Psyllid ID: psy15255


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
ccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccc
ccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHcccccccEEEEEEEc
MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIddagnnlwpeFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIddagnnlwPEFLQFLFQCANSDNTTLKESALRLFtsvpeifgnqeSTYLVVIKQMLQqcllppnpysvqalqlkf
mniiqdagrsveeRQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
*****************AVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPY*********
****************SAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDN**IRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCD***IRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q8BKC5 1097 Importin-5 OS=Mus musculu yes N/A 0.854 0.154 0.401 5e-28
O00410 1097 Importin-5 OS=Homo sapien yes N/A 0.854 0.154 0.395 9e-28
Q8BIV3 1105 Ran-binding protein 6 OS= no N/A 0.683 0.123 0.315 6e-19
O60518 1105 Ran-binding protein 6 OS= no N/A 0.678 0.122 0.362 8e-18
O74476 1095 Importin subunit beta-3 O yes N/A 0.407 0.073 0.325 4e-08
P32337 1089 Importin subunit beta-3 O yes N/A 0.261 0.047 0.421 0.0004
>sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 Back     alignment and function desciption
 Score =  124 bits (310), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 106/177 (59%), Gaps = 7/177 (3%)

Query: 13  ERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNL--KSQIILLLQTCDNDNIRRKICDAAAE 70
           E+Q   +LL  + S D   +  K A     N+  +S+I  LLQ   N     +    AA 
Sbjct: 7   EQQQFYLLLGNLLSPD--NVVRKQAEETYENIPGRSKITFLLQAIRNTTAAEEARQMAAV 64

Query: 71  VARNLIDDAGNNLWPEF---LQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDA 127
           + R L+  A + ++P     +Q  +KS++++++Q     ++R+KICD AAE+ARNLID+ 
Sbjct: 65  LLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIDED 124

Query: 128 GNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCL 184
           GNN WPE L+FLF   +S N  L+E+AL +F + P IFGNQ+  YL VIK+ML QC+
Sbjct: 125 GNNQWPEGLKFLFDSVSSQNMGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCM 181




Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A (By similarity). In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones.
Mus musculus (taxid: 10090)
>sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 Back     alignment and function description
>sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=2 SV=3 Back     alignment and function description
>sp|O60518|RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens GN=RANBP6 PE=1 SV=2 Back     alignment and function description
>sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 Back     alignment and function description
>sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
91084051 1106 PREDICTED: similar to importin beta-3 [T 0.728 0.131 0.430 4e-35
307187370 1119 Importin-5 [Camponotus floridanus] 0.844 0.150 0.475 9e-34
332027053 1096 Importin-5 [Acromyrmex echinatior] 0.844 0.153 0.475 2e-33
307196332 1096 Importin-5 [Harpegnathos saltator] 0.758 0.137 0.5 8e-33
322795803 410 hypothetical protein SINV_12652 [Solenop 0.844 0.409 0.464 1e-32
242005580 1105 Importin beta-3, putative [Pediculus hum 0.663 0.119 0.416 5e-32
383864135 1093 PREDICTED: importin-5 [Megachile rotunda 0.844 0.153 0.459 6e-32
380025547 1109 PREDICTED: importin-5 [Apis florea] 0.763 0.137 0.490 2e-31
350421036 1110 PREDICTED: importin-5-like [Bombus impat 0.788 0.141 0.463 2e-31
340727447 1110 PREDICTED: importin-5-like [Bombus terre 0.864 0.154 0.458 3e-31
>gi|91084051|ref|XP_967428.1| PREDICTED: similar to importin beta-3 [Tribolium castaneum] gi|270006692|gb|EFA03140.1| hypothetical protein TcasGA2_TC013052 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 106/193 (54%), Gaps = 48/193 (24%)

Query: 1   MNIIQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNI 60
           +  I +AG   E RQMSAVLLR++F+ DF+E + KL                        
Sbjct: 43  LGAIHNAGLGDEARQMSAVLLRRLFANDFLEFFPKL------------------------ 78

Query: 61  RRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVA 120
                                   P   Q  LK Q++L +Q    + +R K+C+ AAEVA
Sbjct: 79  ------------------------PPASQAQLKEQVLLAIQQDQTEQLRHKVCEVAAEVA 114

Query: 121 RNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQML 180
           RNLIDD GNN WPEFLQFLFQCAN+ N  LKE+AL++FTSVP +FGNQ++ YL +IKQML
Sbjct: 115 RNLIDDDGNNQWPEFLQFLFQCANAPNNVLKEAALQMFTSVPGVFGNQQNNYLDLIKQML 174

Query: 181 QQCLLPPNPYSVQ 193
            Q L P   Y V+
Sbjct: 175 MQSLAPTEAYEVR 187




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307187370|gb|EFN72493.1| Importin-5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332027053|gb|EGI67149.1| Importin-5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307196332|gb|EFN77942.1| Importin-5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322795803|gb|EFZ18482.1| hypothetical protein SINV_12652 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242005580|ref|XP_002423642.1| Importin beta-3, putative [Pediculus humanus corporis] gi|212506802|gb|EEB10904.1| Importin beta-3, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383864135|ref|XP_003707535.1| PREDICTED: importin-5 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025547|ref|XP_003696532.1| PREDICTED: importin-5 [Apis florea] Back     alignment and taxonomy information
>gi|350421036|ref|XP_003492709.1| PREDICTED: importin-5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727447|ref|XP_003402055.1| PREDICTED: importin-5-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
UNIPROTKB|Q3B7N3 422 RANBP6 "RAN binding protein 6" 0.924 0.436 0.382 1.5e-28
MGI|MGI:1917822 1097 Ipo5 "importin 5" [Mus musculu 0.924 0.167 0.382 1.4e-27
RGD|1308715 1097 Ipo5 "importin 5" [Rattus norv 0.924 0.167 0.382 1.4e-27
UNIPROTKB|O00410 1097 IPO5 "Importin-5" [Homo sapien 0.924 0.167 0.376 1.8e-27
UNIPROTKB|F1MPE5 1110 IPO5 "Uncharacterized protein" 0.924 0.165 0.382 3e-27
UNIPROTKB|H0Y3V4182 IPO5 "Importin-5" [Homo sapien 0.773 0.846 0.409 5.7e-27
UNIPROTKB|C9JMV5165 IPO5 "Importin-5" [Homo sapien 0.703 0.848 0.426 9.4e-27
UNIPROTKB|F1RP44 1067 IPO5 "Uncharacterized protein" 0.773 0.144 0.407 6.9e-26
UNIPROTKB|E2RF06 1089 IPO5 "Uncharacterized protein" 0.773 0.141 0.407 7.1e-26
UNIPROTKB|H0Y8C6 1099 IPO5 "Importin-5" [Homo sapien 0.773 0.140 0.401 7.3e-26
UNIPROTKB|Q3B7N3 RANBP6 "RAN binding protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 1.5e-28, P = 1.5e-28
 Identities = 73/191 (38%), Positives = 111/191 (58%)

Query:    13 ERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNL--KSQIILLLQTCDNDNIRRKICDAAAE 70
             E+Q   +LL  + S D   +  K A     N+  +S+I  LLQ   N     +    AA 
Sbjct:     7 EQQQFYLLLGNLLSPD--NVVRKQAEETYENIPGQSKITFLLQAIRNTAAAEEARQMAAV 64

Query:    71 VARNLIDDAGNNLWPEF---LQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDA 127
             + R L+  A + ++P     +Q  +KS++++++Q     ++R+KICD AAE+ARNLID+ 
Sbjct:    65 LLRRLLSSAFDEVYPTLPTDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIDED 124

Query:   128 GNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCLLPP 187
             GNN WPE L+FLF   +S N  L+E+AL +F + P IFGNQ+  YL VIK+ML QC+   
Sbjct:   125 GNNQWPEGLKFLFDSVSSQNMGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQ 184

Query:   188 NPYSVQALQLK 198
                S++ L  +
Sbjct:   185 EHPSIRTLSAR 195


GO:0008565 "protein transporter activity" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0005643 "nuclear pore" evidence=IEA
MGI|MGI:1917822 Ipo5 "importin 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308715 Ipo5 "importin 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O00410 IPO5 "Importin-5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPE5 IPO5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y3V4 IPO5 "Importin-5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JMV5 IPO5 "Importin-5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RP44 IPO5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF06 IPO5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y8C6 IPO5 "Importin-5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG2171|consensus 1075 99.92
KOG2023|consensus 885 99.92
KOG1241|consensus 859 99.82
KOG2171|consensus 1075 99.8
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.71
KOG1241|consensus 859 99.31
KOG2023|consensus 885 99.11
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 99.05
KOG2274|consensus 1005 99.03
KOG1992|consensus 960 98.81
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.81
PF0381077 IBN_N: Importin-beta N-terminal domain; InterPro: 98.68
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.62
KOG1993|consensus 978 98.59
PRK09687280 putative lyase; Provisional 98.52
KOG1991|consensus 1010 98.5
PRK09687280 putative lyase; Provisional 98.39
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.24
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.22
KOG0211|consensus 759 98.16
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.13
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.11
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.09
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.06
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.05
COG5657 947 CSE1 CAS/CSE protein involved in chromosome segreg 98.04
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.98
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 97.98
KOG1824|consensus 1233 97.94
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.92
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.9
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.89
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 97.85
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 97.85
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.84
KOG1240|consensus 1431 97.8
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.79
KOG1242|consensus 569 97.78
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.77
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.77
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.76
KOG2956|consensus516 97.76
KOG0213|consensus 1172 97.71
KOG0166|consensus 514 97.71
COG5101 1053 CRM1 Importin beta-related nuclear transport recep 97.66
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.66
KOG2274|consensus 1005 97.54
PF08167165 RIX1: rRNA processing/ribosome biogenesis 97.5
PTZ00429 746 beta-adaptin; Provisional 97.5
KOG1967|consensus1030 97.49
KOG0211|consensus 759 97.46
KOG1248|consensus 1176 97.42
KOG1967|consensus1030 97.32
KOG1943|consensus 1133 97.24
KOG1824|consensus 1233 97.24
PF04510174 DUF577: Family of unknown function (DUF577); Inter 97.21
KOG1059|consensus 877 97.21
KOG0166|consensus 514 97.16
PF04510174 DUF577: Family of unknown function (DUF577); Inter 97.14
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.13
KOG0212|consensus 675 97.13
PF13251182 DUF4042: Domain of unknown function (DUF4042) 97.13
PTZ00429 746 beta-adaptin; Provisional 97.1
PF12719 298 Cnd3: Nuclear condensing complex subunits, C-term 97.08
KOG0213|consensus 1172 97.06
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.03
TIGR02270 410 conserved hypothetical protein. Members are found 97.03
KOG1060|consensus 968 97.0
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 96.91
PF13251182 DUF4042: Domain of unknown function (DUF4042) 96.91
KOG1949|consensus 1005 96.91
KOG1242|consensus 569 96.84
PF05004309 IFRD: Interferon-related developmental regulator ( 96.8
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 96.77
KOG1020|consensus 1692 96.7
COG5656 970 SXM1 Importin, protein involved in nuclear import 96.68
KOG4653|consensus982 96.6
KOG2160|consensus342 96.53
KOG1020|consensus 1692 96.44
KOG1062|consensus 866 96.41
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 96.38
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.37
KOG2032|consensus 533 96.33
KOG2032|consensus 533 96.33
KOG2956|consensus516 96.31
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.23
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.11
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 96.06
COG1413335 FOG: HEAT repeat [Energy production and conversion 96.05
KOG0915|consensus 1702 96.04
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 95.96
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 95.96
KOG0212|consensus 675 95.91
KOG1243|consensus 690 95.69
TIGR02270 410 conserved hypothetical protein. Members are found 95.66
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.62
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 95.57
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 95.54
KOG1820|consensus 815 95.45
KOG1077|consensus 938 95.45
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 95.44
KOG2025|consensus 892 95.44
KOG0567|consensus289 95.41
KOG2160|consensus342 95.37
PF04826 254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 95.16
PF05004309 IFRD: Interferon-related developmental regulator ( 95.11
KOG2933|consensus334 95.08
PF1036392 DUF2435: Protein of unknown function (DUF2435) 95.08
KOG0392|consensus 1549 95.02
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 94.94
KOG2062|consensus 929 94.75
KOG1240|consensus 1431 94.75
KOG1061|consensus 734 94.64
KOG1248|consensus 1176 94.55
KOG1949|consensus 1005 94.54
KOG2025|consensus 892 94.48
KOG2149|consensus 393 94.48
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 94.47
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 94.45
KOG1991|consensus 1010 94.44
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 94.42
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 94.41
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 94.38
KOG0567|consensus289 94.36
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 94.36
PF04118 307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 94.27
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 94.15
KOG1837|consensus1621 94.12
KOG0915|consensus 1702 94.05
KOG1992|consensus 960 94.02
PF12719 298 Cnd3: Nuclear condensing complex subunits, C-term 93.96
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 93.96
KOG1993|consensus 978 93.91
KOG2020|consensus 1041 93.89
KOG2021|consensus 980 93.77
KOG1517|consensus 1387 93.65
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 93.58
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 93.55
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.48
KOG4413|consensus 524 93.41
KOG0414|consensus 1251 93.37
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 93.28
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 93.17
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 93.03
KOG1060|consensus 968 93.02
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 92.94
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 92.86
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 92.77
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 92.68
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 92.53
KOG1062|consensus 866 92.51
PF1036392 DUF2435: Protein of unknown function (DUF2435) 92.36
KOG4224|consensus 550 92.34
COG5116 926 RPN2 26S proteasome regulatory complex component [ 92.28
KOG0392|consensus 1549 92.27
COG5098 1128 Chromosome condensation complex Condensin, subunit 92.12
KOG1243|consensus 690 91.9
KOG0168|consensus 1051 91.89
KOG2062|consensus 929 91.53
KOG4653|consensus982 91.41
COG1413 335 FOG: HEAT repeat [Energy production and conversion 91.4
smart00638574 LPD_N Lipoprotein N-terminal Domain. 91.4
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 91.34
PF08167165 RIX1: rRNA processing/ribosome biogenesis 91.01
COG5657 947 CSE1 CAS/CSE protein involved in chromosome segreg 90.77
KOG0803|consensus 1312 90.47
KOG1820|consensus 815 90.13
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 90.09
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 90.01
KOG2933|consensus 334 89.87
KOG4224|consensus 550 89.77
KOG2229|consensus 616 89.53
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 89.26
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 89.19
KOG0414|consensus 1251 89.14
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 88.85
KOG1525|consensus 1266 88.58
KOG0413|consensus 1529 88.12
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 88.11
KOG2759|consensus442 87.94
KOG2149|consensus 393 87.89
KOG4535|consensus728 87.44
KOG1059|consensus 877 87.44
PF12333102 Ipi1_N: Rix1 complex component involved in 60S rib 87.26
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 87.18
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 86.95
KOG2259|consensus 823 86.63
PF12074 339 DUF3554: Domain of unknown function (DUF3554); Int 86.56
PF04388 668 Hamartin: Hamartin protein; InterPro: IPR007483 Th 86.38
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 86.34
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 85.95
KOG1525|consensus 1266 85.95
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 85.72
KOG2259|consensus 823 85.72
PF11701157 UNC45-central: Myosin-binding striated muscle asse 85.24
PF05804 708 KAP: Kinesin-associated protein (KAP) 85.22
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 84.65
KOG2081|consensus 559 84.27
KOG1061|consensus 734 83.54
PF07539141 DRIM: Down-regulated in metastasis; InterPro: IPR0 83.53
PF0146546 GRIP: GRIP domain; InterPro: IPR000237 The GRIP (g 83.52
KOG1837|consensus1621 82.95
PF14868559 DUF4487: Domain of unknown function (DUF4487) 82.8
KOG2022|consensus 982 82.68
smart00638 574 LPD_N Lipoprotein N-terminal Domain. 82.68
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 82.43
PF12830 187 Nipped-B_C: Sister chromatid cohesion C-terminus 82.01
KOG1058|consensus 948 81.45
KOG4535|consensus 728 81.39
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 81.31
KOG1943|consensus 1133 80.68
cd03561133 VHS VHS domain family; The VHS domain is present i 80.46
COG5098 1128 Chromosome condensation complex Condensin, subunit 80.31
>KOG2171|consensus Back     alignment and domain information
Probab=99.92  E-value=3.1e-24  Score=193.61  Aligned_cols=178  Identities=21%  Similarity=0.359  Sum_probs=148.4

Q ss_pred             ccccCCCHHHHHHHHHHHHhhcchhhHhhhhccCHhhHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHHHhhcCcCCCCC
Q psy15255          4 IQDAGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNL   83 (199)
Q Consensus         4 ~~~~~~~~~~R~~a~vlLr~~~~~~~~~~~~~l~~~~~~~ik~~ll~~L~~e~~~~vR~~~~~~ia~la~~~l~~~~~~~   83 (199)
                      |.+.+.++++||+|||++||+++++    |.++++++|+.||+.+|.++..|+.+.||+++|++||+++++.++.    .
T Consensus        44 i~~~~~~p~~Rq~aaVl~Rkl~~~~----w~~l~~e~~~siks~lL~~~~~E~~~~vr~k~~dviAeia~~~l~e----~  115 (1075)
T KOG2171|consen   44 ILATSADPQVRQLAAVLLRKLLTKH----WSRLSAEVQQSIKSSLLEIIQSETEPSVRHKLADVIAEIARNDLPE----K  115 (1075)
T ss_pred             HHhcCCChHHHHHHHHHHHHHHHHH----hhcCCHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHhcccc----c
Confidence            3445599999999999999999987    9999999999999999999999999999999999999999999983    9


Q ss_pred             hHHHHHHHHHHHHHHHHhhcccHHHHHHHHHHHHHHHHHhHhhhccCChHHHHHHHHHHhcCCCHHHHHHHHHHHHhhhH
Q psy15255         84 WPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPE  163 (199)
Q Consensus        84 WpeLl~~~ik~~ll~~l~~~~~~~vr~~a~~~i~~i~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~vr~~a~~~l~~i~e  163 (199)
                      ||||++.     |+++.. +++++.|..|..++..+...+.. ...++.+++++.|.++++|++..||.+|+++++.++.
T Consensus       116 WPell~~-----L~q~~~-S~~~~~rE~al~il~s~~~~~~~-~~~~~~~~l~~lf~q~~~d~s~~vr~~a~rA~~a~~~  188 (1075)
T KOG2171|consen  116 WPELLQF-----LFQSTK-SPNPSLRESALLILSSLPETFGN-TLQPHLDDLLRLFSQTMTDPSSPVRVAAVRALGAFAE  188 (1075)
T ss_pred             hHHHHHH-----HHHHhc-CCCcchhHHHHHHHHhhhhhhcc-ccchhHHHHHHHHHHhccCCcchHHHHHHHHHHHHHH
Confidence            9999998     556776 78889999988888877765542 3457889999999999999977799999999999999


Q ss_pred             hhh--hh-hHHHHHHHHHHH---HHhhCCCCCHHHhhhhh
Q psy15255        164 IFG--NQ-ESTYLVVIKQML---QQCLLPPNPYSVQALQL  197 (199)
Q Consensus       164 ~~~--~~-l~~~~~~l~~~l---~~~l~d~~~~~Vr~~A~  197 (199)
                      +.+  +. ...+.+.+|.++   ....+++ |.+....++
T Consensus       189 ~~~~~~~~~~~~~~llP~~l~vl~~~i~~~-d~~~a~~~l  227 (1075)
T KOG2171|consen  189 YLENNKSEVDKFRDLLPSLLNVLQEVIQDG-DDDAAKSAL  227 (1075)
T ss_pred             HhccchHHHHHHHHHhHHHHHHhHhhhhcc-chHHHHHHH
Confidence            985  22 355666666554   5556665 665554443



>KOG2023|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>KOG1992|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF03810 IBN_N: Importin-beta N-terminal domain; InterPro: IPR001494 Karyopherins are a group of proteins involved in transporting molecules through the pores of the nuclear envelope Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1993|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5657 CSE1 CAS/CSE protein involved in chromosome segregation [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5101 CRM1 Importin beta-related nuclear transport receptor [Nuclear structure / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF04510 DUF577: Family of unknown function (DUF577); InterPro: IPR007598 This is a family of Arabidopsis thaliana (Mouse-ear cress) proteins Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF04510 DUF577: Family of unknown function (DUF577); InterPro: IPR007598 This is a family of Arabidopsis thaliana (Mouse-ear cress) proteins Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG2149|consensus Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1837|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG1992|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1993|consensus Back     alignment and domain information
>KOG2020|consensus Back     alignment and domain information
>KOG2021|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG5657 CSE1 CAS/CSE protein involved in chromosome segregation [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0803|consensus Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG2229|consensus Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG2149|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF12333 Ipi1_N: Rix1 complex component involved in 60S ribosome maturation; InterPro: IPR024679 This domain is found in IPI1, which is a component of the Rix1 complex involved in pre-rRNA-processing [, ] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF04388 Hamartin: Hamartin protein; InterPro: IPR007483 This family includes the hamartin protein which is thought to function as a tumour suppressor Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2081|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>PF07539 DRIM: Down-regulated in metastasis; InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [] Back     alignment and domain information
>PF01465 GRIP: GRIP domain; InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins Back     alignment and domain information
>KOG1837|consensus Back     alignment and domain information
>PF14868 DUF4487: Domain of unknown function (DUF4487) Back     alignment and domain information
>KOG2022|consensus Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 6e-13
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 2e-10
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 4e-12
1qgr_A 876 Protein (importin beta subunit); transport recepto 3e-08
1qgr_A 876 Protein (importin beta subunit); transport recepto 3e-07
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 6e-08
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
 Score = 65.6 bits (159), Expect = 6e-13
 Identities = 18/146 (12%), Positives = 44/146 (30%), Gaps = 15/146 (10%)

Query: 49  ILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNI 108
           +L     +++  R      +  + +N +     N     + + +KS+ +  +        
Sbjct: 53  VLTKLKSEDEPTRS----LSGLILKNNVKAHFQNFPNG-VTDFIKSECLNNIGDSS---- 103

Query: 109 RRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVPE----- 163
              I      +   +        WP+ L  L    +S++    E A      + E     
Sbjct: 104 -PLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEI 162

Query: 164 IFGNQESTYLVVIKQMLQQCLLPPNP 189
           +  +     L ++     Q     +P
Sbjct: 163 LDSDVLDRPLNIMIPKFLQFFKHSSP 188


>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Length = 462 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Length = 462 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.83
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 99.82
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.79
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.74
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 99.57
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 99.43
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 99.39
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.37
2x1g_F 971 Cadmus; transport protein, developmental protein, 99.37
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.34
2x19_B 963 Importin-13; nuclear transport, protein transport; 99.34
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.34
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.34
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 99.33
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.3
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.27
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.2
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 99.15
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.14
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.09
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 99.08
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.87
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 98.81
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.73
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.73
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.71
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.71
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.69
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.69
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.67
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.66
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.65
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.65
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.63
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.6
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.6
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.57
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.53
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.52
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.5
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.48
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.43
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.43
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.38
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.31
2x19_B 963 Importin-13; nuclear transport, protein transport; 98.27
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.18
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.17
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.15
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.13
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.05
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.01
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 97.94
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.94
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 97.92
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 97.9
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 97.85
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 97.84
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 97.8
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 97.78
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.76
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.72
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.62
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.55
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 97.55
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 97.53
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.51
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 97.5
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 97.43
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.4
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.39
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 97.37
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 97.35
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 97.17
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 97.12
3nmz_A458 APC variant protein; protein-protein complex, arma 97.08
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.07
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.93
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.91
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 96.84
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 96.81
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.79
3nmz_A458 APC variant protein; protein-protein complex, arma 96.74
3tjz_B 355 Coatomer subunit gamma; protein trafficking, golgi 96.63
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 96.59
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.55
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 96.53
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.49
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.31
3tjz_B 355 Coatomer subunit gamma; protein trafficking, golgi 96.11
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 96.09
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 95.86
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 95.65
2db0_A253 253AA long hypothetical protein; heat repeats, hel 95.48
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.45
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 95.32
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.31
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 95.24
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 95.18
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 95.1
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 94.56
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 94.55
3tt9_A 233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 94.5
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 93.48
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 93.16
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 92.48
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 91.43
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 91.17
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 90.9
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 90.59
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 89.16
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 89.04
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 88.07
3tt9_A 233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 86.56
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 86.33
3grl_A 651 General vesicular transport factor P115; vesicle t 85.12
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 84.73
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 84.44
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
Probab=99.83  E-value=7.5e-20  Score=166.95  Aligned_cols=176  Identities=11%  Similarity=0.091  Sum_probs=152.0

Q ss_pred             cCCCHHHHHHHHHHHHhhcchhhHhhhhccCHhhHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHHHhhcCcCCCCChHH
Q psy15255          7 AGRSVEERQMSAVLLRKIFSTDFIEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPE   86 (199)
Q Consensus         7 ~~~~~~~R~~a~vlLr~~~~~~~~~~~~~l~~~~~~~ik~~ll~~L~~e~~~~vR~~~~~~ia~la~~~l~~~~~~~Wpe   86 (199)
                      .+.++.+|++||++|||.++.+    |..++++.|++||+.++++|.+ +++.||+++|.+++.+++..    +.+.||+
T Consensus        58 ~~~~~~vR~~a~~~Lkn~i~~~----w~~~~~~~~~~ik~~ll~~l~~-~~~~vr~~~a~~i~~ia~~~----~~~~wp~  128 (852)
T 4fdd_A           58 KSEDEPTRSLSGLILKNNVKAH----FQNFPNGVTDFIKSECLNNIGD-SSPLIRATVGILITTIASKG----ELQNWPD  128 (852)
T ss_dssp             TTSCHHHHHHHHHHHHHHTTTS----GGGCCHHHHHHHHHHHHTTTTC-SSHHHHHHHHHHHHHHHHHT----TTTTCTT
T ss_pred             CCCChHHHHHHHHHHHHHHHHc----cCCCCHHHHHHHHHHHHHHHcC-CCHHHHHHHHHHHHHHHHhc----CccccHH
Confidence            4578999999999999999988    9999999999999999999997 78899999999999999986    3578999


Q ss_pred             HHHHHHHHHHHHHHhhcccHHHHHHHHHHHHHHHHHhHhhh----ccCChHHHHHHHHHHhcCCCHHHHHHHHHHHHhhh
Q psy15255         87 FLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDA----GNNLWPEFLQFLFQCANSDNTTLKESALRLFTSVP  162 (199)
Q Consensus        87 Ll~~~ik~~ll~~l~~~~~~~vr~~a~~~i~~i~~~~~~~~----~~~~~~~ll~~l~~~~~~~~~~vr~~a~~~l~~i~  162 (199)
                      +++.     ++..++ ++++.+|..++.++..++....+..    ....++.++|.+.++++++++.+|..|+.+++.++
T Consensus       129 ll~~-----L~~~l~-~~~~~~r~~al~~L~~i~~~~~~~~~~~~~~~~~~~il~~l~~~l~~~~~~vR~~A~~aL~~~~  202 (852)
T 4fdd_A          129 LLPK-----LCSLLD-SEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFI  202 (852)
T ss_dssp             HHHH-----HHHHHS-CSSHHHHHHHHHHHHHHHHHHTTHHHHCSSSSCHHHHHHHHTTTTTCSSHHHHHHHHHHHHTTT
T ss_pred             HHHH-----HHHHHc-CCCHHHHHHHHHHHHHHHHHhHHHhchhhhcchHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHH
Confidence            9998     556777 7788999999999999987765421    12458999999999999999999999999999988


Q ss_pred             HhhhhhhHHHHHHHHHHHHHhhCCCCCHHHhhhhhc
Q psy15255        163 EIFGNQESTYLVVIKQMLQQCLLPPNPYSVQALQLK  198 (199)
Q Consensus       163 e~~~~~l~~~~~~l~~~l~~~l~d~~~~~Vr~~A~~  198 (199)
                      ...+..+.++.+.+++.+...++|+ +++||..||+
T Consensus       203 ~~~~~~~~~~~~~~l~~l~~~~~d~-~~~vr~~a~~  237 (852)
T 4fdd_A          203 ISRTQALMLHIDSFIENLFALAGDE-EPEVRKNVCR  237 (852)
T ss_dssp             TTTCHHHHTSHHHHHHHHHHHHTCC-CHHHHHHHHH
T ss_pred             hcccHHHHHHHHHHHHHHHHHcCCC-CHHHHHHHHH
Confidence            7665555666777778888888997 9999998874



>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d2bpta1 861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 2e-11
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 3e-11
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 4e-09
d1qgra_ 876 a.118.1.1 (A:) Importin beta {Human (Homo sapiens) 1e-09
d1qgra_ 876 a.118.1.1 (A:) Importin beta {Human (Homo sapiens) 1e-09
d1wa5c_ 959 a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Sacc 2e-06
d1wa5c_ 959 a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Sacc 6e-04
d1ibrb_ 458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 4e-05
d1ibrb_ 458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 8e-04
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.002
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Importin beta
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 60.2 bits (144), Expect = 2e-11
 Identities = 22/156 (14%), Positives = 51/156 (32%), Gaps = 16/156 (10%)

Query: 41  QNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFL-----------Q 89
            +N      L  Q   ++N + +    AA   +N +    +    +F            +
Sbjct: 34  NDNFLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQQFAQRWITQVSPEAK 93

Query: 90  NNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDDAGNNLWPEFLQFLFQCANSDNT- 148
           N +K+  +  L +     I        A +A     +  +  WPE ++ +     ++   
Sbjct: 94  NQIKTNALTALVS-IEPRIANAAAQLIAAIADI---ELPHGAWPELMKIMVDNTGAEQPE 149

Query: 149 TLKESALRLFTSVPEIFGNQESTYLVVIKQMLQQCL 184
            +K ++L     + E    Q    +     +L   +
Sbjct: 150 NVKRASLLALGYMCESADPQSQALVSSSNNILIAIV 185


>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 876 Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 876 Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 959 Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 959 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.79
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.68
d1ibrb_ 458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 99.38
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 99.38
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.16
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.09
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.78
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.69
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.68
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.63
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.54
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.44
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.41
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.37
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.29
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 98.24
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.04
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 97.9
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.9
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.88
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.86
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.85
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.74
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.26
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.13
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 94.93
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 94.66
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 94.4
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 92.01
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 89.17
d2jaka1343 Serine/threonine-protein phosphatase 2A regulatory 82.08
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Importin beta
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.79  E-value=3.3e-18  Score=150.58  Aligned_cols=187  Identities=15%  Similarity=0.162  Sum_probs=150.8

Q ss_pred             ccccccCCCHHHHHHHHHHHHhhcchhh--------HhhhhccCHhhHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHHH
Q psy15255          2 NIIQDAGRSVEERQMSAVLLRKIFSTDF--------IEIYSKLAVNDQNNLKSQIILLLQTCDNDNIRRKICDAAAEVAR   73 (199)
Q Consensus         2 ~~~~~~~~~~~~R~~a~vlLr~~~~~~~--------~~~~~~l~~~~~~~ik~~ll~~L~~e~~~~vR~~~~~~ia~la~   73 (199)
                      +++.+.+.+..+|++|+++|||.+..+|        ...|..++++.|+.||+.+++++.+ +++.||+++|.+++.+++
T Consensus        46 ~il~~~~~~~~~r~~A~i~lkn~i~~~~~~~~~~~~~~~~~~i~~~~~~~ik~~ll~~l~~-~~~~vr~~~a~~i~~i~~  124 (861)
T d2bpta1          46 QVLIDENTKLEGRILAALTLKNELVSKDSVKTQQFAQRWITQVSPEAKNQIKTNALTALVS-IEPRIANAAAQLIAAIAD  124 (861)
T ss_dssp             HHHTCTTSCHHHHHHHHHHHHTTTCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHTC-SSHHHHHHHHHHHHHHHH
T ss_pred             HHHHcCCCCHHHHHHHHHHHHHHhhcccchhhhhHHhhhHhcCCHHHHHHHHHHHHHHHcC-CCHHHHHHHHHHHHHHHH
Confidence            4677777889999999999999997764        2345789999999999999999998 889999999999999999


Q ss_pred             hhcCcCCCCChHHHHHHHHHHHHHHHHhhcccHHHHHHHHHHHHHHHHHhHhh--hccCChHHHHHHHHHHhc--CCCHH
Q psy15255         74 NLIDDAGNNLWPEFLQNNLKSQIILLLQTCDNDNIRRKICDAAAEVARNLIDD--AGNNLWPEFLQFLFQCAN--SDNTT  149 (199)
Q Consensus        74 ~~l~~~~~~~WpeLl~~~ik~~ll~~l~~~~~~~vr~~a~~~i~~i~~~~~~~--~~~~~~~~ll~~l~~~~~--~~~~~  149 (199)
                      ..++   .+.||+|++.     |+..++.+.+..+|..++.++..++....+.  ........+++.+++.+.  +++..
T Consensus       125 ~~~p---~~~wpeli~~-----L~~~~~s~~~~~~~~~al~~l~~i~e~~~~~~~~~~~~~~~il~~i~~~~~~~~~~~~  196 (861)
T d2bpta1         125 IELP---HGAWPELMKI-----MVDNTGAEQPENVKRASLLALGYMCESADPQSQALVSSSNNILIAIVQGAQSTETSKA  196 (861)
T ss_dssp             HHGG---GTCCHHHHHH-----HHHHTSTTSCHHHHHHHHHHHHHHHHTSSTTSSTTGGGHHHHHHHHHHHHSTTCCCHH
T ss_pred             HhCC---cCchHHHHHH-----HHHHhcCCCcHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHhcccCCHH
Confidence            9887   5789999997     5667775666778888889988877544321  112455667777777765  34789


Q ss_pred             HHHHHHHHHHhhhHhhhhhh--HHHHHHHHHHHHHhhCCCCCHHHhhhhhc
Q psy15255        150 LKESALRLFTSVPEIFGNQE--STYLVVIKQMLQQCLLPPNPYSVQALQLK  198 (199)
Q Consensus       150 vr~~a~~~l~~i~e~~~~~l--~~~~~~l~~~l~~~l~d~~~~~Vr~~A~~  198 (199)
                      +|..|+.+++.++..+...+  ....+.+++.+..+++++ ++++|..|++
T Consensus       197 v~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~  246 (861)
T d2bpta1         197 VRLAALNALADSLIFIKNNMEREGERNYLMQVVCEATQAE-DIEVQAAAFG  246 (861)
T ss_dssp             HHHHHHHHHHHHGGGCHHHHTSHHHHHHHHHHHHHHHTCS-CHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhHhHHhhhhhhHHHHhHHHHhcCC-CHHHHHHHHH
Confidence            99999999999998887664  345677888889999997 9999988864



>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure