Psyllid ID: psy15213

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MIAGEIESSDINKKTNNRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQKRKE
ccccccccEEEEccccccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHccccEEccccccccccccccccccEEEEEEEEEccc
cccccEEEEEEccccccHHHHcccccccEEEEEccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHccccEEEccccccccccccccccccEEEEEEEEccc
miageiessdinkktnnrfrfyknkyfdriladlpctgsgvvrrnpdipwlrrkndikKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKnhkdsirlnspgqllptvnkkqdyDGFFYSLFQKRKE
miageiessdinkktnnRFRFYKNKYFDRILadlpctgsgvvrrnpdipwlrrkndikklsKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPgqllptvnkkqDYDGFFYSLFQKRKE
MIAGEIESSDINKKTNNRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQKRKE
****************NRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKN************LLPTVNKKQDYDGFFYSLF*****
MIAGEIESSDINKKTNNRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQKRK*
********SDINKKTNNRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQKRKE
***GEIESSDINKKTNNRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQKR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAGEIESSDINKKTNNRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQKRKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
A6TEU2431 Ribosomal RNA small subun yes N/A 0.877 0.283 0.437 2e-23
Q87KD3427 Ribosomal RNA small subun yes N/A 0.856 0.278 0.401 3e-23
B5XNC2431 Ribosomal RNA small subun yes N/A 0.884 0.285 0.417 7e-23
Q9KVU5434 Ribosomal RNA small subun yes N/A 0.827 0.264 0.398 6e-22
Q7MGK4426 Ribosomal RNA small subun yes N/A 0.848 0.276 0.396 2e-21
A7MPE7429 Ribosomal RNA small subun yes N/A 0.776 0.251 0.444 2e-21
A8GKG7429 Ribosomal RNA small subun yes N/A 0.784 0.254 0.410 2e-21
B4F1L5422 Ribosomal RNA small subun yes N/A 0.791 0.260 0.429 3e-21
Q8DDE5426 Ribosomal RNA small subun yes N/A 0.848 0.276 0.388 3e-21
A4WF97428 Ribosomal RNA small subun yes N/A 0.762 0.247 0.443 3e-21
>sp|A6TEU2|RSMB_KLEP7 Ribosomal RNA small subunit methyltransferase B OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rsmB PE=3 SV=1 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 84/135 (62%), Gaps = 13/135 (9%)

Query: 13  KKTNNRF--RFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNN 70
           K+ + RF  ++  N+ FDRIL D PC+ +GV+RR+PDI WLRR  DI +L++   +ILN 
Sbjct: 300 KQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQAEILNA 359

Query: 71  LWKMLKPGGKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLN------SPGQL-LPTVNKK 123
           +W  LKPGG L++ TCS+  EE+ +Q   F     D+  L+      SPGQ  LP V   
Sbjct: 360 IWGHLKPGGTLVYATCSILPEENSQQIAAFLARTPDA-ELHATGTPASPGQQNLPGV--- 415

Query: 124 QDYDGFFYSLFQKRK 138
           ++ DGFFY+   KR+
Sbjct: 416 EEGDGFFYAKLIKRR 430
Specifically methylates the cytosine at position 967 (m5C967) of 16S rRNA.
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) (taxid: 272620)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 7EC: 6
>sp|Q87KD3|RSMB_VIBPA Ribosomal RNA small subunit methyltransferase B OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|B5XNC2|RSMB_KLEP3 Ribosomal RNA small subunit methyltransferase B OS=Klebsiella pneumoniae (strain 342) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q9KVU5|RSMB_VIBCH Ribosomal RNA small subunit methyltransferase B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q7MGK4|RSMB_VIBVY Ribosomal RNA small subunit methyltransferase B OS=Vibrio vulnificus (strain YJ016) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A7MPE7|RSMB_CROS8 Ribosomal RNA small subunit methyltransferase B OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A8GKG7|RSMB_SERP5 Ribosomal RNA small subunit methyltransferase B OS=Serratia proteamaculans (strain 568) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|B4F1L5|RSMB_PROMH Ribosomal RNA small subunit methyltransferase B OS=Proteus mirabilis (strain HI4320) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q8DDE5|RSMB_VIBVU Ribosomal RNA small subunit methyltransferase B OS=Vibrio vulnificus (strain CMCP6) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A4WF97|RSMB_ENT38 Ribosomal RNA small subunit methyltransferase B OS=Enterobacter sp. (strain 638) GN=rsmB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
445494814 467 ribosomal RNA small subunit methyltransf 0.827 0.246 0.620 1e-37
399021791 438 ribosomal RNA small subunit methyltransf 0.827 0.262 0.603 2e-37
300309418 424 RNA methyltransferase [Herbaspirillum se 0.827 0.271 0.594 2e-37
152981119 437 tRNA and rRNA cytosine-C5-methylases [Ja 0.827 0.263 0.612 6e-37
395760186 475 tRNA and rRNA cytosine-C5-methylases [Ja 0.827 0.242 0.603 1e-36
409408653 439 RNA methyltransferase [Herbaspirillum sp 0.820 0.259 0.606 3e-36
193222202 453 putative 16S rRNA methyltransferase B [H 0.827 0.253 0.603 4e-36
134093422 449 S-adenosyl-L-methionine-dependent RNA me 0.827 0.256 0.603 4e-36
237746959 441 tRNA and rRNA cytosine-C5-methylase [Oxa 0.913 0.287 0.554 1e-35
427402481 553 ribosomal RNA small subunit methyltransf 0.834 0.209 0.606 1e-35
>gi|445494814|ref|ZP_21461858.1| ribosomal RNA small subunit methyltransferase B [Janthinobacterium sp. HH01] gi|444790975|gb|ELX12522.1| ribosomal RNA small subunit methyltransferase B [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 72/116 (62%), Positives = 91/116 (78%), Gaps = 1/116 (0%)

Query: 21  FYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGK 80
           ++  K FDRILAD+PCT SG+VRR+PDI WLRRK D  +L+  S KIL+NLW+ML PGGK
Sbjct: 351 WWDGKLFDRILADVPCTASGIVRRHPDIRWLRRKGDTLQLATLSSKILDNLWQMLAPGGK 410

Query: 81  LLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVNKKQDYDGFFYSLFQK 136
           LLFVTCSLW +ESE QA  F+  ++ ++RL++PGQLLP     QD+DG FY+LFQK
Sbjct: 411 LLFVTCSLWPQESEAQAAAFAVRNQ-AVRLDAPGQLLPAGGAGQDHDGLFYALFQK 465

Source: Janthinobacterium sp. HH01

Species: Janthinobacterium sp. HH01

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|399021791|ref|ZP_10723882.1| ribosomal RNA small subunit methyltransferase RsmB [Herbaspirillum sp. CF444] gi|398090570|gb|EJL81038.1| ribosomal RNA small subunit methyltransferase RsmB [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|300309418|ref|YP_003773510.1| RNA methyltransferase [Herbaspirillum seropedicae SmR1] gi|300072203|gb|ADJ61602.1| RNA methyltransferase (SUN protein) protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|152981119|ref|YP_001351848.1| tRNA and rRNA cytosine-C5-methylases [Janthinobacterium sp. Marseille] gi|151281196|gb|ABR89606.1| tRNA and rRNA cytosine-C5-methylases [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|395760186|ref|ZP_10440855.1| tRNA and rRNA cytosine-C5-methylases [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|409408653|ref|ZP_11257088.1| RNA methyltransferase [Herbaspirillum sp. GW103] gi|386431975|gb|EIJ44803.1| RNA methyltransferase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|193222202|emb|CAL60368.2| putative 16S rRNA methyltransferase B [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|134093422|ref|YP_001098497.1| S-adenosyl-L-methionine-dependent RNA methyltransferase [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|237746959|ref|ZP_04577439.1| tRNA and rRNA cytosine-C5-methylase [Oxalobacter formigenes HOxBLS] gi|229378310|gb|EEO28401.1| tRNA and rRNA cytosine-C5-methylase [Oxalobacter formigenes HOxBLS] Back     alignment and taxonomy information
>gi|427402481|ref|ZP_18893478.1| ribosomal RNA small subunit methyltransferase B [Massilia timonae CCUG 45783] gi|425718287|gb|EKU81234.1| ribosomal RNA small subunit methyltransferase B [Massilia timonae CCUG 45783] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; 1e-48
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 5e-32
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 2e-26
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 2e-25
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 1e-22
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 3e-20
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 1e-17
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; 3e-17
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 6e-17
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 1e-06
>gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information 
 Score =  160 bits (408), Expect = 1e-48
 Identities = 57/117 (48%), Positives = 72/117 (61%), Gaps = 9/117 (7%)

Query: 27  FDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTC 86
           FDRIL D PC+ +GV+RR+PDI WLRR  DI  L+    +IL+ LW +LKPGG LL+ TC
Sbjct: 314 FDRILLDAPCSATGVIRRHPDIKWLRRPEDIAALAALQSEILDALWPLLKPGGTLLYATC 373

Query: 87  SLWFEESEEQAIIFSKNHKDSIRL------NSPGQLLPTVNKKQDYDGFFYSLFQKR 137
           S+  EE+E+Q   F   H D+  L          QLLP     +D DGFFY+L  KR
Sbjct: 374 SILPEENEQQIKAFLARHPDAELLDTGTPQQPGRQLLPGE---EDGDGFFYALLIKR 427

Length = 427
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 100.0
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 100.0
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 100.0
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 100.0
KOG1122|consensus460 100.0
PRK14901434 16S rRNA methyltransferase B; Provisional 100.0
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 100.0
PRK14903431 16S rRNA methyltransferase B; Provisional 100.0
PRK14904445 16S rRNA methyltransferase B; Provisional 100.0
PRK10901427 16S rRNA methyltransferase B; Provisional 99.97
PRK14902444 16S rRNA methyltransferase B; Provisional 99.97
KOG2198|consensus375 99.93
KOG2360|consensus413 99.72
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.06
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.74
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.65
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.15
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 97.89
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.58
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.54
PRK14967223 putative methyltransferase; Provisional 97.48
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.31
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.28
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.87
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.83
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 96.65
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.42
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 96.41
TIGR00438188 rrmJ cell division protein FtsJ. 96.38
COG1041347 Predicted DNA modification methylase [DNA replicat 96.01
PRK00811283 spermidine synthase; Provisional 95.96
KOG2671|consensus421 95.94
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 95.91
TIGR00536284 hemK_fam HemK family putative methylases. The gene 95.79
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 95.71
PRK14968188 putative methyltransferase; Provisional 95.52
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 95.39
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 95.37
PRK01581374 speE spermidine synthase; Validated 95.12
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 95.0
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 95.0
PRK11524 284 putative methyltransferase; Provisional 94.98
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 94.92
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 94.71
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 94.46
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 94.45
PLN02366308 spermidine synthase 94.38
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 94.27
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 93.82
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 93.79
COG4123248 Predicted O-methyltransferase [General function pr 93.69
PRK03612521 spermidine synthase; Provisional 93.38
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 93.34
PRK04266226 fibrillarin; Provisional 93.02
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 92.74
PLN02476278 O-methyltransferase 92.68
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 92.4
PLN02823336 spermine synthase 92.32
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 92.3
PHA03411279 putative methyltransferase; Provisional 91.97
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 91.82
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 91.75
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 90.89
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 90.62
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 90.54
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 90.5
PF01555 231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 90.44
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 90.26
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 89.87
COG2265432 TrmA SAM-dependent methyltransferases related to t 89.78
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 89.57
COG2521287 Predicted archaeal methyltransferase [General func 89.51
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 89.29
PRK13699 227 putative methylase; Provisional 88.72
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 88.45
COG4122219 Predicted O-methyltransferase [General function pr 88.44
PRK04457262 spermidine synthase; Provisional 88.11
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 87.69
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 87.68
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 87.43
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 87.42
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 87.42
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 86.83
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 86.45
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 86.37
PTZ00146293 fibrillarin; Provisional 85.26
PRK08317241 hypothetical protein; Provisional 85.19
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 85.0
KOG1663|consensus237 85.0
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 84.81
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 84.65
PLN02589247 caffeoyl-CoA O-methyltransferase 84.6
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 84.34
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 84.26
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 83.77
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 83.75
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 83.27
PRK00536262 speE spermidine synthase; Provisional 83.16
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 82.6
COG0742187 N6-adenine-specific methylase [DNA replication, re 82.3
PF05063176 MT-A70: MT-A70 ; InterPro: IPR007757 N6-methyladen 82.04
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 81.94
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 81.25
PHA03412241 putative methyltransferase; Provisional 80.55
COG2263198 Predicted RNA methylase [Translation, ribosomal st 80.46
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 80.39
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 80.07
PLN03075296 nicotianamine synthase; Provisional 80.01
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=6.6e-41  Score=280.11  Aligned_cols=125  Identities=41%  Similarity=0.667  Sum_probs=110.0

Q ss_pred             cccccC-ccccccCCCCcCEEEEcCCCCCccccccCCCCCccCCHhHHHHHHHHHHHHHHHHHhcccCCcEEEEeccCCC
Q psy15213         11 INKKTN-NRFRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLW   89 (139)
Q Consensus        11 ~~~~~~-~~~~~~~~~~fD~ILlDaPCSg~G~~~r~p~~~~~~~~~~~~~l~~~Q~~lL~~a~~~lk~gG~lvYsTCS~~   89 (139)
                      ++.++. .+..|.....||+|||||||||+|++||||+++|.++++++.+++++|++||.+|+++|||||+|||||||++
T Consensus       213 ~~~d~~~~~~~~~~~~~fD~iLlDaPCSg~G~irr~Pd~~~~~~~~~i~~l~~lQ~~iL~~a~~~lk~GG~LVYSTCS~~  292 (355)
T COG0144         213 VNKDARRLAELLPGGEKFDRILLDAPCSGTGVIRRDPDVKWRRTPEDIAELAKLQKEILAAALKLLKPGGVLVYSTCSLT  292 (355)
T ss_pred             EecccccccccccccCcCcEEEECCCCCCCcccccCccccccCCHHHHHHHHHHHHHHHHHHHHhcCCCCEEEEEccCCc
Confidence            344443 3345555557999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccHHHHHHHHhhCCCcEEecCC-----------------CcccCCCCCCCCCCcEEEEEEEecC
Q psy15213         90 FEESEEQAIIFSKNHKDSIRLNSP-----------------GQLLPTVNKKQDYDGFFYSLFQKRK  138 (139)
Q Consensus        90 ~~ENE~vV~~~l~~~~~~~~~~~~-----------------~~~~P~~~~~~~~~GfFia~l~k~~  138 (139)
                      |+|||+||++||++++++++.+..                 .+++||.   ++++|||+|+|+|..
T Consensus       293 ~eENE~vV~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~p~~---~~~dGFFia~l~k~~  355 (355)
T COG0144         293 PEENEEVVERFLERHPDFELEPVRLPWGPLFEGLGSELGKTRRLYPHV---HGTDGFFIAKLRKKR  355 (355)
T ss_pred             hhcCHHHHHHHHHhCCCceeecccccccccccccccccCCeEEECCCC---CCCCCeEEEEEEeCC
Confidence            999999999999999998766531                 4789988   788999999999863

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05063 MT-A70: MT-A70 ; InterPro: IPR007757 N6-methyladenosine (m6A) is present at internal sites in eukaryotic mRNA Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 1e-19
2yxl_A450 Crystal Structure Of Ph0851 Length = 450 5e-15
2frx_A 479 Crystal Structure Of Yebu, A M5c Rna Methyltransfer 4e-13
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 2e-12
3m6w_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 4e-07
3m6u_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 4e-07
3m4x_A 456 Structure Of A Ribosomal Methyltransferase Length = 1e-06
3m6x_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 2e-06
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 1e-05
>pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 Back     alignment and structure 
Iteration: 1

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 70/117 (59%), Gaps = 9/117 (7%)
Query: 27  FDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTC 86
           FDRIL D PC+ +GV+RR+PDI WLRR  DI +L++   +IL+ +W  LK GG L++ TC
Sbjct: 316 FDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKTGGTLVYATC 375
Query: 87  SLWFEESEEQAIIFSKNHKDSIRLNS-----PG-QLLPTVNKKQDYDGFFYSLFQKR 137
           S+  EE+  Q   F +   D+    +     PG Q LP     ++ DGFFY+   K+
Sbjct: 376 SVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNLPGA---EEGDGFFYAKLIKK 429
>pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450 Back     alignment and structure
>pdb|2FRX|A Chain A, Crystal Structure Of Yebu, A M5c Rna Methyltransferase From E.Coli Length = 479 Back     alignment and structure
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure
>pdb|3M6W|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 In Complex With S-Adenosyl-L- Methionine Length = 464 Back     alignment and structure
>pdb|3M6U|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group 43 Length = 464 Back     alignment and structure
>pdb|3M4X|A Chain A, Structure Of A Ribosomal Methyltransferase Length = 456 Back     alignment and structure
>pdb|3M6X|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 Length = 464 Back     alignment and structure
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 8e-46
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 9e-41
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 2e-28
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 1e-26
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 6e-26
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 1e-25
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 4e-24
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 1e-23
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure
 Score =  152 bits (387), Expect = 8e-46
 Identities = 47/123 (38%), Positives = 70/123 (56%), Gaps = 9/123 (7%)

Query: 21  FYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGK 80
           +   + FDRIL D PC+ +GV+RR+PDI WLRR  DI +L++   +IL+ +W  LK GG 
Sbjct: 310 WCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKTGGT 369

Query: 81  LLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPG------QLLPTVNKKQDYDGFFYSLF 134
           L++ TCS+  EE+  Q   F +   D+    +        Q LP     ++ DGFFY+  
Sbjct: 370 LVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNLPG---AEEGDGFFYAKL 426

Query: 135 QKR 137
            K+
Sbjct: 427 IKK 429
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 100.0
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 100.0
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 100.0
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.98
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.97
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.97
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.97
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.97
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.94
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.82
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.65
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.48
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.37
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.34
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.26
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.14
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.11
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.07
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.06
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.03
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.97
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.92
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.87
3lpm_A259 Putative methyltransferase; structural genomics, p 97.77
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 97.74
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.73
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 97.71
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.68
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.56
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.53
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.41
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.4
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 97.24
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.22
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.18
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.1
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 97.09
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.05
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.01
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 96.93
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 96.93
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 96.92
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.86
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.84
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 96.83
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 96.82
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.78
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.74
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.71
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.71
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.62
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.59
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.55
2pt6_A321 Spermidine synthase; transferase, structural genom 96.54
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.52
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.47
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.4
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 96.4
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 96.37
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 96.37
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 96.31
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.14
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.13
2o07_A304 Spermidine synthase; structural genomics, structur 96.13
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 96.08
3k6r_A278 Putative transferase PH0793; structural genomics, 96.07
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.04
2i7c_A283 Spermidine synthase; transferase, structural genom 96.01
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.01
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 95.93
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 95.9
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 95.89
3khk_A544 Type I restriction-modification system methylation 95.68
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 95.6
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 95.47
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 95.43
2cmg_A262 Spermidine synthase; transferase, putrescine amino 95.36
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 95.35
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 95.34
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 95.32
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 95.32
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 95.23
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 95.17
2zig_A 297 TTHA0409, putative modification methylase; methylt 95.16
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 95.0
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 94.95
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 94.93
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.91
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 94.9
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 94.9
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 94.71
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 94.66
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 94.65
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 94.57
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 94.5
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 94.44
3lkd_A 542 Type I restriction-modification system methyltrans 94.35
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 94.33
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 94.31
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 94.29
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 94.28
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 94.28
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 94.25
2fpo_A202 Methylase YHHF; structural genomics, putative meth 93.88
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 93.82
2esr_A177 Methyltransferase; structural genomics, hypothetic 93.7
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 93.58
3lcc_A235 Putative methyl chloride transferase; halide methy 93.57
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 93.44
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 93.42
1ws6_A171 Methyltransferase; structural genomics, riken stru 93.28
1xj5_A334 Spermidine synthase 1; structural genomics, protei 93.26
2hwk_A320 Helicase NSP2; rossman fold, alpha/beta/alpha, mul 93.18
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 93.04
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 92.8
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 92.8
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 92.67
3hnr_A220 Probable methyltransferase BT9727_4108; structural 92.38
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 92.13
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 92.02
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 91.88
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 91.87
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 91.82
3trk_A324 Nonstructural polyprotein; hydrolase; 2.40A {Chiku 91.42
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 91.3
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 91.23
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 91.15
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 91.09
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 90.9
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 90.73
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 90.73
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 90.69
3gjy_A317 Spermidine synthase; APC62791, structural genomics 90.55
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 90.53
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 90.52
1jsx_A207 Glucose-inhibited division protein B; methyltransf 90.4
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 90.35
3dtn_A234 Putative methyltransferase MM_2633; structural gen 89.98
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 89.44
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 89.42
3f4k_A257 Putative methyltransferase; structural genomics, P 89.4
2i62_A265 Nicotinamide N-methyltransferase; structural genom 89.29
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 89.03
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 88.72
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 88.72
2kw5_A202 SLR1183 protein; structural genomics, northeast st 88.68
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 88.61
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 88.57
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 88.44
3dh0_A219 SAM dependent methyltransferase; cystal structure, 88.25
2h00_A254 Methyltransferase 10 domain containing protein; st 87.86
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 87.78
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 87.76
3m70_A286 Tellurite resistance protein TEHB homolog; structu 87.52
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 87.03
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 86.98
2b25_A336 Hypothetical protein; structural genomics, methyl 86.76
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 86.74
3ocj_A305 Putative exported protein; structural genomics, PS 86.65
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 86.64
3cvo_A202 Methyltransferase-like protein of unknown functio; 86.23
4gua_A 670 Non-structural polyprotein; viral precursor polypr 86.06
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 86.02
3i9f_A170 Putative type 11 methyltransferase; structural gen 85.22
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 85.11
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 85.05
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 84.97
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 84.92
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 84.84
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 84.71
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 84.64
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 84.61
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 84.46
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 84.19
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 84.14
3ufb_A 530 Type I restriction-modification system methyltran 84.01
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 83.7
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 83.63
1ne2_A200 Hypothetical protein TA1320; structural genomics, 83.57
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 82.86
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 82.73
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 82.62
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 82.28
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 81.93
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 81.8
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 81.57
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 81.25
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 81.2
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 81.19
2oo3_A283 Protein involved in catabolism of external DNA; st 81.06
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 81.0
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 80.66
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 80.39
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 80.27
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-37  Score=256.66  Aligned_cols=114  Identities=19%  Similarity=0.362  Sum_probs=99.0

Q ss_pred             CCCCcCEEEEcCCCCCc--cccccCCCCCccCCHhHHHHHHHHHHHHHHHHHhcccCCcEEEEeccCCCccccHHHHHHH
Q psy15213         23 KNKYFDRILADLPCTGS--GVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAIIF  100 (139)
Q Consensus        23 ~~~~fD~ILlDaPCSg~--G~~~r~p~~~~~~~~~~~~~l~~~Q~~lL~~a~~~lk~gG~lvYsTCS~~~~ENE~vV~~~  100 (139)
                      ..+.||+|||||||||+  |+++++|+++|.++++++..++.+|++||.+|+++|||||+|||||||++|+|||+||++|
T Consensus       220 ~~~~fD~VLlDaPCSg~g~g~~r~~~~~~~~~~~~~~~~l~~lQ~~iL~~a~~~lkpGG~LVYsTCSl~~~ENE~vV~~~  299 (359)
T 4fzv_A          220 EGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGA  299 (359)
T ss_dssp             STTCEEEEEEECCCCCHHHHTTCCTTCTTSGGGHHHHHTHHHHHHHHHHHHHHTEEEEEEEEEEESCCCTTTTHHHHHHH
T ss_pred             ccccCCEEEECCccCCCCCcccccChhhhhhCCHHHHHHHHHHHHHHHHHHHhcCCCCcEEEEEeCCCchhhCHHHHHHH
Confidence            35789999999999997  7889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhCCCcEEec-----CC-------------------CcccCCCCCCCCCCcEEEEEEEecC
Q psy15213        101 SKNHKDSIRLN-----SP-------------------GQLLPTVNKKQDYDGFFYSLFQKRK  138 (139)
Q Consensus       101 l~~~~~~~~~~-----~~-------------------~~~~P~~~~~~~~~GfFia~l~k~~  138 (139)
                      |++++++..++     ++                   .+++|+.  ..+++|||+|+|+|.+
T Consensus       300 L~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~r~~P~~--~~~~gGFFiA~L~KvS  359 (359)
T 4fzv_A          300 IELLANQYSIQVQVEDLTHFRRVFMDTFCFFSSCQVGELVIPNL--MANFGPMYFCKMRRLT  359 (359)
T ss_dssp             HHHHHHHHCCCEEECCCHHHHHHHTTTCEECTTCSSSEEEECBT--TBCCCCEEEEEEEECC
T ss_pred             HHhCCCCcccccccccccccccccccccccCccccceEEECCCC--CCCCCCEEEEEEEECC
Confidence            99876532211     10                   2678876  2467889999999975
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 4e-18
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 1e-15
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 3e-11
d2as0a2324 c.66.1.51 (A:73-396) Hypothetical protein PH1915, 2e-07
d1wxxa2318 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280 4e-07
d2b78a2317 c.66.1.51 (A:69-385) Hypothetical protein SMu776, 8e-05
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 76.3 bits (186), Expect = 4e-18
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 19  FRFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPG 78
            ++   + FDRIL D PC+ +GV+RR+PDI WLRR  DI +L++   +IL+ +W  LK G
Sbjct: 164 SQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKTG 223

Query: 79  GKLLFVTCSLWFEESEEQAIIFSKNHKDSIRLNSPGQLLPTVN---KKQDYDGFFYSLFQ 135
           G L++ TCS+  EE+  Q   F +   D+    +     P        ++ DGFFY+   
Sbjct: 224 GTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNLPGAEEGDGFFYAKLI 283

Query: 136 K 136
           K
Sbjct: 284 K 284
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 324 Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Length = 318 Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Length = 317 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 100.0
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 100.0
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.24
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.17
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.93
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.27
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.51
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 97.05
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.01
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.7
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.67
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 96.08
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.03
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.0
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 95.98
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 95.91
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.76
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 95.27
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 95.03
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 94.88
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 94.81
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 94.7
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 94.22
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 93.89
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 93.87
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 93.68
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 93.59
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 93.57
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 93.18
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 93.11
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 93.1
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 92.64
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 92.48
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 91.91
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 91.85
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 91.74
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 91.61
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 91.55
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 90.78
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 90.4
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 88.75
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 87.94
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 87.93
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 85.4
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 85.35
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 85.24
d1hrua_ 186 Hypothetical protein YrdC {Escherichia coli [TaxId 84.65
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 84.59
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 81.25
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 80.38
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=9.2e-43  Score=279.73  Aligned_cols=114  Identities=41%  Similarity=0.773  Sum_probs=106.6

Q ss_pred             cccCCCCcCEEEEcCCCCCccccccCCCCCccCCHhHHHHHHHHHHHHHHHHHhcccCCcEEEEeccCCCccccHHHHHH
Q psy15213         20 RFYKNKYFDRILADLPCTGSGVVRRNPDIPWLRRKNDIKKLSKYSCKILNNLWKMLKPGGKLLFVTCSLWFEESEEQAII   99 (139)
Q Consensus        20 ~~~~~~~fD~ILlDaPCSg~G~~~r~p~~~~~~~~~~~~~l~~~Q~~lL~~a~~~lk~gG~lvYsTCS~~~~ENE~vV~~   99 (139)
                      .+.....||+|||||||||+|+++|+|+++|.+++.++.+++++|++||.+|+++|||||+|||||||++|+|||+||++
T Consensus       165 ~~~~~~~fd~IL~DaPCSg~G~~rr~p~~~~~~~~~~~~~l~~lQ~~iL~~a~~~lk~gG~lvYsTCS~~~~ENE~vv~~  244 (284)
T d1sqga2         165 QWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKTGGTLVYATCSVLPEENSLQIKA  244 (284)
T ss_dssp             HHHTTCCEEEEEEECCCCCGGGTTTCTTHHHHCCTTHHHHHHHHHHHHHHHHGGGEEEEEEEEEEESCCCGGGTHHHHHH
T ss_pred             hhcccccccEEEEeccccccCccccccchhhccccchhhHHHHHHHHHHHHHHHhcCCCceEEEeeecCchhhCHHHHHH
Confidence            44455789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCCcEEecCC------CcccCCCCCCCCCCcEEEEEEEe
Q psy15213        100 FSKNHKDSIRLNSP------GQLLPTVNKKQDYDGFFYSLFQK  136 (139)
Q Consensus       100 ~l~~~~~~~~~~~~------~~~~P~~~~~~~~~GfFia~l~k  136 (139)
                      ||++++++++++..      .+++|+.   +++||||+|+|+|
T Consensus       245 ~l~~~~~~~~~~~~~~~~~~~~~~P~~---~~~dGFF~A~l~K  284 (284)
T d1sqga2         245 FLQRTADAELCETGTPEQPGKQNLPGA---EEGDGFFYAKLIK  284 (284)
T ss_dssp             HHHHCTTCEECSSBCSSSBSEEECCCT---TSCCSEEEEEEEC
T ss_pred             HHHhCCCcEEecCCCCCCCcEEECCCC---CCcccEEEEEEEC
Confidence            99999999887642      4789998   9999999999987
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hrua_ d.115.1.1 (A:) Hypothetical protein YrdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure