Psyllid ID: psy15532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60
MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNKV
cccccccccccccccEEEEcccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccc
cccccccccEEccccEEEcccccEEEEcccccccccccccHHHHHHHHHHHHHHHccccc
mgpasdpeavvddqllVHGVENvrvadasvfptqlncnpiSVVIMTAEKCAQMVLDKNKV
mgpasdpeavvdDQLLVHGVENVRVadasvfptqlnCNPISVVIMTAEKCAQMVLDKNKV
MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNKV
**********VDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMV******
*****DPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNK*
*********VVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNKV
*****DPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query60 2.2.26 [Sep-21-2011]
Q8CMY2572 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
Q5HL11572 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
Q8NUM0569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
A8Z5A4569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
Q6G664569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
Q6GDJ1569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
P60337569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
P60336569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
A6QK99569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
Q5HCU1569 Choline dehydrogenase OS= yes N/A 0.9 0.094 0.545 1e-08
>sp|Q8CMY2|BETA_STAES Choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=betA PE=3 SV=1 Back     alignment and function desciption
 Score = 58.5 bits (140), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 1   MGPASDPEAVVDD-QLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMV 54
           MGPASDP AVVD   + VHG+EN+RV DAS  P   N N  + V+M AEK A ++
Sbjct: 484 MGPASDPMAVVDPLTMKVHGMENLRVVDASAMPRTTNGNIHAPVLMLAEKAADII 538
Can catalyze the oxidation of choline to betaine aldehyde and betaine aldehyde to glycine betaine.
Staphylococcus epidermidis (strain ATCC 12228) (taxid: 176280)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1
>sp|Q5HL11|BETA_STAEQ Choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q8NUM0|BETA_STAAW Choline dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A8Z5A4|BETA_STAAT Choline dehydrogenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q6G664|BETA_STAAS Choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q6GDJ1|BETA_STAAR Choline dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|P60337|BETA_STAAN Choline dehydrogenase OS=Staphylococcus aureus (strain N315) GN=betA PE=1 SV=1 Back     alignment and function description
>sp|P60336|BETA_STAAM Choline dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=betA PE=1 SV=1 Back     alignment and function description
>sp|A6QK99|BETA_STAAE Choline dehydrogenase OS=Staphylococcus aureus (strain Newman) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q5HCU1|BETA_STAAC Choline dehydrogenase OS=Staphylococcus aureus (strain COL) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
328703422 642 PREDICTED: glucose dehydrogenase [accept 0.9 0.084 0.703 2e-13
332023080 648 Glucose dehydrogenase [Acromyrmex echina 0.9 0.083 0.592 4e-12
307172019 640 Glucose dehydrogenase [acceptor] [Campon 0.9 0.084 0.592 1e-11
307206063 646 Glucose dehydrogenase [acceptor] [Harpeg 0.9 0.083 0.592 2e-11
328720711 631 PREDICTED: glucose dehydrogenase [accept 0.9 0.085 0.648 2e-11
170028614 596 choline dehydrogenase, mitochondrial [Cu 0.95 0.095 0.578 5e-11
322796407 609 hypothetical protein SINV_07147 [Solenop 0.9 0.088 0.574 5e-11
340383217 543 PREDICTED: choline dehydrogenase-like [A 0.95 0.104 0.561 7e-11
449301767 644 hypothetical protein BAUCODRAFT_66666 [B 0.983 0.091 0.508 1e-10
326775394 537 Choline dehydrogenase [Streptomyces gris 0.983 0.109 0.525 6e-10
>gi|328703422|ref|XP_001949949.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 43/54 (79%)

Query: 1   MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMV 54
           MGPASDP AVVD +L VH V  +RVADASVFPTQ NCNPI+ VIM AEK A+ +
Sbjct: 584 MGPASDPTAVVDPELRVHRVRGLRVADASVFPTQPNCNPIAPVIMVAEKAAKFI 637

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|332023080|gb|EGI63345.1| Glucose dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307172019|gb|EFN63613.1| Glucose dehydrogenase [acceptor] [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307206063|gb|EFN84156.1| Glucose dehydrogenase [acceptor] [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328720711|ref|XP_003247112.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170028614|ref|XP_001842190.1| choline dehydrogenase, mitochondrial [Culex quinquefasciatus] gi|167876312|gb|EDS39695.1| choline dehydrogenase, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|322796407|gb|EFZ18941.1| hypothetical protein SINV_07147 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340383217|ref|XP_003390114.1| PREDICTED: choline dehydrogenase-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|449301767|gb|EMC97776.1| hypothetical protein BAUCODRAFT_66666 [Baudoinia compniacensis UAMH 10762] Back     alignment and taxonomy information
>gi|326775394|ref|ZP_08234659.1| Choline dehydrogenase [Streptomyces griseus XylebKG-1] gi|326655727|gb|EGE40573.1| Choline dehydrogenase [Streptomyces griseus XylebKG-1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
FB|FBgn0030588621 CG9521 [Drosophila melanogaste 0.9 0.086 0.537 6.6e-09
FB|FBgn0030589622 CG9519 [Drosophila melanogaste 1.0 0.096 0.491 1.4e-08
FB|FBgn0030593623 CG9512 [Drosophila melanogaste 0.95 0.091 0.491 1.8e-08
FB|FBgn0030590703 CG9518 [Drosophila melanogaste 0.9 0.076 0.555 3.5e-08
ASPGD|ASPL0000037024611 AN3229 [Emericella nidulans (t 0.966 0.094 0.517 9.8e-08
FB|FBgn0039415616 CG6142 [Drosophila melanogaste 0.933 0.090 0.482 1.3e-07
UNIPROTKB|Q8NE62594 CHDH "Choline dehydrogenase, m 0.9 0.090 0.518 2e-07
UNIPROTKB|E1BES2594 CHDH "Choline dehydrogenase" [ 0.9 0.090 0.518 3.2e-07
FB|FBgn0030591865 CG9517 [Drosophila melanogaste 0.9 0.062 0.5 3.3e-07
RGD|735166599 Chdh "choline dehydrogenase" [ 0.9 0.090 0.518 3.3e-07
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 143 (55.4 bits), Expect = 6.6e-09, P = 6.6e-09
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query:     1 MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMV 54
             MGP SD  AVVD +L VHG++N+RVADAS+ P  ++ +P   V M AEK A M+
Sbjct:   560 MGPKSDRAAVVDHRLRVHGIKNLRVADASIMPEIMSGHPNGPVFMIAEKAADMI 613
GO:0008812 "choline dehydrogenase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030593 CG9512 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037024 AN3229 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NE62 CHDH "Choline dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BES2 CHDH "Choline dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|735166 Chdh "choline dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6G664BETA_STAAS1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q5HL11BETA_STAEQ1, ., 1, ., 9, 9, ., 10.54540.90.0944yesN/A
Q2FV11BETA_STAA81, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
A8Z5A4BETA_STAAT1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q4A0Q1BETA_STAS11, ., 1, ., 9, 9, ., 10.53440.950.1017yesN/A
A7X6Z3BETA_STAA11, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q6UPE0CHDH_RAT1, ., 1, ., 9, 9, ., 10.51850.90.0901yesN/A
Q6GDJ1BETA_STAAR1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q2YWJ5BETA_STAAB1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
A6QK99BETA_STAAE1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q8NE62CHDH_HUMAN1, ., 1, ., 9, 9, ., 10.51850.90.0909yesN/A
Q4L9D7BETA_STAHJ1, ., 1, ., 9, 9, ., 10.51720.950.1003yesN/A
P60336BETA_STAAM1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
P60337BETA_STAAN1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
A6U4Z2BETA_STAA21, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q5HCU1BETA_STAAC1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
A5IW37BETA_STAA91, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q8NUM0BETA_STAAW1, ., 1, ., 9, 9, ., 10.54540.90.0949yesN/A
Q8CMY2BETA_STAES1, ., 1, ., 9, 9, ., 10.54540.90.0944yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 5e-18
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 4e-17
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 4e-17
TIGR01810532 TIGR01810, betA, choline dehydrogenase 1e-16
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 8e-09
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information 
 Score = 74.9 bits (185), Expect = 5e-18
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 1   MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDK 57
           MG   DP AVVD +  VHGVE +RV DAS+ PT  N N  +  IM AEK A ++  +
Sbjct: 480 MGT--DPMAVVDPEGRVHGVEGLRVVDASIMPTITNGNLNAPTIMIAEKAADLIRGR 534

Length = 560
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 60
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.89
PRK02106560 choline dehydrogenase; Validated 99.87
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 99.87
KOG1238|consensus623 99.86
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 99.8
COG2303542 BetA Choline dehydrogenase and related flavoprotei 99.8
PLN02785587 Protein HOTHEAD 99.78
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 94.67
PTZ00318424 NADH dehydrogenase-like protein; Provisional 93.74
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 93.72
KOG2495|consensus491 91.07
PF1380782 GNVR: G-rich domain on putative tyrosine kinase 80.03
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information 
Probab=99.89  E-value=1.3e-23  Score=126.00  Aligned_cols=49  Identities=53%  Similarity=0.803  Sum_probs=44.0

Q ss_pred             CCCCCCCCceecCCCceeccCCeEEecCCCcCCCCCCChHHHHHHHHHHH
Q psy15532          1 MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKC   50 (60)
Q Consensus         1 Mg~~~~~~~Vvd~~~~v~g~~nL~V~D~Si~P~~~~~np~~t~~ala~r~   50 (60)
                      ||+ ++..+|||+++||||++||||+|+|+||+.+++||++|++|+|+|+
T Consensus        96 mG~-~~~~~VvD~~~rv~g~~nL~V~DaSv~P~~~~~np~~t~~ala~ra  144 (144)
T PF05199_consen   96 MGP-DPDTSVVDPDLRVHGVRNLRVADASVFPTSPGANPTLTIMALAERA  144 (144)
T ss_dssp             BTS-STTTTSB-TTSBBTTSBSEEE-SGGGSSS-SSSSSHHHHHHHHHHH
T ss_pred             ccc-cCCceeECCCCCeeeeeeEEECCCCcCCCCCCcCcHHHHHHHeeCC
Confidence            788 7777999999999999999999999999999999999999999996

These enzymes include a variety of proteins; choline dehydrogenase (CHD), methanol oxidase (MOX) and cellobiose dehydrogenase (1.1.99.18 from EC) [] which share a number of regions of sequence similarities. The function of this C-terminal conserved domain is not yet known.; GO: 0016614 oxidoreductase activity, acting on CH-OH group of donors, 0055114 oxidation-reduction process; PDB: 3BG7_F 2IGM_D 3BLY_A 3BG6_H 3LSK_A 2IGO_A 3K4B_A 3K4L_B 2IGN_B 3K4M_H ....
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PF13807 GNVR: G-rich domain on putative tyrosine kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 6e-07
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 7e-07
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 7e-07
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 2e-06
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 32/54 (59%)
Query: 1   MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMV 54
           MG   D  + +D +L V GV  +RVADASV P  +  NP   V+M  E+CA ++
Sbjct: 473 MGAVEDEMSPLDPELRVKGVTGLRVADASVMPEHVTVNPNITVMMIGERCADLI 526
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 5e-24
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 7e-24
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 7e-24
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 2e-23
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 6e-23
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 1e-21
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-21
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 5e-19
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 9e-12
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 2e-10
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 4e-10
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
 Score = 91.5 bits (228), Expect = 5e-24
 Identities = 23/55 (41%), Positives = 32/55 (58%)

Query: 1   MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVL 55
           MG   D  + +D +L V GV  +RVADASV P  +  NP   V+M  E+CA ++ 
Sbjct: 473 MGAVEDEMSPLDPELRVKGVTGLRVADASVMPEHVTVNPNITVMMIGERCADLIR 527
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 99.9
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 99.88
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 99.88
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 99.88
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 99.87
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 99.87
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 99.85
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 99.84
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 99.82
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 99.82
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 99.79
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 92.56
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 92.55
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 89.39
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 87.58
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 86.99
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 86.75
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 84.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 81.3
3r9u_A315 Thioredoxin reductase; structural genomics, center 80.15
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
Probab=99.90  E-value=1.7e-24  Score=150.70  Aligned_cols=59  Identities=31%  Similarity=0.441  Sum_probs=56.7

Q ss_pred             CCCCCCCCceecCCCceeccCCeEEecCCCcCCCCCCChHHHHHHHHHHHHHHHHhhhCC
Q psy15532          1 MGPASDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNKV   60 (60)
Q Consensus         1 Mg~~~~~~~Vvd~~~~v~g~~nL~V~D~Si~P~~~~~np~~t~~ala~r~a~~i~~~~~~   60 (60)
                      ||+ ++.++|||+++||||++||||+|+|+||+.+++||++|++|+|||+|+.|++++++
T Consensus       487 MG~-~~~~~VVD~~lrV~Gv~nLrVvDaSv~P~~~~~np~~ti~aiAeraAd~I~~~~~~  545 (546)
T 1kdg_A          487 IGS-SPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGG  545 (546)
T ss_dssp             BCS-CTTTCSBCTTCBBTTCSSEEECSGGGCSSCCSSCSHHHHHHHHHHHHHHHHHSTTC
T ss_pred             cCC-CCCCeeECCCCeEccCCCcEEeEecccCCCCCccHHHHHHHHHHHHHHHHHhhcCC
Confidence            888 78899999999999999999999999999999999999999999999999998874
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 60
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 5e-14
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 3e-11
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 9e-11
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 2e-10
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]

 Score = 61.8 bits (149), Expect = 5e-14
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 6   DPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLD 56
           +   VVD+   V+GV+ +RV D S+ PTQ++ + ++V    A K +  +L+
Sbjct: 329 EMGGVVDNAARVYGVQGLRVIDGSIPPTQMSSHVMTVFYAMALKISDAILE 379
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.83
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.59
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 99.31
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.27
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.86
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.72
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 91.07
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 83.18
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Pyranose 2-oxidase
species: White-rot fungus (Peniophora sp. SG) [TaxId: 204723]

Probab=99.83  E-value=3.9e-21  Score=122.92  Aligned_cols=59  Identities=20%  Similarity=0.297  Sum_probs=54.0

Q ss_pred             CCCC-CCCCceecCCCceeccCCeEEecCCCcCCCCCCChHHHHHHHHHHHHHHHHhhhC
Q psy15532          1 MGPA-SDPEAVVDDQLLVHGVENVRVADASVFPTQLNCNPISVVIMTAEKCAQMVLDKNK   59 (60)
Q Consensus         1 Mg~~-~~~~~Vvd~~~~v~g~~nL~V~D~Si~P~~~~~np~~t~~ala~r~a~~i~~~~~   59 (60)
                      ||.. .+..+|||+++||||++||||+|+|+||+.+.+||++|++|||+|+|++|++.|.
T Consensus       315 mG~~~~~~~~vvd~~~~v~g~~nlyv~d~sv~p~~~~~nPt~t~~alA~r~a~~i~~~~~  374 (379)
T d2f5va1         315 MGFDEKEDNCCVNTDSRVFGFKNLFLGGCGNIPTAYGANPTLTAMSLAIKSCEYIKQNFT  374 (379)
T ss_dssp             BCSCTTTTTCSBCTTCBBTTCSSEEECSGGGCCSCCCSCSHHHHHHHHHHHHHHHHHHCC
T ss_pred             cccCCCCCCccCCCCCcccccCCEEEeCCcccCCccccCcHHHHHHHHHHHHHHHHHhhc
Confidence            6653 2467999999999999999999999999999999999999999999999999874
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure