide VIIB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.23.5.1 PDB: 1oco_K* 1occ_K* 1ocz_K* 1ocr_K* 1v55_K* 2dyr_K* 2dys_K* 2eij_K* 2eik_K* 2eil_K* 2eim_K* 2ein_K* 2occ_K* 2ybb_V* 2zxw_K* 3abk_K* 3abl_K* 3abm_K* 3ag1_K* 3ag2_K* ... Back     alignment and structure
>2y69_K Cytochrome C oxidase polypeptide 7B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d1h3ob_74 a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), hi 8e-30
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 2e-05
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 2e-05
d2huec182 a.22.1.1 (C:20-101) Histone H4 {African clawed fro 7e-05
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 2e-04
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  107 bits (269), Expect = 8e-30
 Identities = 35/74 (47%), Positives = 53/74 (71%)

Query: 258 DQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPK 317
             +L K KL +L+R+VD   Q+DE+V +   +IA+DF++++V  ACQLA+HR SSTL+ K
Sbjct: 1   HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK 60

Query: 318 DLQFVLAKDWNISI 331
           D+Q  L + WN+ I
Sbjct: 61  DVQLHLERQWNMWI 74
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 82 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 99.97
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.32
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 98.12
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 97.97
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 97.62
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 97.57
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 97.48
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 97.34
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 97.3
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 97.05
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 96.74
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 96.49
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 96.25
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 95.89
d1q9ca_172 Histone domain of Son of sevenless protein {Human 93.38
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 91.2
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 90.24
d1v54k_49 Mitochondrial cytochrome c oxidase subunit VIIb {C 86.12
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 84.3
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=9.7e-33  Score=216.28  Aligned_cols=74  Identities=47%  Similarity=0.810  Sum_probs=72.7

Q ss_pred             CCCCChhHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCCCCchhhHHHhhhccCccc
Q psy14441        258 DQILGKDKLDELMRQVDSTLQIDEEVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISI  331 (365)
Q Consensus       258 ~~VL~KrkLqeLVrqIDp~e~LD~dVEElLLeLADDFVdsVvs~AC~LAKHRkSdtLEvkDVql~LER~wNI~I  331 (365)
                      ++||+|++|+|||++|||++.||++|||+|+++|||||++|+++||+|||||||++||+|||||||||+|||+|
T Consensus         1 ~~il~K~~L~eLv~~idp~~~ld~~vee~ll~iADdFV~~V~~~ac~lAKhR~s~~le~kDvql~LeR~wNm~i   74 (74)
T d1h3ob_           1 HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI   74 (74)
T ss_dssp             CCSSCHHHHHHHHHHHCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEECHHHHHHHHHHHTCCCC
T ss_pred             CccccHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCcHHHHHHHHHhhcCccC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999986
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v54k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure