Psyllid ID: psy15623
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| 47220181 | 486 | unnamed protein product [Tetraodon nigro | 0.646 | 0.176 | 0.534 | 2e-23 | |
| 5901990 | 491 | katanin p60 ATPase-containing subunit A1 | 0.646 | 0.175 | 0.551 | 4e-23 | |
| 119568179 | 363 | katanin p60 (ATPase-containing) subunit | 0.646 | 0.236 | 0.551 | 5e-23 | |
| 113206090 | 492 | katanin p60 ATPase-containing subunit A1 | 0.646 | 0.174 | 0.551 | 6e-23 | |
| 326915696 | 492 | PREDICTED: katanin p60 ATPase-containing | 0.646 | 0.174 | 0.551 | 6e-23 | |
| 410896340 | 486 | PREDICTED: katanin p60 ATPase-containing | 0.646 | 0.176 | 0.534 | 6e-23 | |
| 348531082 | 488 | PREDICTED: katanin p60 ATPase-containing | 0.646 | 0.176 | 0.551 | 7e-23 | |
| 410896336 | 486 | PREDICTED: katanin p60 ATPase-containing | 0.646 | 0.176 | 0.534 | 8e-23 | |
| 410896338 | 435 | PREDICTED: katanin p60 ATPase-containing | 0.646 | 0.197 | 0.534 | 9e-23 | |
| 291412430 | 491 | PREDICTED: katanin p60 subunit A 1 [Oryc | 0.646 | 0.175 | 0.540 | 9e-23 |
| >gi|47220181|emb|CAG07322.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
Score = 114 bits (284), Expect = 2e-23, Method: Compositional matrix adjust.
Identities = 46/86 (53%), Positives = 72/86 (83%)
Query: 1 MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQE 60
+KSE L MDG+ +T + DP+K +++L A+NFPW+ID+A RRLEKRIY+PLPS+SGR E
Sbjct: 325 VKSEFLVQMDGMGNTPDEDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSASGRAE 384
Query: 61 LLRLILRQVDLASDLDLELVSDQLEG 86
LL++ L++V++A D+DL ++++++EG
Sbjct: 385 LLKINLKEVEVAEDVDLNVIAEKMEG 410
|
Source: Tetraodon nigroviridis Species: Tetraodon nigroviridis Genus: Tetraodon Family: Tetraodontidae Order: Tetraodontiformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|5901990|ref|NP_008975.1| katanin p60 ATPase-containing subunit A1 isoform 1 [Homo sapiens] gi|60390161|sp|O75449.1|KTNA1_HUMAN RecName: Full=Katanin p60 ATPase-containing subunit A1; Short=Katanin p60 subunit A1; AltName: Full=p60 katanin gi|3283072|gb|AAC25114.1| p60 katanin [Homo sapiens] gi|119568178|gb|EAW47793.1| katanin p60 (ATPase-containing) subunit A 1, isoform CRA_a [Homo sapiens] gi|119568180|gb|EAW47795.1| katanin p60 (ATPase-containing) subunit A 1, isoform CRA_a [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|119568179|gb|EAW47794.1| katanin p60 (ATPase-containing) subunit A 1, isoform CRA_b [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|113206090|ref|NP_001038113.1| katanin p60 ATPase-containing subunit A1 [Gallus gallus] gi|123909795|sp|Q1HGK7.1|KTNA1_CHICK RecName: Full=Katanin p60 ATPase-containing subunit A1; Short=Katanin p60 subunit A1; AltName: Full=p60 katanin gi|94471494|gb|ABF21049.1| p60 katanin [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|326915696|ref|XP_003204149.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
| >gi|410896340|ref|XP_003961657.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|348531082|ref|XP_003453039.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|410896336|ref|XP_003961655.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1-like isoform 1 [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|410896338|ref|XP_003961656.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1-like isoform 2 [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|291412430|ref|XP_002722481.1| PREDICTED: katanin p60 subunit A 1 [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| UNIPROTKB|F1S7T6 | 263 | KATNA1 "Uncharacterized protei | 0.646 | 0.326 | 0.540 | 4.8e-23 | |
| UNIPROTKB|O75449 | 491 | KATNA1 "Katanin p60 ATPase-con | 0.646 | 0.175 | 0.551 | 5.2e-23 | |
| UNIPROTKB|Q1HGK7 | 492 | KATNA1 "Katanin p60 ATPase-con | 0.646 | 0.174 | 0.551 | 8.8e-23 | |
| ZFIN|ZDB-GENE-050522-514 | 485 | katna1 "katanin p60 (ATPase-co | 0.646 | 0.177 | 0.511 | 1.8e-22 | |
| UNIPROTKB|E1BH39 | 491 | KATNA1 "Uncharacterized protei | 0.646 | 0.175 | 0.540 | 1.9e-22 | |
| UNIPROTKB|Q4R407 | 491 | KATNA1 "Katanin p60 ATPase-con | 0.646 | 0.175 | 0.540 | 1.9e-22 | |
| MGI|MGI:1344353 | 491 | Katna1 "katanin p60 (ATPase-co | 0.646 | 0.175 | 0.540 | 2.4e-22 | |
| ZFIN|ZDB-GENE-041114-141 | 488 | katnal1 "katanin p60 subunit A | 0.646 | 0.176 | 0.540 | 5e-22 | |
| UNIPROTKB|E2R3K3 | 491 | KATNA1 "Uncharacterized protei | 0.646 | 0.175 | 0.528 | 6.7e-22 | |
| RGD|1303062 | 491 | Katna1 "katanin p60 (ATPase-co | 0.646 | 0.175 | 0.528 | 6.7e-22 |
| UNIPROTKB|F1S7T6 KATNA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 266 (98.7 bits), Expect = 4.8e-23, P = 4.8e-23
Identities = 47/87 (54%), Positives = 70/87 (80%)
Query: 1 MKSELLCHMDGIASTT-NADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQ 59
+K+ELL MDG+ + N DP+K +++L A+NFPW+ID+A RRLEKRIY+PLPS+ GR+
Sbjct: 101 VKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGRE 160
Query: 60 ELLRLILRQVDLASDLDLELVSDQLEG 86
ELLR+ LR+++LA D+DL +++ +EG
Sbjct: 161 ELLRISLRELELADDVDLASIAENMEG 187
|
|
| UNIPROTKB|O75449 KATNA1 "Katanin p60 ATPase-containing subunit A1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1HGK7 KATNA1 "Katanin p60 ATPase-containing subunit A1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-514 katna1 "katanin p60 (ATPase-containing) subunit A 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BH39 KATNA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R407 KATNA1 "Katanin p60 ATPase-containing subunit A1" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1344353 Katna1 "katanin p60 (ATPase-containing) subunit A1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041114-141 katnal1 "katanin p60 subunit A-like 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R3K3 KATNA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1303062 Katna1 "katanin p60 (ATPase-containing) subunit A1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 4e-14 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 6e-12 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 2e-11 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 5e-11 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 2e-10 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 6e-09 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 1e-07 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 3e-07 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 4e-07 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 2e-06 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 2e-06 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 4e-06 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 2e-05 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 5e-05 |
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 67.2 bits (164), Expect = 4e-14
Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 10/90 (11%)
Query: 1 MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGR 58
+ +LL +DGI + + ++++ A+N P ++D A LR R ++ IYVPLP R
Sbjct: 362 VVGQLLTELDGI------EKAEGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEER 415
Query: 59 QELLRLILRQVD--LASDLDLELVSDQLEG 86
E+ ++ LR LA D+DLE +++ EG
Sbjct: 416 LEIFKIHLRDKKPPLAEDVDLEELAEITEG 445
|
Length = 494 |
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.97 | |
| KOG0730|consensus | 693 | 99.96 | ||
| KOG0738|consensus | 491 | 99.94 | ||
| KOG0733|consensus | 802 | 99.93 | ||
| KOG0734|consensus | 752 | 99.92 | ||
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.92 | |
| KOG0652|consensus | 424 | 99.9 | ||
| KOG0737|consensus | 386 | 99.9 | ||
| KOG0733|consensus | 802 | 99.9 | ||
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.9 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.89 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.89 | |
| KOG0731|consensus | 774 | 99.88 | ||
| KOG0728|consensus | 404 | 99.88 | ||
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.88 | |
| KOG0736|consensus | 953 | 99.87 | ||
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.87 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.87 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.87 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.87 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.86 | |
| KOG0735|consensus | 952 | 99.85 | ||
| KOG0726|consensus | 440 | 99.85 | ||
| KOG0739|consensus | 439 | 99.83 | ||
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.83 | |
| KOG0727|consensus | 408 | 99.83 | ||
| KOG0740|consensus | 428 | 99.82 | ||
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.82 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.82 | |
| KOG0741|consensus | 744 | 99.81 | ||
| KOG0730|consensus | 693 | 99.81 | ||
| KOG0729|consensus | 435 | 99.81 | ||
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.76 | |
| KOG0732|consensus | 1080 | 99.74 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.69 | |
| KOG0651|consensus | 388 | 99.67 | ||
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.53 | |
| KOG0742|consensus | 630 | 99.41 | ||
| KOG0744|consensus | 423 | 99.35 | ||
| KOG0743|consensus | 457 | 99.14 | ||
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.07 | |
| KOG0736|consensus | 953 | 98.98 | ||
| KOG0735|consensus | 952 | 98.54 | ||
| CHL00181 | 287 | cbbX CbbX; Provisional | 98.4 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.4 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.39 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 98.24 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.2 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 98.16 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 98.01 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.98 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.95 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.94 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.93 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.9 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.88 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.8 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.78 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.76 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.76 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.75 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.74 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.73 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.68 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.67 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.62 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.55 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.54 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.54 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.54 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.53 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.5 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.49 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.47 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.45 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.45 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.44 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.41 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.39 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.39 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.37 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.37 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.37 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.35 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.33 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.33 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.31 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.29 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.29 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.28 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.27 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.25 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.21 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.19 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.18 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.18 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.18 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 97.15 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.14 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.12 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.12 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 97.1 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 97.07 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.04 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.03 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.0 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.99 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.94 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.92 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.88 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.87 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.85 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.74 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 96.72 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 96.69 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.63 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.62 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.54 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.53 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.51 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 96.48 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 96.45 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 96.34 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.31 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.3 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.26 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 96.24 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.23 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.16 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.03 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.01 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 95.98 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 95.65 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 95.34 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 95.24 | |
| PRK14700 | 300 | recombination factor protein RarA; Provisional | 95.2 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 95.15 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.06 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 94.82 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 94.71 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 94.65 | |
| KOG0989|consensus | 346 | 94.14 | ||
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 94.05 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 93.86 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 93.49 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 92.99 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 92.98 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 92.44 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 92.01 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 91.85 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 91.59 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 91.3 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 91.25 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 91.19 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 91.1 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 90.3 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 90.06 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 89.69 | |
| KOG2035|consensus | 351 | 89.46 | ||
| KOG2227|consensus | 529 | 89.27 | ||
| PHA02244 | 383 | ATPase-like protein | 89.19 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 89.08 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 88.84 | |
| PRK08485 | 206 | DNA polymerase III subunit delta'; Validated | 88.32 | |
| KOG2028|consensus | 554 | 86.46 | ||
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 84.97 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 84.69 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 84.63 | |
| KOG1514|consensus | 767 | 84.62 | ||
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 84.35 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 84.33 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 83.99 | |
| TIGR01128 | 302 | holA DNA polymerase III, delta subunit. subunit ar | 83.34 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 82.61 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 82.56 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 82.5 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 81.79 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 81.37 |
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.97 E-value=4.3e-30 Score=199.45 Aligned_cols=115 Identities=30% Similarity=0.474 Sum_probs=108.1
Q ss_pred HHHHHHhhCCCCCCCCCCCCcEEEEEeeCCCCCCCHHHHh--ccccEEEcCCCCHHHHHHHHHHHHhcCCCCChhcHHHH
Q psy15623 3 SELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELV 80 (133)
Q Consensus 3 ~~lL~~lD~~~~~~~~~~~~~v~vi~aTn~~~~lD~al~r--Rfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~l 80 (133)
-|||+|||||.+.+ +|-||+|||+|+.||||++| |||++|+||+||.++|.+||+.|.+++.+..++|++.|
T Consensus 276 leLL~qlDGFD~~~------nvKVI~ATNR~D~LDPALLRPGR~DRkIEfplPd~~gR~~Il~IHtrkM~l~~dvd~e~l 349 (406)
T COG1222 276 LELLNQLDGFDPRG------NVKVIMATNRPDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELL 349 (406)
T ss_pred HHHHHhccCCCCCC------CeEEEEecCCccccChhhcCCCcccceeecCCCCHHHHHHHHHHHhhhccCccCcCHHHH
Confidence 48999999998876 99999999999999999999 99999999999999999999999999999999999999
Q ss_pred HHHcCCCCHHHHHHHHHHHHHHh--cCCCCCCHHHHHHHHHhhhh
Q psy15623 81 SDQLEGNAVQQKVMKSYTKKTFC--GKNSTPSQPKLLQAERPFRR 123 (133)
Q Consensus 81 a~~t~G~sgadi~~~~~~~~~~~--~~~~~i~~~dl~~a~~~~~~ 123 (133)
|+.|+|+|||||+++|..+.+++ .++..++++||.+|.++.-+
T Consensus 350 a~~~~g~sGAdlkaictEAGm~AiR~~R~~Vt~~DF~~Av~KV~~ 394 (406)
T COG1222 350 ARLTEGFSGADLKAICTEAGMFAIRERRDEVTMEDFLKAVEKVVK 394 (406)
T ss_pred HHhcCCCchHHHHHHHHHHhHHHHHhccCeecHHHHHHHHHHHHh
Confidence 99999999999999988888755 77889999999999886654
|
|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >KOG0740|consensus | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0651|consensus | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK14700 recombination factor protein RarA; Provisional | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2035|consensus | Back alignment and domain information |
|---|
| >KOG2227|consensus | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08485 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >KOG1514|consensus | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR01128 holA DNA polymerase III, delta subunit | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 133 | ||||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 4e-11 | ||
| 2qp9_X | 355 | Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | 2e-10 | ||
| 3eih_A | 340 | Crystal Structure Of S.Cerevisiae Vps4 In The Prese | 2e-10 | ||
| 3eie_A | 322 | Crystal Structure Of S.Cerevisiae Vps4 In The So4-B | 2e-10 | ||
| 2rko_A | 331 | Crystal Structure Of The Vps4p-Dimer Length = 331 | 2e-10 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 3e-10 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 2e-09 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 3e-09 | ||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 3e-09 | ||
| 3d8b_A | 357 | Crystal Structure Of Human Fidgetin-Like Protein 1 | 5e-09 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 8e-09 | ||
| 3b9p_A | 297 | Spastin Length = 297 | 2e-08 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 7e-08 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 8e-08 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 8e-08 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 9e-08 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 1e-07 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 2e-07 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 2e-07 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 2e-07 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 2e-07 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 2e-07 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 2e-07 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 7e-07 | ||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 1e-06 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 6e-06 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 1e-05 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 4e-04 |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
|
| >pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | Back alignment and structure |
| >pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 | Back alignment and structure |
| >pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 | Back alignment and structure |
| >pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
| >pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|3B9P|A Chain A, Spastin Length = 297 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 1e-28 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 2e-27 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 3e-27 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 4e-27 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 4e-27 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 2e-26 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 8e-26 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-19 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-13 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-18 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 5e-15 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 5e-14 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 2e-13 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 3e-10 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 5e-10 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 5e-10 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 5e-10 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 6e-10 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 2e-08 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 3e-08 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 7e-08 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 2e-04 |
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
Score = 104 bits (262), Expect = 1e-28
Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
Query: 1 MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQE 60
+K+E L DG+ + D IV+L A+N P +D+A LRR KR+YV LP R+
Sbjct: 140 LKTEFLVEFDGLPGNPDGD---RIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTREL 196
Query: 61 LLRLILRQVDLA-SDLDLELVSDQLEG 86
LL +L++ L ++ +G
Sbjct: 197 LLNRLLQKQGSPLDTEALRRLAKITDG 223
|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.96 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.96 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.95 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.95 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.95 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.95 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.92 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.87 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.86 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.85 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.83 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.82 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.81 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.81 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.8 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.79 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.78 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.77 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.76 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.76 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.74 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.71 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.71 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.7 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.7 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.68 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 99.66 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.63 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 99.62 | |
| 3aji_B | 83 | S6C, proteasome (prosome, macropain) 26S subunit, | 99.55 | |
| 3vlf_B | 88 | 26S protease regulatory subunit 7 homolog; heat re | 99.51 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.36 | |
| 2dzn_B | 82 | 26S protease regulatory subunit 6B homolog; ankyri | 99.34 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.32 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.74 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.74 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.71 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.68 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 98.61 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.58 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 98.54 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 98.54 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 98.53 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.53 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 98.48 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.47 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.42 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.4 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.38 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.38 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.35 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 98.26 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 98.22 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 98.21 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.2 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 98.18 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.16 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 98.07 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 98.04 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 98.03 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.02 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.0 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.0 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.97 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.97 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.88 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.83 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.81 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.74 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.71 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.49 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.44 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.44 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.33 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.3 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.23 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.06 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 96.94 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.68 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.62 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.34 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 96.33 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.31 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.75 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.62 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 95.4 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 95.31 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 94.92 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.52 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.13 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 92.52 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 86.02 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 82.95 |
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.96 E-value=1.2e-28 Score=195.46 Aligned_cols=116 Identities=25% Similarity=0.345 Sum_probs=106.4
Q ss_pred HHHHHHHhhCCCCCCCCCCCCcEEEEEeeCCCCCCCHHHHh--ccccEEEcCCCCHHHHHHHHHHHHhcCCCCChhcHHH
Q psy15623 2 KSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLEL 79 (133)
Q Consensus 2 ~~~lL~~lD~~~~~~~~~~~~~v~vi~aTn~~~~lD~al~r--Rfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~ 79 (133)
+++||++|||+.+.. +|+||||||+|+.||||++| |||++|+|++|+.++|.+||+.++++.++..++|++.
T Consensus 272 l~~lL~~lDg~~~~~------~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~ 345 (405)
T 4b4t_J 272 MLELLNQLDGFETSK------NIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRK 345 (405)
T ss_dssp HHHHHHHHHTTTCCC------CEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHH
T ss_pred HHHHHHhhhccCCCC------CeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHH
Confidence 689999999998876 99999999999999999999 9999999999999999999999999999999999999
Q ss_pred HHHHcCCCCHHHHHHHHHHHHH--HhcCCCCCCHHHHHHHHHhhhh
Q psy15623 80 VSDQLEGNAVQQKVMKSYTKKT--FCGKNSTPSQPKLLQAERPFRR 123 (133)
Q Consensus 80 la~~t~G~sgadi~~~~~~~~~--~~~~~~~i~~~dl~~a~~~~~~ 123 (133)
||+.|+|||||||.++|..+.+ +..++..++.+||..|++.+.+
T Consensus 346 lA~~t~G~SGADi~~l~~eA~~~Air~~~~~vt~~Df~~Al~~v~~ 391 (405)
T 4b4t_J 346 VAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMN 391 (405)
T ss_dssp HHHHCCSCCHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHHHH
T ss_pred HHHHCCCCCHHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHHHHhC
Confidence 9999999999999987766655 4467778999999999886644
|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* | Back alignment and structure |
|---|
| >3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* | Back alignment and structure |
|---|
| >2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 133 | ||||
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 3e-20 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 1e-18 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 4e-10 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 4e-08 |
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Thermus thermophilus [TaxId: 274]
Score = 80.7 bits (199), Expect = 3e-20
Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 8/88 (9%)
Query: 1 MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGR 58
++LL MDG T IV++ A+N P +D A LR R +++I + P GR
Sbjct: 131 TLNQLLVEMDGFEKDTA------IVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGR 184
Query: 59 QELLRLILRQVDLASDLDLELVSDQLEG 86
+++LR+ R LA D+DL L++ + G
Sbjct: 185 EQILRIHARGKPLAEDVDLALLAKRTPG 212
|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.93 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.92 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.9 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.85 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.15 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 98.89 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.81 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.42 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.31 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.27 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.23 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.19 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.15 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.1 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.04 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.03 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.99 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.75 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.59 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.51 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.7 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.31 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 93.97 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 89.81 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 87.25 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 82.01 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Probab=99.93 E-value=2.3e-25 Score=165.81 Aligned_cols=114 Identities=25% Similarity=0.423 Sum_probs=102.8
Q ss_pred HHHHHHHhhCCCCCCCCCCCCcEEEEEeeCCCCCCCHHHHh--ccccEEEcCCCCHHHHHHHHHHHHhcCCCCChhcHHH
Q psy15623 2 KSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLEL 79 (133)
Q Consensus 2 ~~~lL~~lD~~~~~~~~~~~~~v~vi~aTn~~~~lD~al~r--Rfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~ 79 (133)
+++||++||++.+++ +|+||||||+|+.||||++| |||++|+|++|+.++|.+||+.++++.++..++++..
T Consensus 135 ~~~ll~~~d~~~~~~------~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~ 208 (256)
T d1lv7a_ 135 LNQMLVEMDGFEGNE------GIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAI 208 (256)
T ss_dssp HHHHHHHHHTCCSSS------CEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHH
T ss_pred HHHHHHHhhCCCCCC------CEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHH
Confidence 678999999998765 89999999999999999999 9999999999999999999999999998888999999
Q ss_pred HHHHcCCCCHHHHHHHHHH--HHHHhcCCCCCCHHHHHHHHHhh
Q psy15623 80 VSDQLEGNAVQQKVMKSYT--KKTFCGKNSTPSQPKLLQAERPF 121 (133)
Q Consensus 80 la~~t~G~sgadi~~~~~~--~~~~~~~~~~i~~~dl~~a~~~~ 121 (133)
+++.|+||||+||..++.. ..+...+...++.+||..|++.+
T Consensus 209 la~~t~G~s~adi~~l~~~A~~~a~~~~~~~i~~~d~~~Al~rv 252 (256)
T d1lv7a_ 209 IARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKI 252 (256)
T ss_dssp HHHTCTTCCHHHHHHHHHHHHHHHHHTTCSSBCHHHHHHHHHHH
T ss_pred HHHhCCCCCHHHHHHHHHHHHHHHHHcCCCccCHHHHHHHHHHH
Confidence 9999999999999876544 34455777789999999998653
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|