Psyllid ID: psy1482

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------

MQHKKGKAKSEIQKDEVLQAVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKKKGQSKSSWKEDLIVAYECDSKKLLMHQTPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKYRRNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKLPSAGADEVDDGNNDSDEEEVPKFKCESEQELDSDESDSESENDVDSVDGQGTPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPSSLRKSVEPFVKWLLEADEESEEDD

cccccccccccccccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHcccccccEEEEEEEEcccccccccccEEEEEEccccEEEEEEccccccccEEEEHHHHcccccEEEEccccccEEEEEccccccccccccccccccccHHHHHHHccccccEEEEEEEcccccEEEcccHHHHHHHHHHHHcccccccccccEEEcccEEEcccEEEccccEEcccEEEccccEEccccEEcccEEccccEEccccEEEcEEEccccEEccccEEEccEEEcccEEccccEEcccEEEccccEEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccc

cccccccccccccccccEEEEEEEcccccEEcccccccccccHccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEccEEEcccHHHHHHHHHHHHHHcccHHHHEEEEccccccccccccEEEEEcccccEEEEEEcccccccEEcccHHHHcccccEEEEcccccccEEEccccHHHHcccccccccHHHHHHHHHccccccccEEEEEEEcccccEEEcccHHHHHHHHHHHHHcccccccccccEccccEEEcccEEEccccEEcccEEEcEccEEccccEEEEEEEEEcEEEccccEEEcEEEEccEEEcccEEEEEEEEEccEEEcccEEEcccEEEEccEEEcccEEEcccccccEccccccccccccccHHHcccccccHHHccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccc

mqhkkgkakseiqkDEVLQAVIVTDtfnrnffpvpepycllplVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSdgcysfgdvmrdldgkavirndFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKkkgqsksswKEDLIVAYECDskkllmhqtpqdnqkkvnipmenILLYSKLEICAHLAStgimicspavpplfsdnfdfqtQEHFIKGVLINEEILDCRLYCSvvddieygisvkdwpsyqiasrDIVQrwvhpfvpsykyrrnniylaEDVLIGKTSVLKQQVVigegssigentqlshciigrnctigsnvrleksylfdnvkiednceVRLSVLSYntgvgehsklLNGCLlgtgvlignktclsgvklpsagadevddgnndsdeeevpkfkceseqeldsdesdsesendvdsvdgqgtppmddtslFYTEVVDSLLRGYEEklvcdnltleinssryaYNVTVKEVNFYMVKAILVvknkpdmdmKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHklydkdilsedIVTKWFnklepsslrksVEPFVKWLLEAdeeseedd

mqhkkgkakseiqkdevLQAVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKkkgqsksswkeDLIVAYECDSKKLLmhqtpqdnqkkvnIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKYRRNNIYLAEDVLIGKTSVLKQQVVIGegssigentqlsHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKLPsagadevddgnndsdeeevpkfkceseqeldsdesdsesendvdsvdgqgtppmddtsLFYTEVVDSLLRGYEEKLVcdnltleinssryaynvTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWfnklepsslrksvepfVKWLLeadeeseedd

MQHKKGKAKSEIQKDEVLQAVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKKKGQSKSSWKEDLIVAYECDSKKLLMHQTPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKYRRNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKLPSAGADEVDDGNNDSDEEEVPKFKCeseqeldsdesdsesendvdsvdGQGTPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPSSLRKSVEPFVKWLLeadeeseedd

***************EVLQAVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKKKGQSKSSWKEDLIVAYECDSKKLLMH********KVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKYRRNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVK***********************************************************SLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPSSLRKSVEPFVKWLL**********

*******************AVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYK********WKEDLIVAYECDSKKLLMHQTPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKY*****Y****VLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKL*********************************************************TSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILV**************HMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEP*SLRKSVEPFVKW************

************QKDEVLQAVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKK********KEDLIVAYECDSKKLLMHQTPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKYRRNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKLPSAGAD******************************************GQGTPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPSSLRKSVEPFVKWLLE*********

**************DEVLQAVIVTDTFNRNFFPVPEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVLYKKKGQSKSSWKEDLIVAYECDSKKLLMHQTPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPSYKYRRNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKLPSA********************KCESEQELDSDESDSESE*********GTPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPSSLRKSVEPFVKWLLEA********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		627	2.2.26 [Sep-21-2011]
Q64350		716	Translation initiation fa	yes	N/A	0.964	0.844	0.327	6e-93
P47823		721	Translation initiation fa	yes	N/A	0.931	0.809	0.317	6e-91
Q8CHW4		717	Translation initiation fa	yes	N/A	0.942	0.824	0.319	1e-89
P56287		678	Probable translation init	yes	N/A	0.945	0.874	0.288	5e-71
Q54RF3		707	Translation initiation fa	yes	N/A	0.960	0.851	0.294	5e-70
P32501		712	Translation initiation fa	yes	N/A	0.982	0.865	0.285	2e-65
P87163		732	Translation initiation fa	N/A	N/A	0.669	0.573	0.337	1e-64
Q13144		721	Translation initiation fa	yes	N/A	0.610	0.531	0.349	2e-62
P56288		458	Probable translation init	no	N/A	0.596	0.816	0.203	7e-12
Q9C8F1		439	Probable eukaryotic trans	no	N/A	0.149	0.214	0.348	1e-07

>sp\|Q64350\|EI2BE_RAT Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus GN=Eif2b5 PE=1 SV=2	Back alignment and function desciption

 Score =  342 bits (876), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 224/684 (32%), Positives = 371/684 (54%), Gaps = 79/684 (11%)

Query: 18  LQAVIVTDTFNRNFFPVP--EPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQI 75
           LQAV+V D+F+R FFP+   +P  LLPL N  L++YTLE L  +G++E  VFC     QI
Sbjct: 38  LQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQI 97

Query: 76  RELVKRKEKSLVGTL--ITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLL 133
           +E +++ +     +L  + +I SD   S GDV+RD+D KA++R+DF+L+ GDVVSNIN+ 
Sbjct: 98  KEHLQKSKWCHPTSLNVVRIITSDLYRSLGDVLRDVDAKALVRSDFLLIYGDVVSNINIS 157

Query: 134 SALKSFKKINSMDSG-AVALVLYKKKGQSKSS--WKEDLIVAYECDSKKLLMHQTPQDNQ 190
            AL+  +    ++   +V  +++K+   S  +   ++++++A +  + ++L  Q  Q   
Sbjct: 158 KALEEHRLRRKLEKNVSVMTMVFKESSPSHPTRCHEDNVVLAVDSTTNRILHFQKTQ-GL 216

Query: 191 KKVNIPMENILLYSKL---EICAHLASTGIMICSPAVPPLFSDNFDFQTQEHFIKGVLIN 247
           +  + P+   L    L   EI   L    I ICSP V  LF+DNFD+QT++ F++G+L+N
Sbjct: 217 RHFSFPLG--LFQGSLDGVEIRYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVN 274

Query: 248 EEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVP----------SYKYR 297
           EEIL  +++  V    EYG  V +   Y     D+++RWV+P  P          SY + 
Sbjct: 275 EEILGNQIHLHVTSR-EYGARVSNLHMYSAVCADVIRRWVYPLTPEVNFTDSSTQSYTHS 333

Query: 298 RNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFD 357
           R+NIY   +V +G  SVL++ V++G G+ +G N  +++ +IG NC IG NV L+++YL+ 
Sbjct: 334 RHNIYRGPEVSLGHGSVLEENVLLGAGTVVGSNCSITNSVIGPNCHIGDNVVLDQAYLWQ 393

Query: 358 NVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLS-----GVKLPSAGA 412
            V++    ++  S+L     V E   L   C+L + V++G    L       +  P A  
Sbjct: 394 GVRVAAGAQIHQSLLCDRAEVKERVILKPHCVLTSQVVVGPDIILPEGSVISLHPPDAEE 453

Query: 413 DE-----VDDGNNDSDEEEVPKFKCESEQELDSD-------------------------- 441
           DE      DD   D ++E+V K K  +  E+  +                          
Sbjct: 454 DEDDGQFSDDSGADQEKEKV-KLKGYNPAEVGPEGQGYLWKAEDVDEKEDEELRQSLWGL 512

Query: 442 --------ESDSESENDVDSVDGQ-GTPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLE 492
                   E++SE   D + +D + G+P +DD  +F  EV+ +L RG EE + CDNL LE
Sbjct: 513 MINMEEESETESERSVDPEELDSRAGSPQLDDIRVFQNEVLGTLQRGREENISCDNLVLE 572

Query: 493 INSSRYAYNVTVKEVNFYMVKAIL---VVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIK 549
           INS +YAYN+++KEV   +   +L   + +    +D   +   ++  +  + P+F+NYIK
Sbjct: 573 INSLKYAYNISLKEVMQVLSHVVLEFPLQQVDGVLDPNRYCALLLPLLKAWSPVFRNYIK 632

Query: 550 NESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPS----SL 605
             +   + L A E+F  E+E+L     K+L   Y  +IL+E+ +  WF++ + +     L
Sbjct: 633 RAADHLEALAAIEDFFLEHETLVPSLAKVLMAFYQLEILAEETILSWFSQRDITDKGQQL 692

Query: 606 RKS--VEPFVKWLLEADEESEEDD 627
           RK+  ++ F++WL EA+EES +DD
Sbjct: 693 RKNQQLQRFIQWLREAEEESSDDD 716

Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Rattus norvegicus (taxid: 10116)

>sp\|P47823\|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1	Back alignment and function description

>sp\|Q8CHW4\|EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus GN=Eif2b5 PE=1 SV=1	Back alignment and function description

>sp\|P56287\|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1	Back alignment and function description

>sp\|Q54RF3\|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1	Back alignment and function description

>sp\|P32501\|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1	Back alignment and function description

>sp\|P87163\|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2	Back alignment and function description

>sp\|Q13144\|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3	Back alignment and function description

>sp\|P56288\|EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif223 PE=1 SV=2	Back alignment and function description

>sp\|Q9C8F1\|IF5Y_ARATH Probable eukaryotic translation initiation factor 5-1 OS=Arabidopsis thaliana GN=At1g36730 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		627
170054220		665	translation initiation factor eIF-2B sub	0.950	0.896	0.354	1e-117
312385013		661	hypothetical protein AND_01275 [Anophele	0.952	0.903	0.357	1e-112
157110619		666	eukariotic translation initiation factor	0.971	0.914	0.365	1e-110
321458002		691	hypothetical protein DAPPUDRAFT_62668 [D	0.961	0.872	0.361	1e-108
307188984		635	Translation initiation factor eIF-2B sub	0.956	0.944	0.368	1e-108
443701750		690	hypothetical protein CAPTEDRAFT_153443 [	0.971	0.882	0.338	1e-108
91081755		630	PREDICTED: similar to translation initia	0.936	0.931	0.365	1e-107
332021419		634	Translation initiation factor eIF-2B sub	0.955	0.944	0.357	1e-107
380013016		639	PREDICTED: translation initiation factor	0.961	0.943	0.356	1e-106
322800340		637	hypothetical protein SINV_02589 [Solenop	0.964	0.949	0.356	1e-106

>gi\|170054220\|ref\|XP_001863026.1\| translation initiation factor eIF-2B subunit epsilon [Culex quinquefasciatus] gi\|167874546\|gb\|EDS37929.1\| translation initiation factor eIF-2B subunit epsilon [Culex quinquefasciatus]	Back alignment and taxonomy information

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 234/661 (35%), Positives = 373/661 (56%), Gaps = 65/661 (9%)

Query: 10  SEIQKDEVLQAVIVTDTFNRNFFPVPE--PYCLLPLVNKCLLEYTLEHLHLSGIEEIIVF 67
           +++ K E +QA+++ D+FN  F P  +  P  LLPLVN  L++Y LE L+ SG+EE+IVF
Sbjct: 2   NQLDKKEPVQAILIADSFNDCFVPFSDRKPLSLLPLVNVPLVDYALESLNRSGVEEVIVF 61

Query: 68  CTSHVNQIRELVKRKEKSL-----VGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILV 122
           C++HV+Q+R  ++ ++++      VG  ++++ S+GC   GD +RDLD K ++R +FIL 
Sbjct: 62  CSAHVDQVRGYIRSQQQNPSCSWNVGMTVSIVSSEGCRCMGDALRDLDAKGLVRGNFILT 121

Query: 123 SGDVVSNINLLSALKSFKKINSMDSGAVALVLYKKKGQSKSSWKEDLIVAYECDSKKLLM 182
             D ++N NL + L+  K+I   D GA   V+YK+ G        ++++A E ++++LL 
Sbjct: 122 GVDTLTNANLAAILEEHKRIAKTDKGAAMTVVYKE-GVPDQRTGNEVMIAMEKNTRRLLF 180

Query: 183 HQ--TPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSDNFDFQTQEHF 240
           HQ   P+  ++K   PME IL   ++ +   L    I ICS    PLFSDNFDF T++ F
Sbjct: 181 HQRLNPKHKERKFTFPMEIILENKEVTMWHGLIDPQIAICSNTALPLFSDNFDFLTRDDF 240

Query: 241 IKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPS------- 293
           ++G+LINEEIL   +Y + +   EY + V +W +YQIASRD+  R+V+P VP        
Sbjct: 241 VRGLLINEEILASTIYVAPLPAEEYALRVNNWHNYQIASRDVTNRFVYPLVPDMGICGSE 300

Query: 294 --YKYRRNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLE 351
             Y + RNNIY   ++ + + + L+  VVIGE   I E+T ++H ++G+ C IG N +L 
Sbjct: 301 QLYSFSRNNIYRHRNIRLARRATLESDVVIGEKCEIDEDTVVAHSVLGKGCKIGKNCQLR 360

Query: 352 KSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIGNKTCLSGVKLPSAG 411
             +L D V++EDNC +   +++ N  +G    L  GC+LG  V++     L+ + L S  
Sbjct: 361 NCFLLDGVQVEDNCVLNHCIIAENVILGPGCNLTEGCVLGPEVVLPKGMTLAKITLQSTK 420

Query: 412 ADE---------------VDDGNNDSDEE--------------------EVPKFKCESEQ 436
            D+                D+   D+DEE                    E+P+   ES  
Sbjct: 421 PDDDWSDAKPIAEHAFTVPDETEGDADEEPDSDAEDIQDVATGYPMRLGELPRTSPESIY 480

Query: 437 ELDSDESDSESENDVDSVDGQGTPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSS 496
            + S+E +S +           +P  DD ++F +EV++SL RG+ EK   + L LEINSS
Sbjct: 481 SMSSEEDESRA----------ASPIQDDANIFLSEVLESLKRGFSEKSNPEYLILEINSS 530

Query: 497 RYAYNVTVKEVNFYMVKAILVVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQD 556
           RYAYN+ + EVNF++VKAIL +    +    +  + +   + YF P+FKNYI+ + A  D
Sbjct: 531 RYAYNMALSEVNFFVVKAILQLTLAQEGAATALVSTLAKLLGYFGPVFKNYIRGQPAMLD 590

Query: 557 CLDAFEEFA-EENESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLEPSSLRKSVEPFVKW 615
           CL A EE A EE  ++      ++H LY+KD ++E+ + +W   +E    RK++   V+W
Sbjct: 591 CLKALEEVAGEEPATVGAKIAAVVHFLYEKDYVAEEAILEWHGGIEEEDTRKALAKLVEW 650

Query: 616 L 616
           L
Sbjct: 651 L 651

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|312385013\|gb\|EFR29607.1\| hypothetical protein AND_01275 [Anopheles darlingi]	Back alignment and taxonomy information

>gi\|157110619\|ref\|XP_001651177.1\| eukariotic translation initiation factor 2b, epsilon subunit [Aedes aegypti] gi\|108878647\|gb\|EAT42872.1\| AAEL005636-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|321458002\|gb\|EFX69078.1\| hypothetical protein DAPPUDRAFT_62668 [Daphnia pulex]	Back alignment and taxonomy information

>gi\|307188984\|gb\|EFN73501.1\| Translation initiation factor eIF-2B subunit epsilon [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|443701750\|gb\|ELU00049.1\| hypothetical protein CAPTEDRAFT_153443 [Capitella teleta]	Back alignment and taxonomy information

>gi\|91081755\|ref\|XP_972918.1\| PREDICTED: similar to translation initiation factor eIF-2B subunit epsilon [Tribolium castaneum] gi\|270006269\|gb\|EFA02717.1\| hypothetical protein TcasGA2_TC008441 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|332021419\|gb\|EGI61787.1\| Translation initiation factor eIF-2B subunit epsilon [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|380013016\|ref\|XP_003690567.1\| PREDICTED: translation initiation factor eIF-2B subunit epsilon-like [Apis florea]	Back alignment and taxonomy information

>gi\|322800340\|gb\|EFZ21344.1\| hypothetical protein SINV_02589 [Solenopsis invicta]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		627
UNIPROTKB\|C0H8R1		702	EI2BE "Translation initiation	0.674	0.602	0.376	1.1e-97
ZFIN\|ZDB-GENE-030131-5364		703	eif2b5 "eukaryotic translation	0.655	0.584	0.364	4.3e-94
FB\|FBgn0023512		669	eIF2B-epsilon "eIF2B-epsilon"	0.618	0.579	0.349	2.7e-92
UNIPROTKB\|E1BPB3		728	EIF2B5 "Uncharacterized protei	0.655	0.564	0.352	1e-90
UNIPROTKB\|F1P6G3		721	EIF2B5 "Uncharacterized protei	0.673	0.585	0.353	5.6e-90
UNIPROTKB\|P47823		721	EIF2B5 "Translation initiation	0.676	0.588	0.342	2.4e-89
UNIPROTKB\|Q13144		721	EIF2B5 "Translation initiation	0.674	0.586	0.349	6.3e-89
RGD\|708380		716	Eif2b5 "eukaryotic translation	0.671	0.587	0.350	1.3e-88
MGI\|MGI:2446176		717	Eif2b5 "eukaryotic translation	0.673	0.588	0.353	1.7e-88
UNIPROTKB\|E9PC74		705	EIF2B5 "Translation initiation	0.674	0.6	0.349	2.4e-87

UNIPROTKB\|C0H8R1 EI2BE "Translation initiation factor eIF-2B subunit epsilon" [Salmo salar (taxid:8030)]	Back alignment and assigned GO terms

 Score = 711 (255.3 bits), Expect = 1.1e-97, Sum P(2) = 1.1e-97
 Identities = 169/449 (37%), Positives = 262/449 (58%)

Query:     2 QHKKGKAKSEIQKDEVLQAVIVTDTFNRNFFPVP--EPYCLLPLVNKCLLEYTLEHLHLS 59
             Q K      + ++++ LQAV+V D+FNR FFP+   +P  LLPL N  +++YTLE L  +
Sbjct:     8 QKKGNVTSEQEEEEQPLQAVLVADSFNRRFFPISKDQPRALLPLGNVAMIDYTLEFLTST 67

Query:    60 GIEEIIVFCTSHVNQIRE-LVKRKE-KSLVGTLITLIVSDGCYSFGDVMRDLDGKAVIRN 117
             G++E  VFC    N+I++ L+K K  +     ++ +I SD   S GDV+RD+D K ++RN
Sbjct:    68 GVQETFVFCCWMSNKIKDHLLKSKWCRPTSPNVVHIITSDLYRSLGDVLRDVDAKNLVRN 127

Query:   118 DFILVSGDVVSNINLLSALKSFKKINSMDSG-AVALVLYKKKGQS-KSSWKED-LIVAYE 174
             DFILV GDVVSNI++  AL+  +    +D   +V  +++K+     KS  +ED +IV  +
Sbjct:   128 DFILVYGDVVSNIDVSQALQEHRHRRKVDKNISVMTMVFKESSPGHKSRCEEDDVIVVMD 187

Query:   175 CDSKKLLMHQTPQDNQKKVNIPMENILLYS--KLEICAHLASTGIMICSPAVPPLFSDNF 232
               SK++L +Q  Q   KK+  PM NI  +   + E+   L    I ICSP V  LF+DNF
Sbjct:   188 SKSKRVLHYQKTQ-GLKKLQFPM-NIFQHGSDEFEVRHDLLDCHISICSPQVAELFTDNF 245

Query:   233 DFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVP 292
             D+QT+  F++G+L+NEEIL  +++  V  D  YG  V +   Y   S D+V+RWV+P  P
Sbjct:   246 DYQTRNDFVRGILVNEEILGNQIHLYVTQD-GYGARVSNLQMYDSVSSDMVRRWVYPLTP 304

Query:   293 SYKYR----------RNNIYLAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNC 342
                +           R+N+Y   +V +G  S +++ V+IG  +SIG N  +S+ IIG NC
Sbjct:   305 EANFTDQQGQGCTHSRHNVYRGAEVSLGHGSQMEENVLIGRDTSIGANCHISNSIIGNNC 364

Query:   343 TIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHSKLLNGCLLGTGVLIG-NKTC 401
             TIG NV L+++Y+++NV I  N E+  SV+     V E  +L   C+L   V+IG N + 
Sbjct:   365 TIGDNVVLDRAYMWNNVHISSNVEIHQSVVCDGAVVKEAVRLNKQCVLAYNVVIGPNLSL 424

Query:   402 LSGVKLPSAGADEVDDGNND---SDEEEV 427
               G  +     +E ++ ++D   SD++EV
Sbjct:   425 PEGTVVSMHHPEEEEEDDDDEFLSDDQEV 453

GO:0005737 "cytoplasm" evidence=ISS

GO:0005851 "eukaryotic translation initiation factor 2B complex" evidence=ISS

GO:0006413 "translational initiation" evidence=ISS

GO:0006950 "response to stress" evidence=ISS

GO:0009408 "response to heat" evidence=ISS

GO:0014002 "astrocyte development" evidence=ISS

GO:0014003 "oligodendrocyte development" evidence=ISS

GO:0042552 "myelination" evidence=ISS

GO:0048708 "astrocyte differentiation" evidence=ISS

GO:0051716 "cellular response to stimulus" evidence=ISS

GO:0003743 "translation initiation factor activity" evidence=ISS

GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=ISS

ZFIN\|ZDB-GENE-030131-5364 eif2b5 "eukaryotic translation initiation factor 2B, subunit 5 epsilon" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

FB\|FBgn0023512 eIF2B-epsilon "eIF2B-epsilon" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BPB3 EIF2B5 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P6G3 EIF2B5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P47823 EIF2B5 "Translation initiation factor eIF-2B subunit epsilon" [Oryctolagus cuniculus (taxid:9986)]	Back alignment and assigned GO terms

UNIPROTKB\|Q13144 EIF2B5 "Translation initiation factor eIF-2B subunit epsilon" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|708380 Eif2b5 "eukaryotic translation initiation factor 2B, subunit 5 epsilon" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:2446176 Eif2b5 "eukaryotic translation initiation factor 2B, subunit 5 epsilon" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E9PC74 EIF2B5 "Translation initiation factor eIF-2B subunit epsilon" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P56287	EI2BE_SCHPO	No assigned EC number	0.2885	0.9457	0.8746	yes	N/A
P32501	EI2BE_YEAST	No assigned EC number	0.2853	0.9824	0.8651	yes	N/A
Q54RF3	EI2BE_DICDI	No assigned EC number	0.2943	0.9601	0.8514	yes	N/A
P47823	EI2BE_RABIT	No assigned EC number	0.3177	0.9314	0.8099	yes	N/A
Q8CHW4	EI2BE_MOUSE	No assigned EC number	0.3195	0.9425	0.8242	yes	N/A
Q64350	EI2BE_RAT	No assigned EC number	0.3274	0.9649	0.8449	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.7	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		627
cd04197		217	cd04197, eIF-2B_epsilon_N, The N-terminal domain o	2e-57
cd11558		169	cd11558, W2_eIF2B_epsilon, C-terminal W2 domain of	2e-50
cd02507		216	cd02507, eIF-2B_gamma_N_like, The N-terminal of eI	7e-45
COG1208		358	COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph	9e-30
cd05787		79	cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit	1e-26
cd03356		79	cd03356, LbH_G1P_AT_C_like, Left-handed parallel b	5e-19
smart00515		83	smart00515, eIF5C, Domain at the C-termini of GCD6	2e-18
cd11561		157	cd11561, W2_eIF5, C-terminal W2 domain of eukaryot	2e-16
cd04652		81	cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit,	2e-16
pfam02020		75	pfam02020, W2, eIF4-gamma/eIF5/eIF2-epsilon	6e-15
cd04198		214	cd04198, eIF-2B_gamma_N, The N-terminal domain of	3e-13
cd03352		205	cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl	3e-11
cd04181		217	cd04181, NTP_transferase, NTP_transferases catalyz	1e-10
cd03352		205	cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl	4e-10
COG1044		338	COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	4e-10
COG1044		338	COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	4e-10
cd03353		193	cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph	7e-10
cd05636		163	cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho	2e-09
PRK00892		343	PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco	3e-09
COG1044		338	COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	9e-09
cd04645		153	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra	2e-08
TIGR01853		324	TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo	3e-08
TIGR01173		451	TIGR01173, glmU, UDP-N-acetylglucosamine diphospho	4e-08
cd04651		104	cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly	5e-08
cd11560		194	cd11560, W2_eIF5C_like, C-terminal W2 domain of th	8e-08
cd05824		80	cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate	1e-07
cd03358		119	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p	4e-07
TIGR01853		324	TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo	7e-07
TIGR01173		451	TIGR01173, glmU, UDP-N-acetylglucosamine diphospho	7e-07
cd00208		78	cd00208, LbetaH, Left-handed parallel beta-Helix (	2e-06
PRK14354		458	PRK14354, glmU, bifunctional N-acetylglucosamine-1	2e-06
PRK00892		343	PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco	3e-06
cd02523		229	cd02523, PC_cytidylyltransferase, Phosphocholine c	3e-06
COG1207		460	COG1207, GlmU, N-acetylglucosamine-1-phosphate uri	4e-06
cd03360		197	cd03360, LbH_AT_putative, Putative Acyltransferase	8e-06
cd06422		221	cd06422, NTP_transferase_like_1, NTP_transferase_l	8e-06
TIGR03570		193	TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia	9e-06
TIGR02091		361	TIGR02091, glgC, glucose-1-phosphate adenylyltrans	1e-05
pfam00132		36	pfam00132, Hexapep, Bacterial transferase hexapept	1e-05
PRK14357		448	PRK14357, glmU, bifunctional N-acetylglucosamine-1	1e-05
PRK14353		446	PRK14353, glmU, bifunctional N-acetylglucosamine-1	1e-05
COG0448		393	COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb	1e-05
COG0663		176	COG0663, PaaY, Carbonic anhydrases/acetyltransfera	2e-05
COG0663		176	COG0663, PaaY, Carbonic anhydrases/acetyltransfera	2e-05
COG1213		239	COG1213, COG1213, Predicted sugar nucleotidyltrans	2e-05
TIGR01852		254	TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei	3e-05
TIGR02091		361	TIGR02091, glgC, glucose-1-phosphate adenylyltrans	4e-05
PRK05289		262	PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr	4e-05
cd03351		254	cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin	6e-05
PRK02862		429	PRK02862, glgC, glucose-1-phosphate adenylyltransf	1e-04
COG1043		260	COG1043, LpxA, Acyl-[acyl carrier protein]	1e-04
PRK14355		459	PRK14355, glmU, bifunctional N-acetylglucosamine-1	2e-04
PRK05293		380	PRK05293, glgC, glucose-1-phosphate adenylyltransf	3e-04
cd04647		109	cd04647, LbH_MAT_like, Maltose O-acyltransferase (	4e-04
PRK14360		450	PRK14360, glmU, bifunctional N-acetylglucosamine-1	4e-04
PRK00844		407	PRK00844, glgC, glucose-1-phosphate adenylyltransf	5e-04
cd00208		78	cd00208, LbetaH, Left-handed parallel beta-Helix (	6e-04
cd04189		236	cd04189, G1P_TT_long, G1P_TT_long represents the l	6e-04
PRK12461		255	PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr	7e-04
TIGR03992		393	TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph	7e-04
cd04745		155	cd04745, LbH_paaY_like, paaY-like: This group is c	0.001
cd03350		139	cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyri	0.001
cd03352		205	cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl	0.002
TIGR03992		393	TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph	0.002
cd00208		78	cd00208, LbetaH, Left-handed parallel beta-Helix (	0.003
PRK12461		255	PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr	0.003

>gnl\|CDD\|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

 Score =  192 bits (490), Expect = 2e-57
 Identities = 84/217 (38%), Positives = 130/217 (59%), Gaps = 9/217 (4%)

Query: 18  LQAVIVTDTFNRNFFPVP--EPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSHVNQI 75
           LQAV++ D+FNR F P+   +P CLLPL N  L++YTLE L L+G+EE+ VFC SH +QI
Sbjct: 1   LQAVVLADSFNRRFRPLTKEKPRCLLPLANVPLIDYTLEFLALNGVEEVFVFCCSHSDQI 60

Query: 76  RELVKRKEKSLVGT---LITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINL 132
           +E +++ + S   +   ++ +I+S+ C S GD +RDLD K +IR DFILVSGDVVSNI+L
Sbjct: 61  KEYIEKSKWSKPKSSLMIVIIIMSEDCRSLGDALRDLDAKGLIRGDFILVSGDVVSNIDL 120

Query: 133 LSALKSFKKINSMDSGAVALVLYKKKG--QSKSSWKEDLIVAYECDSKKLLMHQTPQDNQ 190
              L+  K+    D  A+  ++ K+           E+ ++A +  + +LL ++    ++
Sbjct: 121 KEILEEHKERRKKDKNAIMTMVLKEASPPHRTRRTGEEFVIAVDPKTSRLLHYEELPGSK 180

Query: 191 KKVNIPMENILLY--SKLEICAHLASTGIMICSPAVP 225
            +    + + LL   S++EI   L    I ICSP V 
Sbjct: 181 YRSITDLPSELLGSNSEVEIRHDLLDCHIDICSPDVL 217

N-terminal domain of epsilon subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 217

>gnl\|CDD\|211396 cd11558, W2_eIF2B_epsilon, C-terminal W2 domain of eukaryotic translation initiation factor 2B epsilon	Back alignment and domain information

>gnl\|CDD\|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>gnl\|CDD\|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>gnl\|CDD\|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>gnl\|CDD\|214705 smart00515, eIF5C, Domain at the C-termini of GCD6, eIF-2B epsilon, eIF-4 gamma and eIF-5	Back alignment and domain information

>gnl\|CDD\|211399 cd11561, W2_eIF5, C-terminal W2 domain of eukaryotic translation initiation factor 5	Back alignment and domain information

>gnl\|CDD\|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>gnl\|CDD\|216850 pfam02020, W2, eIF4-gamma/eIF5/eIF2-epsilon	Back alignment and domain information

>gnl\|CDD\|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>gnl\|CDD\|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>gnl\|CDD\|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>gnl\|CDD\|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>gnl\|CDD\|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>gnl\|CDD\|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>gnl\|CDD\|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>gnl\|CDD\|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>gnl\|CDD\|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>gnl\|CDD\|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>gnl\|CDD\|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|211398 cd11560, W2_eIF5C_like, C-terminal W2 domain of the eukaryotic translation initiation factor 5C and similar proteins	Back alignment and domain information

>gnl\|CDD\|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>gnl\|CDD\|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>gnl\|CDD\|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>gnl\|CDD\|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>gnl\|CDD\|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>gnl\|CDD\|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>gnl\|CDD\|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats)	Back alignment and domain information

>gnl\|CDD\|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>gnl\|CDD\|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>gnl\|CDD\|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223973 COG1043, LpxA, Acyl-[acyl carrier protein]	Back alignment and domain information

>gnl\|CDD\|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>gnl\|CDD\|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>gnl\|CDD\|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>gnl\|CDD\|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>gnl\|CDD\|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>gnl\|CDD\|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>gnl\|CDD\|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		627
KOG1461\|consensus		673		100.0
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	100.0
PLN02241		436	glucose-1-phosphate adenylyltransferase	100.0
KOG1462\|consensus		433		100.0
KOG1322\|consensus		371		100.0
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	100.0
KOG1460\|consensus		407		100.0
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	100.0
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	100.0
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	100.0
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	100.0
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	100.0
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
COG1209		286	RfbA dTDP-glucose pyrophosphorylase [Cell envelope	100.0
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
cd04197		217	eIF-2B_epsilon_N The N-terminal domain of epsilon	100.0
cd04198		214	eIF-2B_gamma_N The N-terminal domain of gamma subu	100.0
TIGR01105		297	galF UTP-glucose-1-phosphate uridylyltransferase,	100.0
cd02507		216	eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma	99.97
PRK10122		297	GalU regulator GalF; Provisional	99.97
PF00483		248	NTP_transferase: Nucleotidyl transferase This Pros	99.97
cd06428		257	M1P_guanylylT_A_like_N N-terminal domain of M1P_gu	99.97
cd06425		233	M1P_guanylylT_B_like_N N-terminal domain of the M1	99.97
PRK15480		292	glucose-1-phosphate thymidylyltransferase RfbA; Pr	99.97
cd02538		240	G1P_TT_short G1P_TT_short is the short form of glu	99.97
TIGR01207		286	rmlA glucose-1-phosphate thymidylyltransferase, sh	99.97
cd04189		236	G1P_TT_long G1P_TT_long represents the long form o	99.96
TIGR02623		254	G1P_cyt_trans glucose-1-phosphate cytidylyltransfe	99.96
PRK13389		302	UTP--glucose-1-phosphate uridylyltransferase subun	99.96
cd06422		221	NTP_transferase_like_1 NTP_transferase_like_1 is a	99.96
cd02541		267	UGPase_prokaryotic Prokaryotic UGPase catalyses th	99.96
cd06426		220	NTP_transferase_like_2 NTP_trnasferase_like_2 is a	99.96
cd02524		253	G1P_cytidylyltransferase G1P_cytidylyltransferase	99.95
TIGR01099		260	galU UTP-glucose-1-phosphate uridylyltransferase.	99.95
cd04181		217	NTP_transferase NTP_transferases catalyze the tran	99.95
cd06915		223	NTP_transferase_WcbM_like WcbM_like is a subfamily	99.95
COG1210		291	GalU UDP-glucose pyrophosphorylase [Cell envelope	99.93
KOG2297\|consensus		412		99.92
cd04183		231	GT2_BcE_like GT2_BcbE_like is likely involved in t	99.91
cd02508		200	ADP_Glucose_PP ADP-glucose pyrophosphorylase is in	99.9
cd02523		229	PC_cytidylyltransferase Phosphocholine cytidylyltr	99.9
cd02509		274	GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf	99.88
cd02540		229	GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	99.87
COG1213		239	Predicted sugar nucleotidyltransferases [Cell enve	99.86
PF02020		84	W2: eIF4-gamma/eIF5/eIF2-epsilon; InterPro: IPR003	99.85
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	99.84
PRK05450		245	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.81
cd02517		239	CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th	99.8
smart00515		83	eIF5C Domain at the C-termini of GCD6, eIF-2B epsi	99.8
PRK13368		238	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.74
COG4750		231	LicC CTP:phosphocholine cytidylyltransferase invol	99.69
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	99.69
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.66
KOG2767\|consensus		400		99.66
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	99.66
COG0836		333	{ManC} Mannose-1-phosphate guanylyltransferase [Ce	99.62
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.62
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.62
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.61
PRK13627		196	carnitine operon protein CaiE; Provisional	99.59
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	99.59
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.59
PLN02472		246	uncharacterized protein	99.58
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.57
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.56
PLN02296		269	carbonate dehydratase	99.56
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.56
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.56
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.54
PLN02917		293	CMP-KDO synthetase	99.54
PRK11132		273	cysE serine acetyltransferase; Provisional	99.53
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	99.53
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.53
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	99.53
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.51
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.51
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.51
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.51
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.49
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.49
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	99.49
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.48
KOG1461\|consensus		673		99.47
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.47
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	99.45
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.45
TIGR00454		183	conserved hypothetical protein TIGR00454. At this	99.44
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.44
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	99.44
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.43
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	99.42
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.42
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	99.42
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.42
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	99.42
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.42
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	99.41
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	99.4
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	99.4
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	99.4
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.4
TIGR00466		238	kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe	99.4
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	99.4
PLN02472		246	uncharacterized protein	99.38
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.38
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	99.38
PLN02296		269	carbonate dehydratase	99.37
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	99.36
PF12804		160	NTP_transf_3: MobA-like NTP transferase domain; PD	99.36
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	99.35
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	99.34
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	99.34
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.34
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.33
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	99.32
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.31
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	99.3
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	99.3
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.3
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	99.3
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	99.29
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	99.29
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	99.29
PRK13627		196	carnitine operon protein CaiE; Provisional	99.28
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	99.27
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	99.27
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	99.27
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	99.27
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	99.26
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	99.25
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.25
COG2266		177	GTP:adenosylcobinamide-phosphate guanylyltransfera	99.24
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	99.24
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	99.22
cd02513		223	CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-	99.22
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	99.22
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	99.21
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	99.2
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	99.2
TIGR00453		217	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.19
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	99.19
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	99.18
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	99.18
TIGR03310		188	matur_ygfJ molybdenum hydroxylase accessory protei	99.18
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	99.18
cd04182		186	GT_2_like_f GT_2_like_f is a subfamily of the glyc	99.18
KOG1462\|consensus		433		99.18
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.17
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.17
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	99.16
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	99.16
cd02516		218	CDP-ME_synthetase CDP-ME synthetase is involved in	99.13
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	99.13
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	99.13
PRK00155		227	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.12
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	99.11
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	99.08
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	99.08
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	99.08
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	99.05
PRK10502		182	putative acyl transferase; Provisional	99.04
PRK10502		182	putative acyl transferase; Provisional	99.03
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	99.01
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	99.0
PRK09382		378	ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp	98.98
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	98.96
PLN02694		294	serine O-acetyltransferase	98.94
KOG3121\|consensus		184		98.94
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	98.94
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	98.93
PRK13385		230	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	98.93
PRK10092		183	maltose O-acetyltransferase; Provisional	98.92
COG1212		247	KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase	98.92
TIGR03584		222	PseF pseudaminic acid CMP-transferase. The sequenc	98.91
PLN02241		436	glucose-1-phosphate adenylyltransferase	98.91
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	98.91
cd02503		181	MobA MobA catalyzes the formation of molybdopterin	98.91
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	98.9
KOG3121\|consensus		184		98.89
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	98.88
PRK10191		146	putative acyl transferase; Provisional	98.88
PLN02694		294	serine O-acetyltransferase	98.88
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	98.88
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	98.88
cd04180		266	UGPase_euk_like Eukaryotic UGPase-like includes UD	98.87
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.87
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.86
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	98.85
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	98.85
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.84
PRK10191		146	putative acyl transferase; Provisional	98.82
PLN02357		360	serine acetyltransferase	98.81
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.81
TIGR02665		186	molyb_mobA molybdopterin-guanine dinucleotide bios	98.81
PRK00317		193	mobA molybdopterin-guanine dinucleotide biosynthes	98.81
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.81
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	98.8
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	98.8
PRK10092		183	maltose O-acetyltransferase; Provisional	98.79
TIGR03202		190	pucB xanthine dehydrogenase accessory protein pucB	98.79
KOG1460\|consensus		407		98.77
PLN02728		252	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	98.77
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	98.77
PLN02357		360	serine acetyltransferase	98.75
cd04193		323	UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala	98.74
PRK11132		273	cysE serine acetyltransferase; Provisional	98.74
PLN02739		355	serine acetyltransferase	98.73
PLN02739		355	serine acetyltransferase	98.72
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.72
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.72
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	98.71
COG2068		199	Uncharacterized MobA-related protein [General func	98.7
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.7
PF01128		221	IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly	98.69
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.68
PTZ00339		482	UDP-N-acetylglucosamine pyrophosphorylase; Provisi	98.67
KOG1322\|consensus		371		98.67
KOG4042\|consensus		190		98.65
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	98.65
cd02518		233	GT2_SpsF SpsF is a glycosyltrnasferase implicated	98.64
PRK02726		200	molybdopterin-guanine dinucleotide biosynthesis pr	98.63
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	98.51
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.48
COG1211		230	IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt	98.45
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	98.39
PLN02474		469	UTP--glucose-1-phosphate uridylyltransferase	98.38
PRK14500		346	putative bifunctional molybdopterin-guanine dinucl	98.35
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	98.34
KOG4042\|consensus		190		98.29
COG0746		192	MobA Molybdopterin-guanine dinucleotide biosynthes	98.29
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	98.11
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	98.11
PRK00560		196	molybdopterin-guanine dinucleotide biosynthesis pr	98.08
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	98.08
KOG4750\|consensus		269		97.84
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	97.78
cd00897		300	UGPase_euk Eukaryotic UGPase catalyses the synthes	97.78
COG4801		277	Predicted acyltransferase [General function predic	97.73
KOG4750\|consensus		269		97.73
COG1083		228	NeuA CMP-N-acetylneuraminic acid synthetase [Cell	97.71
PLN02435		493	probable UDP-N-acetylglucosamine pyrophosphorylase	97.69
COG4801		277	Predicted acyltransferase [General function predic	97.67
PF02348		217	CTP_transf_3: Cytidylyltransferase; InterPro: IPR0	97.55
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	97.47
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	97.24
PF00132		36	Hexapep: Bacterial transferase hexapeptide (six re	97.19
cd06424		315	UGGPase UGGPase catalyzes the synthesis of UDP-Glu	97.17
PF01704		420	UDPGP: UTP--glucose-1-phosphate uridylyltransferas	97.04
COG4284		472	UDP-glucose pyrophosphorylase [Carbohydrate transp	96.98
COG1861		241	SpsF Spore coat polysaccharide biosynthesis protei	96.76
PRK13412		974	fkp bifunctional fucokinase/L-fucose-1-P-guanylylt	96.54
PLN02830		615	UDP-sugar pyrophosphorylase	96.44
PF09090		253	MIF4G_like_2: MIF4G like; InterPro: IPR015174 This	96.35
PRK00576		178	molybdopterin-guanine dinucleotide biosynthesis pr	95.67
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	95.14
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	94.59
KOG1104\|consensus		759		93.13
TIGR03552		195	F420_cofC 2-phospho-L-lactate guanylyltransferase	92.14
cd00761		156	Glyco_tranf_GTA_type Glycosyltransferase family A	91.82
PF04519		101	Bactofilin: Polymer-forming cytoskeletal; InterPro	87.78
COG1664		146	CcmA Integral membrane protein CcmA involved in ce	86.77
PF02847		113	MA3: MA3 domain; InterPro: IPR003891 This entry re	86.05
PRK13412		974	fkp bifunctional fucokinase/L-fucose-1-P-guanylylt	82.4

>KOG1461\|consensus	Back alignment and domain information

Probab=100.00  E-value=2e-119  Score=933.18  Aligned_cols=619  Identities=36%  Similarity=0.607  Sum_probs=540.0

Q ss_pred             CCCcccC-------CccccccCCceEEEEEeCCCCCCCCcC--CCCccccccCCeehHHHHHHHHHhCCCcEEEEEecCC
Q psy1482           1 MQHKKGK-------AKSEIQKDEVLQAVIVTDTFNRNFFPV--PEPYCLLPLVNKCLLEYTLEHLHLSGIEEIIVFCTSH   71 (627)
Q Consensus         1 ~~~~~~~-------~~~~~~~~~~~~aVIlA~g~g~R~~Pl--~~PK~Llpi~g~pli~~~l~~L~~~gi~~i~vv~~~~   71 (627)
                      |+||||.       +|.+...++.+|||+||+.|.+||+|+  .+|++||||+|.|||+|+|++|.++||++|+|+|+.|
T Consensus         1 M~~~k~~~~~~~~~~~~~~~~~~rLqAIllaDsf~trF~Plt~~~p~~LLPlaNVpmIdYtL~~L~~agV~eVfvfc~~~   80 (673)
T KOG1461|consen    1 MAKKKKRPAALGETGKEENFREHRLQAILLADSFETRFRPLTLEKPRVLLPLANVPMIDYTLEWLERAGVEEVFVFCSAH   80 (673)
T ss_pred             CCcccCcccccccCcccccccccceEEEEEeccchhcccccccCCCceEeeecCchHHHHHHHHHHhcCceEEEEEeccc
Confidence            7777752       122222378999999999999999999  9999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhccccc-CCeeEEEEeCCCCcchhhhhhcccccCCccCCEEEEeCCeeccccHHHHHHHHHHHhcCCCCce
Q psy1482          72 VNQIRELVKRKEKSL-VGTLITLIVSDGCYSFGDVMRDLDGKAVIRNDFILVSGDVVSNINLLSALKSFKKINSMDSGAV  150 (627)
Q Consensus        72 ~~~i~~~l~~~~~~~-~~~~v~~i~~~~~~~~gdalr~l~~~~~i~~dfll~~gD~i~~~~l~~~l~~h~~~~~~~~~~~  150 (627)
                      +.||++|+++++|.. ..+.+..+....++++|||||+++.++++++||+|++||+++|++|.+++++||+|+|.||+++
T Consensus        81 ~~qi~e~i~~sew~~~~~~~v~ti~s~~~~S~GDamR~id~k~litgDFiLVsgd~vsN~pl~~~l~eHr~r~k~Dk~~i  160 (673)
T KOG1461|consen   81 AAQIIEYIEKSEWYLPMSFIVVTICSGESRSVGDAMRDIDEKQLITGDFILVSGDTVSNMPLRNVLEEHRKRRKEDKDAI  160 (673)
T ss_pred             HHHHHHHHhhccccccccceEEEEcCCCcCcHHHHHHHHHhcceeecceEEEeCCeeecCchHHHHHHHHHHhhhCccce
Confidence            999999999999974 2345666667789999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeeccCCCCCCCCcceEEEEECCCCeEEEeeCCCCCCCccccchhhhccCCcEEEEecCCcceeeecCCchhhhhhc
Q psy1482         151 ALVLYKKKGQSKSSWKEDLIVAYECDSKKLLMHQTPQDNQKKVNIPMENILLYSKLEICAHLASTGIMICSPAVPPLFSD  230 (627)
Q Consensus       151 ~T~~~~~~~~~~~~~~~~~vv~~d~~~~~vl~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Giyi~s~~vl~~~~~  230 (627)
                      |||++++.+  .+.+.+..++++|+.|+|+++|.+....+..+.+|+++|..++++.+++||.||+|.||||+++.+|++
T Consensus       161 MTmv~k~~s--t~~~~~~~~~avd~~T~~ll~yq~~~~~~~~~~l~~sl~d~~~~v~vr~DL~dc~IdIcS~~V~sLF~d  238 (673)
T KOG1461|consen  161 MTMVFKESS--TRETTEQVVIAVDSRTSRLLHYQKCVREKHDIQLDLSLFDSNDEVEVRNDLLDCQIDICSPEVLSLFTD  238 (673)
T ss_pred             EEEEEeccc--cccCCcceEEEEcCCcceEEeehhhcccccccccCHHHhcCCCcEEEEccCCCceeeEecHhHHHHhhh
Confidence            999999975  233356788999999999999998444567899999999999999999999999999999999999999


Q ss_pred             CCCCCchhhhhcccccChhcccCeeEEEEcCCCceeeecCChhhHHHHhHHHhhcccCCCCCC--------ceeecCeEE
Q psy1482         231 NFDFQTQEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWVHPFVPS--------YKYRRNNIY  302 (627)
Q Consensus       231 ~fd~~~~~dfi~~il~~~~~~g~~I~~~~~~~~~~~~~V~s~~~y~~a~~dil~~~~~~~~~~--------~~~~~~~~~  302 (627)
                      |||||.|.||++|+|. ++++|++||+|.++...|+.+|.++++|..+++++++||+||++|+        +.+.+.++|
T Consensus       239 NFDyq~r~DfV~GvL~-~dilg~kI~~~~~~~~~yA~rv~n~~syd~vSkDiI~RW~YP~Vpd~~~~~~q~~~~~r~~IY  317 (673)
T KOG1461|consen  239 NFDYQTRDDFVRGVLV-DDILGYKIHVHVLSSIDYAARVENLRSYDLVSKDIIQRWTYPLVPDINFSGNQTFSLERRNIY  317 (673)
T ss_pred             cccceehhhhhhhhhh-hhhcCCeEEEEEcChhhhhhhhcccHHHHHHHHHHHHhhcccccccccCCCCceeeecccccc
Confidence            9999999999999998 5699999999999865599999999999999999999999999998        567789999


Q ss_pred             ECCCeEECCCCEEcCCcEECCCCEECCCceeeeeEECCCCEECCCcEEeceEECCCCEeCCCcEEeeeeecCCcEECCCc
Q psy1482         303 LAEDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDNVKIEDNCEVRLSVLSYNTGVGEHS  382 (627)
Q Consensus       303 i~~~~~i~~~~~i~~~~~ig~~~~Ig~~~~I~~s~Ig~~~~Ig~~~~I~~s~i~~~v~Ig~~~~i~~~ii~~~~~Ig~~~  382 (627)
                      .++.+++++.+.++.+++||.++.||.++.|.||+||.||+||.||+|.+|+||.||+||+||.|.+|+||++|.|+.|+
T Consensus       318 k~~dv~~~~~~~v~~~~~ig~gT~Ig~g~~I~NSVIG~~c~IgsN~~I~~S~iw~~v~Igdnc~I~~aii~d~v~i~~~~  397 (673)
T KOG1461|consen  318 KSPDVVLSHSVIVGANVVIGAGTKIGSGSKISNSVIGANCRIGSNVRIKNSFIWNNVTIGDNCRIDHAIICDDVKIGEGA  397 (673)
T ss_pred             cCccceehhhccccceEEecccccccCCCeeecceecCCCEecCceEEeeeeeecCcEECCCceEeeeEeecCcEeCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EECCCCEECCCcEECCCcEECCCcccCCCCC-CCCCC--------------------CCCC-Ccccc---cccCC---CC
Q psy1482         383 KLLNGCLLGTGVLIGNKTCLSGVKLPSAGAD-EVDDG--------------------NNDS-DEEEV---PKFKC---ES  434 (627)
Q Consensus       383 ~i~~~~ii~~~~~ig~~~~v~~~~~v~~~~~-~~~~~--------------------~~~~-~~~~~---~~~~~---~~  434 (627)
                      ++.+||+||.+|++|++-+++.+++|..+.+ +++++                    .++. +++|.   ..+..   ..
T Consensus       398 ~l~~g~vl~~~VVv~~~~~l~~ns~~~~p~~eesdee~~~~~~l~siG~~G~gyi~~~~~~~dee~~~~~~~~~~~k~n~  477 (673)
T KOG1461|consen  398 ILKPGSVLGFGVVVGRNFVLPKNSKVRQPTTEESDEEGLDDVKLKSIGPDGAGYIWETEDADDEEWKPLVPPSPNDKTNE  477 (673)
T ss_pred             ccCCCcEEeeeeEeCCCccccccccccCCcccccchhhccchheeeccCCcceeeecccCcccccccccccCCccccccc
Confidence            9999999999999999999999999865322 11110                    0111 12221   01111   11


Q ss_pred             CcccCC-CCCCCCCCCCCCCCCCCCCC-CCCchhhHHHHHHHHHHHHHhccCChhhHHHHHHhhHHhcCCChHHHHHHHH
Q psy1482         435 EQELDS-DESDSESENDVDSVDGQGTP-PMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMV  512 (627)
Q Consensus       435 ~~~~d~-~~~~~~~~~~~~~~~~~~~~-~~dd~~~F~~ev~~~l~~~~~~~~~~~~~~lei~~lr~a~n~~~~~v~~~v~  512 (627)
                      ..++|+ +++.|.+++++     +.++ ..||+..|++||.++++|+++|++.+|++++|||+||+|||++++||+.+++
T Consensus       478 ~~~~Dd~~se~s~~~~ed-----d~~~~in~d~~~F~~Ev~~s~~ra~Een~~~D~~vlEINslRla~N~s~~ev~~av~  552 (673)
T KOG1461|consen  478 AIEDDDSESESSVSEEED-----DASTDINDDTKDFEKEVLGSLQRAFEENSDMDNLVLEINSLRLAYNVSLKEVAGAVF  552 (673)
T ss_pred             ccccccchhhcccccccc-----ccccccCchhHHHHHHHHHHHHHHHHhccchHHHHHHHhhhHHhhcCCHHHHHHHHH
Confidence            111122 11111111111     1122 2368899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhc-CCCCCchhHHHHHHHHHhhHHHHHHHhhcCcHHHHHHHHHHHHHHhhccchHHHHHHHHHHHhhcCCCChh
Q psy1482         513 KAILVVKN-KPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLLHKLYDKDILSED  591 (627)
Q Consensus       513 ~ail~~~~-~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~q~~~l~ale~~~~~~~~~~~~~~~il~~lYd~dil~Ee  591 (627)
                      .|+|..+. ...+....+..++.+++++|++++.+|+++.+.|+++|.+||.+|.++..+.+.+.++++.||+.|||+|+
T Consensus       553 ~all~~~~~~~~~~~~~~~~~~~~~~~~w~~l~~~y~ks~deqid~l~~led~~~e~~~~~~~~~~~v~~lY~~dil~Ed  632 (673)
T KOG1461|consen  553 MALLKLILHQDHSSMNEVKRAALKVFTQWGPLLGNYIKSEDEQIDLLLALEDKCVESEELGPKAAKLVHYLYDYDILQED  632 (673)
T ss_pred             HHHHHHHhcCCCccchhHHHHHHHHHHHhhHHhhhhhhhHHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhHhhHH
Confidence            99999987 55554555788999999999999999999999999999999999999988889999999999999999999


Q ss_pred             hHhhhhhcCC-----chhHHhhhHHHHHHhccccCCCCCCC
Q psy1482         592 IVTKWFNKLE-----PSSLRKSVEPFVKWLLEADEESEEDD  627 (627)
Q Consensus       592 ~il~W~~~~~-----~~~~~~~~~~fi~WL~eaeee~~ee~  627 (627)
                      +|++||....     .++.++++++||+||+||+||||+||
T Consensus       633 aI~~W~~~~~~~~~~~~~~~~~~k~fv~WL~easeE~~~ee  673 (673)
T KOG1461|consen  633 AILSWSSQKAGDDEEDAVYNQQLKKFVDWLKEASEEEESEE  673 (673)
T ss_pred             HHHHhhhccccchHHHHHHHHHHHHHHHHHhhcccccccCC
Confidence            9999998744     46788899999999999999999886

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>KOG1462\|consensus	Back alignment and domain information

>KOG1322\|consensus	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>KOG1460\|consensus	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit	Back alignment and domain information

>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>PRK10122 GalU regulator GalF; Provisional	Back alignment and domain information

>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry	Back alignment and domain information

>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase	Back alignment and domain information

>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase	Back alignment and domain information

>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional	Back alignment and domain information

>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose	Back alignment and domain information

>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG2297\|consensus	Back alignment and domain information

>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule	Back alignment and domain information

>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose	Back alignment and domain information

>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	Back alignment and domain information

>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF02020 W2: eIF4-gamma/eIF5/eIF2-epsilon; InterPro: IPR003307 This entry represents the W2 domain (two invariant tryptophans) and is a region of ~165 amino acids which is found in the C terminus of the following eIFs [, , , ]: Eukaryotic translation initiation factor 2B epsilon (eIF-2B-epsilon) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) Eukaryotic translation initiation factor 5 (eIF-5), a GTPase-activating protein (GAP) specific for eIF2 Translation initiation is a sophisticated, well regulated and highly coordinated cellular process in eukaryotes, in which at least 11 eukayrotic initiation factors (eIFs) are included []

Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide	Back alignment and domain information

>smart00515 eIF5C Domain at the C-termini of GCD6, eIF-2B epsilon, eIF-4 gamma and eIF-5	Back alignment and domain information

>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>KOG2767\|consensus	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>PLN02917 CMP-KDO synthetase	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>KOG1461\|consensus	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>TIGR00454 conserved hypothetical protein TIGR00454	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site

Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function	Back alignment and domain information

>KOG1462\|consensus	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>KOG3121\|consensus	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03584 PseF pseudaminic acid CMP-transferase	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>KOG3121\|consensus	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial	Back alignment and domain information

>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB	Back alignment and domain information

>KOG1460\|consensus	Back alignment and domain information

>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>COG2068 Uncharacterized MobA-related protein [General function prediction only]	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate []	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional	Back alignment and domain information

>KOG1322\|consensus	Back alignment and domain information

>KOG4042\|consensus	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat	Back alignment and domain information

>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism]	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>PLN02474 UTP--glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>KOG4042\|consensus	Back alignment and domain information

>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism]	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>KOG4750\|consensus	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>KOG4750\|consensus	Back alignment and domain information

>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix	Back alignment and domain information

>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose	Back alignment and domain information

>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2	Back alignment and domain information

>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional	Back alignment and domain information

>PLN02830 UDP-sugar pyrophosphorylase	Back alignment and domain information

>PF09090 MIF4G_like_2: MIF4G like; InterPro: IPR015174 This entry represents an MIF4G-like domain	Back alignment and domain information

>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>KOG1104\|consensus	Back alignment and domain information

>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC	Back alignment and domain information

>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold	Back alignment and domain information

>PF04519 Bactofilin: Polymer-forming cytoskeletal; InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins	Back alignment and domain information

>COG1664 CcmA Integral membrane protein CcmA involved in cell shape determination [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ]	Back alignment and domain information

>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		627
3jui_A		182	Crystal Structure Of The C-terminal Domain Of Human		3e-21

>pdb|3JUI|A Chain A, Crystal Structure Of The C-terminal Domain Of Human Translation Initiation Factor Eif2b Epsilon Subunit Length = 182

Back alignment and structure

Iteration: 1

Score = 100 bits (248), Expect = 3e-21, Method: Composition-based stats. Identities = 54/163 (33%), Positives = 94/163 (57%), Gaps = 9/163 (5%) Query: 463 DDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAIL---VVK 519 DD +F EV+ +L RG EE + CDNL LEINS +YAYN+++KEV + +L + + Sbjct: 9 DDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVXQVLSHVVLEFPLQQ 68 Query: 520 NKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVAGKLL 579 +D + ++ + + P+F+NYIK + + L A E+F E+E+L + K+L Sbjct: 69 XDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISXAKVL 128 Query: 580 HKLYDKDILSEDIVTKWFNKLEPS----SLRKS--VEPFVKWL 616 Y +IL+ + + WF++ + + LRK+ ++ F++WL Sbjct: 129 XAFYQLEILAGETILSWFSQRDTTDKGQQLRKNQQLQRFIQWL 171

PyMOL of 3jui

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		627
3jui_A		182	Translation initiation factor EIF-2B subunit EPSI;	1e-41
1paq_A		189	Translation initiation factor EIF-2B epsilon subun	3e-38
2ful_A		177	EIF-5, eukaryotic translation initiation factor 5;	1e-19
2iu1_A		208	EIF5, eukaryotic translation initiation factor 5;	2e-15
3d3m_A		168	Eukaryotic translation initiation factor 4 gamma 2	5e-15
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	6e-15
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	4e-12
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	4e-12
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	7e-12
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	1e-06
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	5e-04
3l6a_A		364	Eukaryotic translation initiation factor 4 gamma;	2e-11
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	2e-10
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	3e-06
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	1e-05
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	9e-10
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	3e-09
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	1e-09
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	2e-09
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	3e-07
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	1e-09
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	2e-09
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	2e-07
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	4e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
4fce_A		459	Bifunctional protein GLMU; GLMU. csgid, niaid, str	8e-09
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	1e-07
3bfp_A		194	Acetyltransferase; LEFT-handed beta helix, COA bin	1e-07
2v0h_A		456	Bifunctional protein GLMU; cell WALL, magnesium, c	2e-07
3c8v_A		496	Putative acetyltransferase; YP_390128.1, structura	2e-07
3c8v_A		496	Putative acetyltransferase; YP_390128.1, structura	5e-05
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	2e-07
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	1e-06
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	2e-05
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	1e-04
1ug3_A		339	EIF4GI, eukaryotic protein synthesis initiation fa	3e-07
2qia_A		262	UDP-N-acetylglucosamine acyltransferase; LEFT-hand	6e-07
4eqy_A		283	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	7e-07
3rsb_A		196	Adenosylcobinamide-phosphate guanylyltransferase;	9e-07
1j2z_A		270	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	1e-06
3st8_A		501	Bifunctional protein GLMU; acetyltransferase, pyro	1e-06
1hm9_A		468	GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr	2e-06
4ea9_A		220	Perosamine N-acetyltransferase; beta helix, acetyl	2e-06
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	4e-06
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	1e-04
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	3e-04
3r8y_A		240	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac	5e-06
3r0s_A		266	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	7e-06
3hsq_A		259	Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam	8e-06
1jyk_A		254	LICC protein, CTP:phosphocholine cytidylytransfera	2e-05
1xhd_A		173	Putative acetyltransferase/acyltransferase; struct	4e-05
2pig_A		334	Putative transferase; SCR6, NESG, YDCK, structural	6e-05
1v3w_A		173	Ferripyochelin binding protein; beta-helix, carbon	7e-05
3ixc_A		191	Hexapeptide transferase family protein; niaid, ssg	2e-04
3kwd_A		213	Carbon dioxide concentrating mechanism protein; LE	7e-04

>3jui_A Translation initiation factor EIF-2B subunit EPSI; heat repeat, guanine nucleotide exchange factor, disease mutation, leukodystrophy; 2.00A {Homo sapiens} Length = 182	Back alignment and structure

 Score =  147 bits (373), Expect = 1e-41
 Identities = 60/178 (33%), Positives = 101/178 (56%), Gaps = 9/178 (5%)

Query: 459 TPPMDDTSLFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAIL-- 516
              MDD  +F  EV+ +L RG EE + CDNL LEINS +YAYN+++KEV   +   +L  
Sbjct: 5   HHHMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEF 64

Query: 517 -VVKNKPDMDMKSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEFAEENESLSVVA 575
            + +    +D   +   ++  +  + P+F+NYIK  +   + L A E+F  E+E+L +  
Sbjct: 65  PLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISM 124

Query: 576 GKLLHKLYDKDILSEDIVTKWFNKLEPSS------LRKSVEPFVKWLLEADEESEEDD 627
            K+L   Y  +IL+ + +  WF++ + +         + ++ F++WL EA+EES EDD
Sbjct: 125 AKVLMAFYQLEILAGETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSEDD 182

PyMOL of 3jui

>1paq_A Translation initiation factor EIF-2B epsilon subunit; heat repeat, AA motif; 2.30A {Saccharomyces cerevisiae} SCOP: a.118.1.14 Length = 189	Back alignment and structure

>2ful_A EIF-5, eukaryotic translation initiation factor 5; atypical heat motif; 1.50A {Saccharomyces cerevisiae} Length = 177	Back alignment and structure

>2iu1_A EIF5, eukaryotic translation initiation factor 5; MFC, GTP-binding, phosphorylation, protein biosynthesis, translation inititation; 1.8A {Homo sapiens} Length = 208	Back alignment and structure

>3d3m_A Eukaryotic translation initiation factor 4 gamma 2; heat repeat domain, structural genomics, PSI, protein structure initiative; 1.90A {Homo sapiens} Length = 168	Back alignment and structure

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273	Back alignment and structure

>3l6a_A Eukaryotic translation initiation factor 4 gamma; C-terminal region, MA2 domain, W2 domain, EIF4G2, EIF family translation; HET: MES PG4; 2.00A {Homo sapiens} Length = 364	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459	Back alignment and structure

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451	Back alignment and structure

>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194	Back alignment and structure

>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456	Back alignment and structure

>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496	Back alignment and structure

>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420	Back alignment and structure

>1ug3_A EIF4GI, eukaryotic protein synthesis initiation factor 4G; heat repeat, translation; 2.24A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 Length = 339	Back alignment and structure

>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262	Back alignment and structure

>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283	Back alignment and structure

>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196	Back alignment and structure

>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270	Back alignment and structure

>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501	Back alignment and structure

>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468	Back alignment and structure

>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205	Back alignment and structure

>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240	Back alignment and structure

>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266	Back alignment and structure

>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259	Back alignment and structure

>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254	Back alignment and structure

>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173	Back alignment and structure

>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334	Back alignment and structure

>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173	Back alignment and structure

>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191	Back alignment and structure

>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		627
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	100.0
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	100.0
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	100.0
3st8_A		501	Bifunctional protein GLMU; acetyltransferase, pyro	100.0
1hm9_A		468	GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr	100.0
4fce_A		459	Bifunctional protein GLMU; GLMU. csgid, niaid, str	100.0
3jui_A		182	Translation initiation factor EIF-2B subunit EPSI;	100.0
2v0h_A		456	Bifunctional protein GLMU; cell WALL, magnesium, c	100.0
1paq_A		189	Translation initiation factor EIF-2B epsilon subun	100.0
3juk_A		281	UDP-glucose pyrophosphorylase (GALU); transfer; HE	99.96
4ecm_A		269	Glucose-1-phosphate thymidylyltransferase; HET: DA	99.95
3pnn_A		303	Conserved domain protein; structural genomics, PSI	99.95
1tzf_A		259	Glucose-1-phosphate cytidylyltransferase; nucleoti	99.95
2e3d_A		302	UTP--glucose-1-phosphate uridylyltransferase; UDP-	99.94
2ux8_A		297	Glucose-1-phosphate uridylyltransferase; UGPG, GAL	99.94
1lvw_A		295	Glucose-1-phosphate thymidylyltransferase; protein	99.94
2pa4_A		323	UTP-glucose-1-phosphate uridylyltransferase; phosp	99.94
1mc3_A		296	Glucose-1-phosphate thymidylyltransferase; glucose	99.93
1fxo_A		293	Glucose-1-phosphate thymidylyltransferase; rhamnos	99.93
4evw_A		255	Nucleoside-diphosphate-sugar pyrophosphorylase; st	99.92
3d3m_A		168	Eukaryotic translation initiation factor 4 gamma 2	99.92
2qh5_A		308	PMI, ALGA, mannose-6-phosphate isomerase; structur	99.91
2ful_A		177	EIF-5, eukaryotic translation initiation factor 5;	99.9
3oam_A		252	3-deoxy-manno-octulosonate cytidylyltransferase; c	99.89
2x65_A		336	Mannose-1-phosphate guanylyltransferase; nucleotid	99.88
2iu1_A		208	EIF5, eukaryotic translation initiation factor 5;	99.87
1jyk_A		254	LICC protein, CTP:phosphocholine cytidylytransfera	99.87
2cu2_A		337	Putative mannose-1-phosphate guanylyl transferase;	99.85
3l6a_A		364	Eukaryotic translation initiation factor 4 gamma;	99.84
3tqd_A		256	3-deoxy-manno-octulosonate cytidylyltransferase; c	99.82
3k8d_A		264	3-deoxy-manno-octulosonate cytidylyltransferase; K	99.81
2xme_A		232	CTP-inositol-1-phosphate cytidylyltransferase; CDP	99.79
2icy_A		469	Probable UTP-glucose-1-phosphate uridylyltransfera	99.78
2y6p_A		234	3-deoxy-manno-octulosonate cytidylyltransferase; l	99.78
4fcu_A		253	3-deoxy-manno-octulosonate cytidylyltransferase; s	99.75
1h7e_A		245	3-deoxy-manno-octulosonate cytidylyltransferase; n	99.72
1vic_A		262	3-deoxy-manno-octulosonate cytidylyltransferase; s	99.72
1ug3_A		339	EIF4GI, eukaryotic protein synthesis initiation fa	99.71
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	99.71
3r8y_A		240	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac	99.68
3ixc_A		191	Hexapeptide transferase family protein; niaid, ssg	99.67
1xhd_A		173	Putative acetyltransferase/acyltransferase; struct	99.67
3tv0_A		194	Dynactin subunit 6; LEFT-handed beta-helix, ARP11,	99.66
3r3r_A		187	Ferripyochelin binding protein; structural genomic	99.65
1v3w_A		173	Ferripyochelin binding protein; beta-helix, carbon	99.64
2i5k_A		488	UTP--glucose-1-phosphate uridylyltransferase; LEFT	99.64
3r1w_A		189	Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid	99.63
2vsh_A		236	TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly	99.59
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	99.58
1ezi_A		228	CMP-N-acetylneuraminic acid synthetase; homodimer,	99.58
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	99.57
2pig_A		334	Putative transferase; SCR6, NESG, YDCK, structural	99.57
4eqy_A		283	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.57
3r0s_A		266	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.57
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	99.56
4eqy_A		283	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.56
3kwd_A		213	Carbon dioxide concentrating mechanism protein; LE	99.56
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	99.56
3r0s_A		266	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.56
4e6u_A		265	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.55
3hsq_A		259	Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam	99.55
1j2z_A		270	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.55
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	99.54
2dpw_A		232	Hypothetical protein TTHA0179; transferase, struct	99.54
2xwl_A		223	2-C-methyl-D-erythritol 4-phosphate cytidylyltran;	99.54
3hsq_A		259	Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam	99.54
3rsb_A		196	Adenosylcobinamide-phosphate guanylyltransferase;	99.54
4e6u_A		265	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.53
1jv1_A		505	Glcnac1P uridyltransferase isoform 1: AGX1; nucleo	99.53
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	99.53
1qre_A		247	Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth	99.53
3c8v_A		496	Putative acetyltransferase; YP_390128.1, structura	99.53
4e79_A		357	UDP-3-O-acylglucosamine N-acyltransferase; lipopol	99.52
1j2z_A		270	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.52
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	99.52
2qia_A		262	UDP-N-acetylglucosamine acyltransferase; LEFT-hand	99.51
2qia_A		262	UDP-N-acetylglucosamine acyltransferase; LEFT-hand	99.51
3kwd_A		213	Carbon dioxide concentrating mechanism protein; LE	99.51
3f1c_A		246	Putative 2-C-methyl-D-erythritol 4-phosphate cytid	99.5
3tk8_A		316	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.49
3eg4_A		304	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.49
3c8v_A		496	Putative acetyltransferase; YP_390128.1, structura	99.49
2yc3_A		228	2-C-methyl-D-erythritol 4-phosphate cytidylyltran	99.49
1qre_A		247	Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth	99.48
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	99.48
3gos_A		276	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.48
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	99.48
1vgw_A		231	4-diphosphocytidyl-2C-methyl-D-erythritol synthas;	99.48
4e79_A		357	UDP-3-O-acylglucosamine N-acyltransferase; lipopol	99.47
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	99.47
1qwj_A		229	Cytidine monophospho-N-acetylneuraminic acid synth	99.47
1v3w_A		173	Ferripyochelin binding protein; beta-helix, carbon	99.46
3t57_A		305	UDP-N-acetylglucosamine O-acyltransferase domain-	99.46
1xhd_A		173	Putative acetyltransferase/acyltransferase; struct	99.46
3t57_A		305	UDP-N-acetylglucosamine O-acyltransferase domain-	99.45
3gos_A		276	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.45
3eg4_A		304	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.45
3r5d_A		347	Tetrahydrodipicolinate N-succinyletransferase; 1.8	99.45
3r3r_A		187	Ferripyochelin binding protein; structural genomic	99.44
3tk8_A		316	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.44
3bfp_A		194	Acetyltransferase; LEFT-handed beta helix, COA bin	99.44
3ixc_A		191	Hexapeptide transferase family protein; niaid, ssg	99.42
3jqy_B		252	NEUO, polysialic acid O-acetyltransferase; LEFT-ha	99.42
3bfp_A		194	Acetyltransferase; LEFT-handed beta helix, COA bin	99.42
3tv0_A		194	Dynactin subunit 6; LEFT-handed beta-helix, ARP11,	99.41
3fsy_A		332	Tetrahydrodipicolinate N-succinyltransferase; beta	99.41
3r1w_A		189	Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid	99.41
4ea9_A		220	Perosamine N-acetyltransferase; beta helix, acetyl	99.41
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	99.41
4ea9_A		220	Perosamine N-acetyltransferase; beta helix, acetyl	99.4
1vpa_A		234	2-C-methyl-D-erythritol 4-phosphate cytidylyltran;	99.4
2wlg_A		215	Polysialic acid O-acetyltransferase; enzyme, LEFT-	99.39
4fce_A		459	Bifunctional protein GLMU; GLMU. csgid, niaid, str	99.39
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	99.37
3r8y_A		240	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac	99.36
2v0h_A		456	Bifunctional protein GLMU; cell WALL, magnesium, c	99.35
3nz2_A		195	Hexapeptide-repeat containing-acetyltransferase; s	99.34
3fsy_A		332	Tetrahydrodipicolinate N-succinyltransferase; beta	99.32
1hm9_A		468	GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr	99.31
2wee_A		197	MOBA-related protein; unknown function; 1.65A {Myc	99.3
1i52_A		236	4-diphosphocytidyl-2-C-methylerythritol synthase;	99.29
2waw_A		199	MOBA relate protein; unknown function; HET: PGE; 1	99.29
3r5d_A		347	Tetrahydrodipicolinate N-succinyletransferase; 1.8	99.29
2rij_A		387	Putative 2,3,4,5-tetrahydropyridine-2-carboxylate	99.29
3hjj_A		190	Maltose O-acetyltransferase; LEFT-handed beta-heli	99.28
2oeg_A		505	UTP-glucose-1-phosphate uridylyltransferase 2, put	99.27
3jqy_B		252	NEUO, polysialic acid O-acetyltransferase; LEFT-ha	99.25
3oc9_A		405	UDP-N-acetylglucosamine pyrophosphorylase; structu	99.25
2px7_A		236	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.24
2pig_A		334	Putative transferase; SCR6, NESG, YDCK, structural	99.23
3ftt_A		199	Putative acetyltransferase sacol2570; galactoside	99.22
2yqc_A		486	UDP-N-acetylglucosamine pyrophosphorylase; uridine	99.21
3q80_A		231	2-C-methyl-D-erythritol 4-phosphate cytidyltransf;	99.21
3q1x_A		313	Serine acetyltransferase; cysteine biosynthesis, L	99.21
1krr_A		203	Galactoside O-acetyltransferase; LEFT-handed paral	99.19
3q1x_A		313	Serine acetyltransferase; cysteine biosynthesis, L	99.18
3nz2_A		195	Hexapeptide-repeat containing-acetyltransferase; s	99.18
3st8_A		501	Bifunctional protein GLMU; acetyltransferase, pyro	99.18
3srt_A		188	Maltose O-acetyltransferase; structural genomics,	99.15
1ocx_A		182	Maltose O-acetyltransferase; LEFT-handed parallel	99.13
2p2o_A		185	Maltose transacetylase; GK1921, GKA001001921.1, ge	99.13
3hjj_A		190	Maltose O-acetyltransferase; LEFT-handed beta-heli	99.12
3srt_A		188	Maltose O-acetyltransferase; structural genomics,	99.12
3ftt_A		199	Putative acetyltransferase sacol2570; galactoside	99.11
2wlg_A		215	Polysialic acid O-acetyltransferase; enzyme, LEFT-	99.11
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	99.11
1krr_A		203	Galactoside O-acetyltransferase; LEFT-handed paral	99.11
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	99.1
4hur_A		220	Virginiamycin A acetyltransferase; structural geno	99.09
3d5n_A		197	Q97W15_sulso; NESG, SSR125, structural genomics, P	99.08
4hur_A		220	Virginiamycin A acetyltransferase; structural geno	99.06
3f1x_A		310	Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9	99.06
1e5k_A		201	Molybdopterin-guanine dinucleotide biosynthesis pr	99.05
3mc4_A		287	WW/RSP5/WWP domain:bacterial transferase hexapept	99.01
3mc4_A		287	WW/RSP5/WWP domain:bacterial transferase hexapept	98.99
1ocx_A		182	Maltose O-acetyltransferase; LEFT-handed parallel	98.99
2rij_A		387	Putative 2,3,4,5-tetrahydropyridine-2-carboxylate	98.99
2p2o_A		185	Maltose transacetylase; GK1921, GKA001001921.1, ge	98.98
2e8b_A		201	Probable molybdopterin-guanine dinucleotide biosy	98.94
1ssq_A		267	SAT, serine acetyltransferase; LEFT-handed paralle	98.93
3f1x_A		310	Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9	98.92
1ssq_A		267	SAT, serine acetyltransferase; LEFT-handed paralle	98.92
1t3d_A		289	SAT, serine acetyltransferase; LEFT-handed-beta-he	98.89
3ngw_A		208	Molybdopterin-guanine dinucleotide biosynthesis P	98.89
1t3d_A		289	SAT, serine acetyltransferase; LEFT-handed-beta-he	98.88
1w55_A		371	ISPD/ISPF bifunctional enzyme; biosynthetic pathwa	98.82
4e8l_A		219	Virginiamycin A acetyltransferase; structural geno	98.78
3eev_A		212	Chloramphenicol acetyltransferase; beta-helix, str	98.78
1mr7_A		209	Streptogramin A acetyltransferase; LEFT-handed par	98.76
4e8l_A		219	Virginiamycin A acetyltransferase; structural geno	98.73
3eev_A		212	Chloramphenicol acetyltransferase; beta-helix, str	98.73
1mr7_A		209	Streptogramin A acetyltransferase; LEFT-handed par	98.64
1xat_A		212	Xenobiotic acetyltransferase; chloramphenicol, LEF	98.63
1xat_A		212	Xenobiotic acetyltransferase; chloramphenicol, LEF	98.61
3r3i_A		528	UTP--glucose-1-phosphate uridylyltransferase; ross	98.28
3gue_A		484	UTP-glucose-1-phosphate uridylyltransferase 2; pho	97.61
3ogz_A		630	UDP-sugar pyrophosphorylase; LEFT handed beta heli	96.73
2i5e_A		211	Hypothetical protein MM_2497; APC86122, methanosar	95.94
1h2v_C		771	80 kDa nuclear CAP binding protein; CAP-binding-co	94.67

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A*	Back alignment and structure

Probab=100.00  E-value=2e-45  Score=399.81  Aligned_cols=349  Identities=16%  Similarity=0.246  Sum_probs=258.4

Q ss_pred             CceEEEEEeCCCCCCCCcC--CCCccccccCCe-ehHHHHHHHHHhCCCcEEEEEecCChHHHHHHHHhcccccCCe---
Q psy1482          16 EVLQAVIVTDTFNRNFFPV--PEPYCLLPLVNK-CLLEYTLEHLHLSGIEEIIVFCTSHVNQIRELVKRKEKSLVGT---   89 (627)
Q Consensus        16 ~~~~aVIlA~g~g~R~~Pl--~~PK~Llpi~g~-pli~~~l~~L~~~gi~~i~vv~~~~~~~i~~~l~~~~~~~~~~---   89 (627)
                      ..|+|||||||+|+||+||  .+||+|+||+|+ |||+|+|+.|..+|+++|+|+++++.+++.+|+.. .|+ .++   
T Consensus        19 ~~~~avILAaG~gtRl~plT~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~~~i~~~~~~-~~~-~~~~~~   96 (451)
T 1yp2_A           19 RSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSR-AYA-SNMGGY   96 (451)
T ss_dssp             HHEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHHHHHHHH-HCC-------
T ss_pred             cceEEEEECCCCCCcccchhcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCHHHHHHHHhh-hhh-cccccc
Confidence            3589999999999999999  889999999999 99999999999999999999999988899999875 231 011   


Q ss_pred             ----eEEEEe--CC-----CCcchhhhhhcccccCCcc----CCEEEEeCCeeccccHHHHHHHHHHHhcCCCCceEEEE
Q psy1482          90 ----LITLIV--SD-----GCYSFGDVMRDLDGKAVIR----NDFILVSGDVVSNINLLSALKSFKKINSMDSGAVALVL  154 (627)
Q Consensus        90 ----~v~~i~--~~-----~~~~~gdalr~l~~~~~i~----~dfll~~gD~i~~~~l~~~l~~h~~~~~~~~~~~~T~~  154 (627)
                          .+.++.  +.     ...|++++++.  +...+.    ++|++++||++++.++..+++.|++.     ++.+|++
T Consensus        97 ~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~--a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~-----~~~~tl~  169 (451)
T 1yp2_A           97 KNEGFVEVLAAQQSPENPDWFQGTADAVRQ--YLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRET-----DADITVA  169 (451)
T ss_dssp             --CCEEEEEESCSSTTSCCCCCSHHHHHHH--THHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHT-----TCSEEEE
T ss_pred             cccCcEEEecccccccccccccCcHHHHHH--HHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHc-----CCcEEEE
Confidence                133432  21     24799999984  333343    57999999999999999999999875     5788888


Q ss_pred             eeccC--CCCCCCCcceEEEEECCCCeEEEeeCCCCC--CCccccchhhhccCCcEEE-EecCCcceeeecCCchh-hhh
Q psy1482         155 YKKKG--QSKSSWKEDLIVAYECDSKKLLMHQTPQDN--QKKVNIPMENILLYSKLEI-CAHLASTGIMICSPAVP-PLF  228 (627)
Q Consensus       155 ~~~~~--~~~~~~~~~~vv~~d~~~~~vl~~~e~~~~--~~~~~~~~~~~~~~~~~~~-~~~l~~~Giyi~s~~vl-~~~  228 (627)
                      +.+..  ++.+++    ++.+| ++++|+.|.++|+.  ...+++|..++.+++.... .++++++|+|+|++++| .++
T Consensus       170 ~~~~~~~~~~~~g----~v~~d-~~~~v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~~~l  244 (451)
T 1yp2_A          170 ALPMDEKRATAFG----LMKID-EEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLL  244 (451)
T ss_dssp             EEEECHHHHTTSE----EEEEC-TTSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHH
T ss_pred             EEEcChhhcccCC----EEEEC-CCCCEEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHHHHH
Confidence            77754  334555    88888 68999999998851  1224456666654432111 34688999999999988 466


Q ss_pred             hcCCCCC-c-hhhhhcccccChhcccCeeEEEEcCCCceeeecCChhhHHHHhHHHhhccc-CC-CCCCceeecCeEEEC
Q psy1482         229 SDNFDFQ-T-QEHFIKGVLINEEILDCRLYCSVVDDIEYGISVKDWPSYQIASRDIVQRWV-HP-FVPSYKYRRNNIYLA  304 (627)
Q Consensus       229 ~~~fd~~-~-~~dfi~~il~~~~~~g~~I~~~~~~~~~~~~~V~s~~~y~~a~~dil~~~~-~~-~~~~~~~~~~~~~i~  304 (627)
                      ++.+... . ..++++.++    ..|.++++|..+ + +|.+|+++++|.+++++++.++. .. ++.+...+.+++.++
T Consensus       245 ~~~~~~~~~~~~~~l~~~i----~~g~~v~~~~~~-~-~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~  318 (451)
T 1yp2_A          245 RDKFPGANDFGSEVIPGAT----SLGMRVQAYLYD-G-YWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYL  318 (451)
T ss_dssp             HTTCTTCCCTTTTHHHHHH----HTTCCEEEEECC-S-CCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCC
T ss_pred             HhhcccccchHhhHHHHHH----hcCCceEEEEeC-C-EEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccC
Confidence            6542211 1 223333222    236899999987 6 99999999999999999988763 11 111123334455566


Q ss_pred             CCeEECCCCEEcCCcEECCCCEECCCceeeeeEECCCCEECCCcEEeceEECCC-------------------CEeCCCc
Q psy1482         305 EDVLIGKTSVLKQQVVIGEGSSIGENTQLSHCIIGRNCTIGSNVRLEKSYLFDN-------------------VKIEDNC  365 (627)
Q Consensus       305 ~~~~i~~~~~i~~~~~ig~~~~Ig~~~~I~~s~Ig~~~~Ig~~~~I~~s~i~~~-------------------v~Ig~~~  365 (627)
                      +++.| +++.| .++.||++|.|+. +.|.+++||++|.||++|+|.++++..+                   +.||++|
T Consensus       319 ~~~~i-~~~~I-~~~~Ig~~~~I~~-~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~  395 (451)
T 1yp2_A          319 PPSKM-LDADV-TDSVIGEGCVIKN-CKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNC  395 (451)
T ss_dssp             CCEEE-EEEEE-EEEEECTTCEEEE-EEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTC
T ss_pred             CCeEE-cceEE-eCeEECCCCEEcc-eEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCC
Confidence            66666 56777 4688999999986 8888999999999999999988888888                   9999999


Q ss_pred             EEeeeeecCCcEECCCcEECCC
Q psy1482         366 EVRLSVLSYNTGVGEHSKLLNG  387 (627)
Q Consensus       366 ~i~~~ii~~~~~Ig~~~~i~~~  387 (627)
                      .|.+++||++|+||++++|.++
T Consensus       396 ~i~~~~Ig~~~~IG~~~~i~~~  417 (451)
T 1yp2_A          396 HIKRAIIDKNARIGDNVKIINK  417 (451)
T ss_dssp             EEESEEECTTCEECTTCEECCS
T ss_pred             EEeccEeCCCcEECCCCEEeCC
Confidence            9999999999999999999865

PyMOL of 1yp2

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A*	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens}	Back alignment and structure

>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A*	Back alignment and structure

>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A*	Back alignment and structure

>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A*	Back alignment and structure

>3jui_A Translation initiation factor EIF-2B subunit EPSI; heat repeat, guanine nucleotide exchange factor, disease mutation, leukodystrophy; 2.00A {Homo sapiens} SCOP: a.118.1.0	Back alignment and structure

>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A*	Back alignment and structure

>1paq_A Translation initiation factor EIF-2B epsilon subunit; heat repeat, AA motif; 2.30A {Saccharomyces cerevisiae} SCOP: a.118.1.14	Back alignment and structure

>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A*	Back alignment and structure

>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A*	Back alignment and structure

>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis}	Back alignment and structure

>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A*	Back alignment and structure

>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli}	Back alignment and structure

>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea}	Back alignment and structure

>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6	Back alignment and structure

>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6	Back alignment and structure

>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ...	Back alignment and structure

>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae}	Back alignment and structure

>3d3m_A Eukaryotic translation initiation factor 4 gamma 2; heat repeat domain, structural genomics, PSI, protein structure initiative; 1.90A {Homo sapiens}	Back alignment and structure

>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori}	Back alignment and structure

>2ful_A EIF-5, eukaryotic translation initiation factor 5; atypical heat motif; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13	Back alignment and structure

>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A*	Back alignment and structure

>2iu1_A EIF5, eukaryotic translation initiation factor 5; MFC, GTP-binding, phosphorylation, protein biosynthesis, translation inititation; 1.8A {Homo sapiens}	Back alignment and structure

>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A*	Back alignment and structure

>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20	Back alignment and structure

>3l6a_A Eukaryotic translation initiation factor 4 gamma; C-terminal region, MA2 domain, W2 domain, EIF4G2, EIF family translation; HET: MES PG4; 2.00A {Homo sapiens}	Back alignment and structure

>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0	Back alignment and structure

>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A*	Back alignment and structure

>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A*	Back alignment and structure

>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus}	Back alignment and structure

>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A	Back alignment and structure

>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A*	Back alignment and structure

>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A*	Back alignment and structure

>1ug3_A EIF4GI, eukaryotic protein synthesis initiation factor 4G; heat repeat, translation; 2.24A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A*	Back alignment and structure

>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A*	Back alignment and structure

>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum}	Back alignment and structure

>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A	Back alignment and structure

>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens}	Back alignment and structure

>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A	Back alignment and structure

>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A	Back alignment and structure

>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae}	Back alignment and structure

>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified}	Back alignment and structure

>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A*	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A*	Back alignment and structure

>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A*	Back alignment and structure

>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A	Back alignment and structure

>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis}	Back alignment and structure

>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A*	Back alignment and structure

>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis}	Back alignment and structure

>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A	Back alignment and structure

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A*	Back alignment and structure

>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0	Back alignment and structure

>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A*	Back alignment and structure

>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A*	Back alignment and structure

>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A*	Back alignment and structure

>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19	Back alignment and structure

>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A*	Back alignment and structure

>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A*	Back alignment and structure

>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii}	Back alignment and structure

>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A*	Back alignment and structure

>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A*	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli}	Back alignment and structure

>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A	Back alignment and structure

>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A	Back alignment and structure

>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa}	Back alignment and structure

>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A	Back alignment and structure

>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A	Back alignment and structure

>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A	Back alignment and structure

>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0	Back alignment and structure

>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei}	Back alignment and structure

>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis}	Back alignment and structure

>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A*	Back alignment and structure

>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa}	Back alignment and structure

>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli}	Back alignment and structure

>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A	Back alignment and structure

>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A*	Back alignment and structure

>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13	Back alignment and structure

>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A	Back alignment and structure

>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A	Back alignment and structure

>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A	Back alignment and structure

>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis}	Back alignment and structure

>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A	Back alignment and structure

>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A	Back alignment and structure

>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei}	Back alignment and structure

>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A	Back alignment and structure

>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum}	Back alignment and structure

>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli}	Back alignment and structure

>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A	Back alignment and structure

>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens}	Back alignment and structure

>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A*	Back alignment and structure

>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified}	Back alignment and structure

>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A*	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A*	Back alignment and structure

>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A*	Back alignment and structure

>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13	Back alignment and structure

>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A*	Back alignment and structure

>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A*	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A*	Back alignment and structure

>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A*	Back alignment and structure

>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A*	Back alignment and structure

>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A*	Back alignment and structure

>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A*	Back alignment and structure

>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A*	Back alignment and structure

>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A	Back alignment and structure

>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A	Back alignment and structure

>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP}	Back alignment and structure

>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A	Back alignment and structure

>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni}	Back alignment and structure

>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A*	Back alignment and structure

>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A*	Back alignment and structure

>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli}	Back alignment and structure

>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica}	Back alignment and structure

>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8}	Back alignment and structure

>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A	Back alignment and structure

>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A	Back alignment and structure

>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A*	Back alignment and structure

>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A*	Back alignment and structure

>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A	Back alignment and structure

>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A*	Back alignment and structure

>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A	Back alignment and structure

>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A*	Back alignment and structure

>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A*	Back alignment and structure

>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A*	Back alignment and structure

>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3	Back alignment and structure

>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A	Back alignment and structure

>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A*	Back alignment and structure

>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A*	Back alignment and structure

>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A	Back alignment and structure

>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A*	Back alignment and structure

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A*	Back alignment and structure

>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A*	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens}	Back alignment and structure

>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A	Back alignment and structure

>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus}	Back alignment and structure

>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A	Back alignment and structure

>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A*	Back alignment and structure

>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus}	Back alignment and structure

>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus}	Back alignment and structure

>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3	Back alignment and structure

>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni}	Back alignment and structure

>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A	Back alignment and structure

>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus}	Back alignment and structure

>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A*	Back alignment and structure

>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A*	Back alignment and structure

>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6	Back alignment and structure

>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus}	Back alignment and structure

>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6	Back alignment and structure

>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A*	Back alignment and structure

>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus}	Back alignment and structure

>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3	Back alignment and structure

>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A*	Back alignment and structure

>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus}	Back alignment and structure

>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3	Back alignment and structure

>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A*	Back alignment and structure

>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A*	Back alignment and structure

>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A*	Back alignment and structure

>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A	Back alignment and structure

>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei}	Back alignment and structure

>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A*	Back alignment and structure

>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21	Back alignment and structure

>1h2v_C 80 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 a.118.1.14 PDB: 1n52_A* 1n54_A 3fex_A 3fey_A 1h6k_A 1h2t_C* 1h2u_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		627
d1paqa_		161	a.118.1.14 (A:) Translation initiation factor eIF-	7e-38
d1ug3a2		127	a.118.1.14 (A:1438-1564) Eukaryotic initiation fac	9e-16
d1fxja1		78	b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha	4e-11
d1fxja1		78	b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha	5e-09
d1fxja1		78	b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha	1e-05
d2jf2a1		262	b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra	5e-07
d2jf2a1		262	b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra	7e-06
d1j2za_		259	b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer	8e-07
d1j2za_		259	b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer	2e-04
d1fxoa_		292	c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa	4e-06
d2f9ca1		320	b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm	3e-05
d2f9ca1		320	b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm	0.002
d1mc3a_		291	c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]}	6e-05
d1lvwa_		295	c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri	7e-05
d2oi6a1		201	b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha	8e-05
d1yp2a2		307	c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr	1e-04
d1tzfa_		259	c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf	2e-04
d1yp2a1		135	b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt	3e-04
d3tdta_		274	b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra	4e-04
d1v3wa_		173	b.81.1.5 (A:) Ferripyochelin binding protein {Arch	0.001
d1g97a1		196	b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha	0.002

>d1paqa_ a.118.1.14 (A:) Translation initiation factor eIF-2b epsilon {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 161	Back information, alignment and structure


class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: MIF4G domain-like
domain: Translation initiation factor eIF-2b epsilon
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  135 bits (342), Expect = 7e-38
 Identities = 40/160 (25%), Positives = 69/160 (43%), Gaps = 7/160 (4%)

Query: 468 FYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAIL-VVKNKPDMDM 526
           F  E + ++ R  E     D   LE+N+ R + NVT  EV    + A+L  V +      
Sbjct: 2   FEKEGIATVERAMENNHDLDTALLELNTLRMSMNVTYHEVRIATITALLRRVYHFIATQT 61

Query: 527 KSFHTHMMSKINYFLPLFKNYIKNESAQQDCLDAFEEF--AEENESLSVVAGKLLHKLYD 584
                 ++   N +  LFK    +E    D ++   E    +  +   ++    L  LYD
Sbjct: 62  LGPKDAVVKVFNQWGLLFKRQAFDEEEYIDLMNIIMEKIVEQSFDKPDLILFSALVSLYD 121

Query: 585 KDILSEDIVTKWFNKLEPS----SLRKSVEPFVKWLLEAD 620
            DI+ ED++ KW++ +        ++K    +V+WL  AD
Sbjct: 122 NDIIEEDVIYKWWDNVSTDPRYDEVKKLTVKWVEWLQNAD 161

PyMOL of d1paqa_

>d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Length = 127	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78	Back information, alignment and structure

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262	Back information, alignment and structure

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262	Back information, alignment and structure

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259	Back information, alignment and structure

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259	Back information, alignment and structure

>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292	Back information, alignment and structure

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320	Back information, alignment and structure

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320	Back information, alignment and structure

>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291	Back information, alignment and structure

>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295	Back information, alignment and structure

>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201	Back information, alignment and structure

>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307	Back information, alignment and structure

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259	Back information, alignment and structure

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135	Back information, alignment and structure

>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274	Back information, alignment and structure

>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173	Back information, alignment and structure

>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		627
d1paqa_		161	Translation initiation factor eIF-2b epsilon {Bake	100.0
d1fxoa_		292	RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}	100.0
d1mc3a_		291	RffH {Escherichia coli [TaxId: 562]}	100.0
d1lvwa_		295	RmlA (RfbA) {Archaeon Methanobacterium thermoautot	99.96
d1yp2a2		307	Glucose-1-phosphate adenylyltransferase small subu	99.96
d1tzfa_		259	Glucose-1-phosphate cytidylyltransferase RfbF {Sal	99.93
d2cu2a2		268	Putative mannose-1-phosphate guanylyl transferase	99.91
d1jyka_		229	CTP:phosphocholine cytidylytransferase LicC {Strep	99.9
d1g97a2		250	N-acetylglucosamine 1-phosphate uridyltransferase	99.84
d2oi6a2		248	N-acetylglucosamine 1-phosphate uridyltransferase	99.8
d1ug3a2		127	Eukaryotic initiation factor eIF4G {Human (Homo sa	99.79
d1xhda_		172	Putative acetyltransferase/acyltransferase BC4754	99.56
d1qrea_		210	gamma-carbonic anhydrase {Archaeon Methanosarcina	99.51
d1j2za_		259	UDP N-acetylglucosamine acyltransferase {Helicobac	99.51
d1qrea_		210	gamma-carbonic anhydrase {Archaeon Methanosarcina	99.48
d2jf2a1		262	UDP N-acetylglucosamine acyltransferase {Escherich	99.48
d1g97a1		196	N-acetylglucosamine 1-phosphate uridyltransferase	99.47
d2jf2a1		262	UDP N-acetylglucosamine acyltransferase {Escherich	99.44
d1v3wa_		173	Ferripyochelin binding protein {Archaeon Pyrococcu	99.44
d3bswa1		193	Acetyltransferase PglD {Campylobacter jejuni [TaxI	99.42
d1fxja1		78	N-acetylglucosamine 1-phosphate uridyltransferase	99.42
d1yp2a1		135	Glucose-1-phosphate adenylyltransferase small subu	99.41
d1fxja1		78	N-acetylglucosamine 1-phosphate uridyltransferase	99.38
d1krra_		200	Galactoside acetyltransferase {Escherichia coli [T	99.37
d1j2za_		259	UDP N-acetylglucosamine acyltransferase {Helicobac	99.34
d3bswa1		193	Acetyltransferase PglD {Campylobacter jejuni [TaxI	99.34
d2oi6a1		201	N-acetylglucosamine 1-phosphate uridyltransferase	99.31
d1yp2a1		135	Glucose-1-phosphate adenylyltransferase small subu	99.3
d1krra_		200	Galactoside acetyltransferase {Escherichia coli [T	99.23
d3tdta_		274	Tetrahydrodipicolinate-N-succinlytransferase, THDP	99.21
d1g97a1		196	N-acetylglucosamine 1-phosphate uridyltransferase	99.19
d1ocxa_		182	Maltose O-acetyltransferase {Escherichia coli [Tax	99.16
d1vpaa_		221	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.15
d1xhda_		172	Putative acetyltransferase/acyltransferase BC4754	99.14
d2dpwa1		231	Uncharacterized protein TTHA0179 {Thermus thermoph	99.11
d1v3wa_		173	Ferripyochelin binding protein {Archaeon Pyrococcu	99.09
d1i52a_		225	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.08
d1vgwa_		226	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.07
d1vh1a_		246	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	99.05
d1w77a1		226	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.05
d1vica_		255	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	99.04
d3tdta_		274	Tetrahydrodipicolinate-N-succinlytransferase, THDP	99.03
d1ocxa_		182	Maltose O-acetyltransferase {Escherichia coli [Tax	99.02
d1mr7a_		203	Xenobiotic acetyltransferase {Enterococcus faecium	99.02
d2oi6a1		201	N-acetylglucosamine 1-phosphate uridyltransferase	99.01
d1h7ea_		245	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	98.84
d1w55a1		205	IspD/IspF bifunctional enzyme, CDP-me synthase dom	98.79
d1xata_		208	Xenobiotic acetyltransferase {Pseudomonas aerugino	98.79
d1e5ka_		188	Molybdenum cofactor biosynthesis protein MobA {Esc	98.75
d1ssqa_		241	Serine acetyltransferase {Haemophilus influenzae [	98.66
d1eyra_		225	CMP acylneuraminate synthetase {Neisseria meningit	98.65
d1mr7a_		203	Xenobiotic acetyltransferase {Enterococcus faecium	98.62
d1xata_		208	Xenobiotic acetyltransferase {Pseudomonas aerugino	98.62
d1ssqa_		241	Serine acetyltransferase {Haemophilus influenzae [	98.5
d2f9ca1		320	Hypothetical protein YdcK {Salmonella enterica [Ta	98.42
d2icya2		378	UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c	98.41
d2f9ca1		320	Hypothetical protein YdcK {Salmonella enterica [Ta	98.36
d1qwja_		228	CMP acylneuraminate synthetase {Mouse (Mus musculu	98.03
d1jv1a_		501	UDP-N-acetylglucosamine pyrophosphorylase {Human (	97.42
d1h2vc3		310	CBP80, 80KDa nuclear cap-binding protein {Human (H	96.39

>d1paqa_ a.118.1.14 (A:) Translation initiation factor eIF-2b epsilon {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: MIF4G domain-like
domain: Translation initiation factor eIF-2b epsilon
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=2.1e-35  Score=269.81  Aligned_cols=154  Identities=26%  Similarity=0.340  Sum_probs=140.2

Q ss_pred             hHHHHHHHHHHHHHhccCChhhHHHHHHhhHHhcCCChHHHHHHHHHHHHHhhc-CCCCCchhHHHHHHHHHhhHHHHHH
Q psy1482         467 LFYTEVVDSLLRGYEEKLVCDNLTLEINSSRYAYNVTVKEVNFYMVKAILVVKN-KPDMDMKSFHTHMMSKINYFLPLFK  545 (627)
Q Consensus       467 ~F~~ev~~~l~~~~~~~~~~~~~~lei~~lr~a~n~~~~~v~~~v~~ail~~~~-~~~~~~~~~~~~~~~~~~~~~~ll~  545 (627)
                      +|++||+++|+|+++++++++|+++|||++|||||+|.+||+.++++|+|+.+. ..........+++++.|++|+|+|+
T Consensus         1 eF~~Ev~~sl~r~~ee~~~~dn~iLElnslr~a~N~~~~dv~~av~~All~~i~~~~~~~~~~~~~~~~~~l~k~~~ll~   80 (161)
T d1paqa_           1 DFEKEGIATVERAMENNHDLDTALLELNTLRMSMNVTYHEVRIATITALLRRVYHFIATQTLGPKDAVVKVFNQWGLLFK   80 (161)
T ss_dssp             CHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHGGGGG
T ss_pred             ChHHHHHHHHHHHHHcCCChhHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHHHH
Confidence            499999999999999999999999999999999999999999999999999875 3333345567789999999999999


Q ss_pred             HhhcCcHHHHHHHHHHHHHHhh--ccchHHHHHHHHHHHhhcCCCChhhHhhhhhcCC----chhHHhhhHHHHHHhccc
Q psy1482         546 NYIKNESAQQDCLDAFEEFAEE--NESLSVVAGKLLHKLYDKDILSEDIVTKWFNKLE----PSSLRKSVEPFVKWLLEA  619 (627)
Q Consensus       546 ~~~~~~~~q~~~l~ale~~~~~--~~~~~~~~~~il~~lYd~dil~Ee~il~W~~~~~----~~~~~~~~~~fi~WL~ea  619 (627)
                      +|+++.+.|+++|.++|.+|.+  ++...+.|+.+|+.|||.|||+||+|++||++.+    .++++++++|||+||++|
T Consensus        81 ~~~~~~~~q~~~L~~lq~~c~~~~~~~~~~~~~~il~~lY~~dii~Ed~i~~W~~~~~~~~~~~~~~~~~~~fv~WL~~a  160 (161)
T d1paqa_          81 RQAFDEEEYIDLMNIIMEKIVEQSFDKPDLILFSALVSLYDNDIIEEDVIYKWWDNVSTDPRYDEVKKLTVKWVEWLQNA  160 (161)
T ss_dssp             GTCCSHHHHHHHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHTTSSCHHHHHHHHHTCCCCGGGHHHHHHHHHHHHHHHHT
T ss_pred             HHcCCcHHHHHHHHHHHHHHHhccCcccHHHHHHHHHHHHhhchhcHHHHHHHHHcCCCchHHHHHHHHHHHHHHHHHhC
Confidence            9999999999999999999986  3456789999999999999999999999998765    578999999999999999


Q ss_pred             c
Q psy1482         620 D  620 (627)
Q Consensus       620 e  620 (627)
                      |
T Consensus       161 e  161 (161)
T d1paqa_         161 D  161 (161)
T ss_dssp             C
T ss_pred             C
Confidence            7

PyMOL of d1paqa_

>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]}	Back information, alignment and structure

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]}	Back information, alignment and structure

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}	Back information, alignment and structure

>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}	Back information, alignment and structure

>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]}	Back information, alignment and structure

>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]}	Back information, alignment and structure

>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]}	Back information, alignment and structure

>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}	Back information, alignment and structure

>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]}	Back information, alignment and structure

>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}	Back information, alignment and structure

>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}	Back information, alignment and structure

>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}	Back information, alignment and structure

>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]}	Back information, alignment and structure

>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]}	Back information, alignment and structure

>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]}	Back information, alignment and structure

>d1h2vc3 a.118.1.14 (C:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure