Psyllid ID: psy15623


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYTKKTFCGKNSTPSQPKLLQAERPFRRSRVLLFTGYY
cHHHHHHHHcccccccccccccEEEEEccccccccccHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHcccccccccccccccc
cccEEEEEEcccccccccccccEEEEEEEccccccccHHHHHHHccEEEEcccccccHHHHHHHHHccccccccccHHHHHccccccHHHHHHHHHHHHcccEEccccHHHHHHHHHcccccccHEEEccccc
mksellchmdgiasttnadptkSIVILgasnfpwniDDAFLRRLEKRiyvplpsssgrQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYtkktfcgknstpsqpkllqaerpfrrsRVLLFTGYY
MKSELLCHMDGiasttnadptKSIVILGASNFPWNIDDAFLRRLEKRIYvplpsssgrqELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYTkktfcgknstpsqpkllqaerpfrrsrVLLFTGYY
MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYTKKTFCGKNSTPSQPKLLQAERPFRRSRVLLFTGYY
******CHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAV************************************VLLF****
MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYT*************************SRVLLFTGYY
MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYTKKTFCGKNSTPSQPKLLQAERPFRRSRVLLFTGYY
*KSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYTKKTFCGKNSTPSQPKLLQAERPFRRSRVLLFT*YY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGNAVQQKVMKSYTKKTFCGKNSTPSQPKLLQAERPFRRSRVLLFTGYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
O75449491 Katanin p60 ATPase-contai yes N/A 0.646 0.175 0.551 6e-25
Q1HGK7492 Katanin p60 ATPase-contai yes N/A 0.646 0.174 0.551 8e-25
Q5RII9485 Katanin p60 ATPase-contai yes N/A 0.646 0.177 0.511 1e-24
Q9WV86491 Katanin p60 ATPase-contai yes N/A 0.646 0.175 0.540 2e-24
Q4R407491 Katanin p60 ATPase-contai N/A N/A 0.646 0.175 0.540 2e-24
Q5U3S1488 Katanin p60 ATPase-contai no N/A 0.646 0.176 0.540 5e-24
Q6E0V2491 Katanin p60 ATPase-contai yes N/A 0.646 0.175 0.528 6e-24
Q0IIR9492 Katanin p60 ATPase-contai yes N/A 0.646 0.174 0.505 1e-23
Q9PUL2486 Katanin p60 ATPase-contai N/A N/A 0.646 0.176 0.505 1e-23
B5X3X5486 Katanin p60 ATPase-contai N/A N/A 0.646 0.176 0.528 1e-23
>sp|O75449|KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 71/87 (81%), Gaps = 1/87 (1%)

Query: 1   MKSELLCHMDGIASTT-NADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQ 59
           +K+ELL  MDG+  T+ N DP+K +++L A+NFPW+ID+A  RRLEKRIY+PLPS+ GR+
Sbjct: 329 VKAELLVQMDGVGGTSENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGRE 388

Query: 60  ELLRLILRQVDLASDLDLELVSDQLEG 86
           ELLR+ LR+++LA D+DL  +++ +EG
Sbjct: 389 ELLRISLRELELADDVDLASIAENMEG 415




Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays, such as during disassembly of interphase microtubules at the G2-M transition. May also be required for microtubule release from the centrosome after nucleation. In mitotic spindles this could allow depolymerization of the microtubule end proximal to the centrosome, and subsequent poleward microtubule flux. In neurons, microtubule release within the cell body may allow their subsequent transport into neuronal processes by microtubule dependent motor proteins. This transport is required for axonal growth.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 3
>sp|Q1HGK7|KTNA1_CHICK Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 Back     alignment and function description
>sp|Q9WV86|KTNA1_MOUSE Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R407|KTNA1_MACFA Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 Back     alignment and function description
>sp|Q5U3S1|KATL1_DANRE Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 Back     alignment and function description
>sp|Q6E0V2|KTNA1_RAT Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1 Back     alignment and function description
>sp|Q0IIR9|KTNA1_XENTR Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 Back     alignment and function description
>sp|Q9PUL2|KTNA1_XENLA Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1 Back     alignment and function description
>sp|B5X3X5|KTNA1_SALSA Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
47220181 486 unnamed protein product [Tetraodon nigro 0.646 0.176 0.534 2e-23
5901990 491 katanin p60 ATPase-containing subunit A1 0.646 0.175 0.551 4e-23
119568179 363 katanin p60 (ATPase-containing) subunit 0.646 0.236 0.551 5e-23
113206090 492 katanin p60 ATPase-containing subunit A1 0.646 0.174 0.551 6e-23
326915696 492 PREDICTED: katanin p60 ATPase-containing 0.646 0.174 0.551 6e-23
410896340 486 PREDICTED: katanin p60 ATPase-containing 0.646 0.176 0.534 6e-23
348531082 488 PREDICTED: katanin p60 ATPase-containing 0.646 0.176 0.551 7e-23
410896336 486 PREDICTED: katanin p60 ATPase-containing 0.646 0.176 0.534 8e-23
410896338 435 PREDICTED: katanin p60 ATPase-containing 0.646 0.197 0.534 9e-23
291412430 491 PREDICTED: katanin p60 subunit A 1 [Oryc 0.646 0.175 0.540 9e-23
>gi|47220181|emb|CAG07322.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 72/86 (83%)

Query: 1   MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQE 60
           +KSE L  MDG+ +T + DP+K +++L A+NFPW+ID+A  RRLEKRIY+PLPS+SGR E
Sbjct: 325 VKSEFLVQMDGMGNTPDEDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSASGRAE 384

Query: 61  LLRLILRQVDLASDLDLELVSDQLEG 86
           LL++ L++V++A D+DL ++++++EG
Sbjct: 385 LLKINLKEVEVAEDVDLNVIAEKMEG 410




Source: Tetraodon nigroviridis

Species: Tetraodon nigroviridis

Genus: Tetraodon

Family: Tetraodontidae

Order: Tetraodontiformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|5901990|ref|NP_008975.1| katanin p60 ATPase-containing subunit A1 isoform 1 [Homo sapiens] gi|60390161|sp|O75449.1|KTNA1_HUMAN RecName: Full=Katanin p60 ATPase-containing subunit A1; Short=Katanin p60 subunit A1; AltName: Full=p60 katanin gi|3283072|gb|AAC25114.1| p60 katanin [Homo sapiens] gi|119568178|gb|EAW47793.1| katanin p60 (ATPase-containing) subunit A 1, isoform CRA_a [Homo sapiens] gi|119568180|gb|EAW47795.1| katanin p60 (ATPase-containing) subunit A 1, isoform CRA_a [Homo sapiens] Back     alignment and taxonomy information
>gi|119568179|gb|EAW47794.1| katanin p60 (ATPase-containing) subunit A 1, isoform CRA_b [Homo sapiens] Back     alignment and taxonomy information
>gi|113206090|ref|NP_001038113.1| katanin p60 ATPase-containing subunit A1 [Gallus gallus] gi|123909795|sp|Q1HGK7.1|KTNA1_CHICK RecName: Full=Katanin p60 ATPase-containing subunit A1; Short=Katanin p60 subunit A1; AltName: Full=p60 katanin gi|94471494|gb|ABF21049.1| p60 katanin [Gallus gallus] Back     alignment and taxonomy information
>gi|326915696|ref|XP_003204149.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|410896340|ref|XP_003961657.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|348531082|ref|XP_003453039.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410896336|ref|XP_003961655.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1-like isoform 1 [Takifugu rubripes] Back     alignment and taxonomy information
>gi|410896338|ref|XP_003961656.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 1-like isoform 2 [Takifugu rubripes] Back     alignment and taxonomy information
>gi|291412430|ref|XP_002722481.1| PREDICTED: katanin p60 subunit A 1 [Oryctolagus cuniculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
UNIPROTKB|F1S7T6263 KATNA1 "Uncharacterized protei 0.646 0.326 0.540 4.8e-23
UNIPROTKB|O75449491 KATNA1 "Katanin p60 ATPase-con 0.646 0.175 0.551 5.2e-23
UNIPROTKB|Q1HGK7492 KATNA1 "Katanin p60 ATPase-con 0.646 0.174 0.551 8.8e-23
ZFIN|ZDB-GENE-050522-514485 katna1 "katanin p60 (ATPase-co 0.646 0.177 0.511 1.8e-22
UNIPROTKB|E1BH39491 KATNA1 "Uncharacterized protei 0.646 0.175 0.540 1.9e-22
UNIPROTKB|Q4R407491 KATNA1 "Katanin p60 ATPase-con 0.646 0.175 0.540 1.9e-22
MGI|MGI:1344353491 Katna1 "katanin p60 (ATPase-co 0.646 0.175 0.540 2.4e-22
ZFIN|ZDB-GENE-041114-141488 katnal1 "katanin p60 subunit A 0.646 0.176 0.540 5e-22
UNIPROTKB|E2R3K3491 KATNA1 "Uncharacterized protei 0.646 0.175 0.528 6.7e-22
RGD|1303062491 Katna1 "katanin p60 (ATPase-co 0.646 0.175 0.528 6.7e-22
UNIPROTKB|F1S7T6 KATNA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 47/87 (54%), Positives = 70/87 (80%)

Query:     1 MKSELLCHMDGIASTT-NADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQ 59
             +K+ELL  MDG+   + N DP+K +++L A+NFPW+ID+A  RRLEKRIY+PLPS+ GR+
Sbjct:   101 VKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGRE 160

Query:    60 ELLRLILRQVDLASDLDLELVSDQLEG 86
             ELLR+ LR+++LA D+DL  +++ +EG
Sbjct:   161 ELLRISLRELELADDVDLASIAENMEG 187




GO:0005524 "ATP binding" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
UNIPROTKB|O75449 KATNA1 "Katanin p60 ATPase-containing subunit A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1HGK7 KATNA1 "Katanin p60 ATPase-containing subunit A1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-514 katna1 "katanin p60 (ATPase-containing) subunit A 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH39 KATNA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R407 KATNA1 "Katanin p60 ATPase-containing subunit A1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
MGI|MGI:1344353 Katna1 "katanin p60 (ATPase-containing) subunit A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-141 katnal1 "katanin p60 subunit A-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3K3 KATNA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1303062 Katna1 "katanin p60 (ATPase-containing) subunit A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RII9KTNA1_DANRE3, ., 6, ., 4, ., 30.51160.64660.1773yesN/A
O75449KTNA1_HUMAN3, ., 6, ., 4, ., 30.55170.64660.1751yesN/A
Q1HGK7KTNA1_CHICK3, ., 6, ., 4, ., 30.55170.64660.1747yesN/A
Q6E0V2KTNA1_RAT3, ., 6, ., 4, ., 30.52870.64660.1751yesN/A
Q0IIR9KTNA1_XENTR3, ., 6, ., 4, ., 30.50570.64660.1747yesN/A
Q9WV86KTNA1_MOUSE3, ., 6, ., 4, ., 30.54020.64660.1751yesN/A
Q9SEX2KTNA1_ARATH3, ., 6, ., 4, ., 30.51130.64660.1644yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 4e-14
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 6e-12
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-11
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 5e-11
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-10
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 6e-09
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-07
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-07
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 4e-07
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 2e-06
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-06
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-06
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-05
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 5e-05
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 67.2 bits (164), Expect = 4e-14
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 10/90 (11%)

Query: 1   MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGR 58
           +  +LL  +DGI      +  + ++++ A+N P ++D A LR  R ++ IYVPLP    R
Sbjct: 362 VVGQLLTELDGI------EKAEGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEER 415

Query: 59  QELLRLILRQVD--LASDLDLELVSDQLEG 86
            E+ ++ LR     LA D+DLE +++  EG
Sbjct: 416 LEIFKIHLRDKKPPLAEDVDLEELAEITEG 445


Length = 494

>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.97
KOG0730|consensus693 99.96
KOG0738|consensus491 99.94
KOG0733|consensus802 99.93
KOG0734|consensus 752 99.92
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.92
KOG0652|consensus424 99.9
KOG0737|consensus386 99.9
KOG0733|consensus 802 99.9
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.9
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.89
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.89
KOG0731|consensus 774 99.88
KOG0728|consensus404 99.88
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.88
KOG0736|consensus953 99.87
PRK03992389 proteasome-activating nucleotidase; Provisional 99.87
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.87
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.87
CHL00195489 ycf46 Ycf46; Provisional 99.87
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.86
KOG0735|consensus952 99.85
KOG0726|consensus440 99.85
KOG0739|consensus439 99.83
CHL00206 2281 ycf2 Ycf2; Provisional 99.83
KOG0727|consensus408 99.83
KOG0740|consensus428 99.82
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.82
CHL00176 638 ftsH cell division protein; Validated 99.82
KOG0741|consensus 744 99.81
KOG0730|consensus 693 99.81
KOG0729|consensus435 99.81
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.76
KOG0732|consensus 1080 99.74
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.69
KOG0651|consensus388 99.67
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.53
KOG0742|consensus630 99.41
KOG0744|consensus423 99.35
KOG0743|consensus457 99.14
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.07
KOG0736|consensus 953 98.98
KOG0735|consensus 952 98.54
CHL00181287 cbbX CbbX; Provisional 98.4
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.4
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.39
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 98.24
PF00004132 AAA: ATPase family associated with various cellula 98.2
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.16
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.01
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.98
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.95
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.94
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.93
PRK00149450 dnaA chromosomal replication initiation protein; R 97.9
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.88
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.87
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.8
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.78
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.76
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.76
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.75
PRK06893229 DNA replication initiation factor; Validated 97.74
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.73
PRK09087226 hypothetical protein; Validated 97.68
PRK12402337 replication factor C small subunit 2; Reviewed 97.67
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.62
PRK08727233 hypothetical protein; Validated 97.55
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.54
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.54
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.54
PRK14088440 dnaA chromosomal replication initiation protein; P 97.53
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.5
PRK06620214 hypothetical protein; Validated 97.49
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.47
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.45
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.45
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.44
PRK08084235 DNA replication initiation factor; Provisional 97.41
PRK12422445 chromosomal replication initiation protein; Provis 97.39
PRK00440319 rfc replication factor C small subunit; Reviewed 97.39
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.37
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.37
PRK04195 482 replication factor C large subunit; Provisional 97.37
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.35
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.35
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.33
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.33
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.31
PLN03025319 replication factor C subunit; Provisional 97.29
PRK10865 857 protein disaggregation chaperone; Provisional 97.29
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.28
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.27
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.25
PRK14086617 dnaA chromosomal replication initiation protein; P 97.21
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.21
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.19
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.18
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.18
PTZ00112 1164 origin recognition complex 1 protein; Provisional 97.18
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.15
PHA02544316 44 clamp loader, small subunit; Provisional 97.14
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.12
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.12
PRK04132846 replication factor C small subunit; Provisional 97.1
PRK13407334 bchI magnesium chelatase subunit I; Provisional 97.07
PRK05642234 DNA replication initiation factor; Validated 97.04
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.03
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.0
PRK13342 413 recombination factor protein RarA; Reviewed 96.99
PRK14087450 dnaA chromosomal replication initiation protein; P 96.94
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.92
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.88
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.87
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.85
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 96.74
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 96.72
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.69
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 96.63
CHL00195 489 ycf46 Ycf46; Provisional 96.62
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.54
PRK06964342 DNA polymerase III subunit delta'; Validated 96.53
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 96.51
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 96.48
PRK09112351 DNA polymerase III subunit delta'; Validated 96.45
COG0593408 DnaA ATPase involved in DNA replication initiation 96.34
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 96.31
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.3
PRK05707328 DNA polymerase III subunit delta'; Validated 96.26
smart00350509 MCM minichromosome maintenance proteins. 96.24
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.23
CHL00095 821 clpC Clp protease ATP binding subunit 96.16
PRK13341 725 recombination factor protein RarA/unknown domain f 96.03
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.01
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 95.98
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 95.65
COG0714329 MoxR-like ATPases [General function prediction onl 95.34
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 95.24
PRK14700 300 recombination factor protein RarA; Provisional 95.2
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 95.15
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.06
PRK05564313 DNA polymerase III subunit delta'; Validated 94.82
PRK07471365 DNA polymerase III subunit delta'; Validated 94.71
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.65
KOG0989|consensus346 94.14
PRK07399314 DNA polymerase III subunit delta'; Validated 94.05
PRK07993334 DNA polymerase III subunit delta'; Validated 93.86
PRK06090319 DNA polymerase III subunit delta'; Validated 93.49
PRK08769319 DNA polymerase III subunit delta'; Validated 92.99
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 92.98
PRK11331459 5-methylcytosine-specific restriction enzyme subun 92.44
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 92.01
PRK06871325 DNA polymerase III subunit delta'; Validated 91.85
PRK09862506 putative ATP-dependent protease; Provisional 91.59
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 91.3
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.25
COG2255332 RuvB Holliday junction resolvasome, helicase subun 91.19
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 91.1
COG2256 436 MGS1 ATPase related to the helicase subunit of the 90.3
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 90.06
PRK08058329 DNA polymerase III subunit delta'; Validated 89.69
KOG2035|consensus351 89.46
KOG2227|consensus 529 89.27
PHA02244383 ATPase-like protein 89.19
PRK08699325 DNA polymerase III subunit delta'; Validated 89.08
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 88.84
PRK08485206 DNA polymerase III subunit delta'; Validated 88.32
KOG2028|consensus 554 86.46
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 84.97
PRK07276290 DNA polymerase III subunit delta'; Validated 84.69
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 84.63
KOG1514|consensus767 84.62
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 84.35
PRK06581263 DNA polymerase III subunit delta'; Validated 84.33
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 83.99
TIGR01128 302 holA DNA polymerase III, delta subunit. subunit ar 83.34
PRK07132299 DNA polymerase III subunit delta'; Validated 82.61
PRK10865857 protein disaggregation chaperone; Provisional 82.56
CHL00095821 clpC Clp protease ATP binding subunit 82.5
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 81.79
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 81.37
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=4.3e-30  Score=199.45  Aligned_cols=115  Identities=30%  Similarity=0.474  Sum_probs=108.1

Q ss_pred             HHHHHHhhCCCCCCCCCCCCcEEEEEeeCCCCCCCHHHHh--ccccEEEcCCCCHHHHHHHHHHHHhcCCCCChhcHHHH
Q psy15623          3 SELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELV   80 (133)
Q Consensus         3 ~~lL~~lD~~~~~~~~~~~~~v~vi~aTn~~~~lD~al~r--Rfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~l   80 (133)
                      -|||+|||||.+.+      +|-||+|||+|+.||||++|  |||++|+||+||.++|.+||+.|.+++.+..++|++.|
T Consensus       276 leLL~qlDGFD~~~------nvKVI~ATNR~D~LDPALLRPGR~DRkIEfplPd~~gR~~Il~IHtrkM~l~~dvd~e~l  349 (406)
T COG1222         276 LELLNQLDGFDPRG------NVKVIMATNRPDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELL  349 (406)
T ss_pred             HHHHHhccCCCCCC------CeEEEEecCCccccChhhcCCCcccceeecCCCCHHHHHHHHHHHhhhccCccCcCHHHH
Confidence            48999999998876      99999999999999999999  99999999999999999999999999999999999999


Q ss_pred             HHHcCCCCHHHHHHHHHHHHHHh--cCCCCCCHHHHHHHHHhhhh
Q psy15623         81 SDQLEGNAVQQKVMKSYTKKTFC--GKNSTPSQPKLLQAERPFRR  123 (133)
Q Consensus        81 a~~t~G~sgadi~~~~~~~~~~~--~~~~~i~~~dl~~a~~~~~~  123 (133)
                      |+.|+|+|||||+++|..+.+++  .++..++++||.+|.++.-+
T Consensus       350 a~~~~g~sGAdlkaictEAGm~AiR~~R~~Vt~~DF~~Av~KV~~  394 (406)
T COG1222         350 ARLTEGFSGADLKAICTEAGMFAIRERRDEVTMEDFLKAVEKVVK  394 (406)
T ss_pred             HHhcCCCchHHHHHHHHHHhHHHHHhccCeecHHHHHHHHHHHHh
Confidence            99999999999999988888755  77889999999999886654



>KOG0730|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08485 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR01128 holA DNA polymerase III, delta subunit Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 4e-11
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 2e-10
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 2e-10
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-10
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 2e-10
1xwi_A322 Crystal Structure Of Vps4b Length = 322 3e-10
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-09
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-09
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 3e-09
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 5e-09
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 8e-09
3b9p_A297 Spastin Length = 297 2e-08
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 7e-08
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 8e-08
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 8e-08
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 9e-08
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 1e-07
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 2e-07
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-07
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 2e-07
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-07
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 2e-07
2ce7_A 476 Edta Treated Length = 476 2e-07
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 7e-07
3vfd_A389 Human Spastin Aaa Domain Length = 389 1e-06
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 6e-06
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 1e-05
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 4e-04
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 5/66 (7%) Query: 1 MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQE 60 +K+E L M G+ + I++LGA+N PW +D A RR EKRIY+PLP + R Sbjct: 254 IKTEFLVQMQGVGVDNDG-----ILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHARAA 308 Query: 61 LLRLIL 66 + RL L Sbjct: 309 MFRLHL 314
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-28
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-27
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-27
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 4e-27
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 4e-27
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-26
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 8e-26
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-19
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-13
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-18
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 5e-15
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 5e-14
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-13
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 3e-10
2r62_A268 Cell division protease FTSH homolog; ATPase domain 5e-10
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 5e-10
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 5e-10
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-10
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-08
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-08
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 7e-08
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-04
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
 Score =  104 bits (262), Expect = 1e-28
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 4/87 (4%)

Query: 1   MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQE 60
           +K+E L   DG+    + D    IV+L A+N P  +D+A LRR  KR+YV LP    R+ 
Sbjct: 140 LKTEFLVEFDGLPGNPDGD---RIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTREL 196

Query: 61  LLRLILRQVDLA-SDLDLELVSDQLEG 86
           LL  +L++         L  ++   +G
Sbjct: 197 LLNRLLQKQGSPLDTEALRRLAKITDG 223


>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.96
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.96
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.95
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.95
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.95
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.95
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.92
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.87
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.86
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.85
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.83
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.82
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.81
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.81
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.8
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.79
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.78
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.77
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.76
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.76
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.74
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.71
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.71
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.7
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.7
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.68
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.66
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.63
2krk_A86 26S protease regulatory subunit 8; structural geno 99.62
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.55
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.51
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.36
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.34
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.74
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.74
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.71
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.68
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.61
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.58
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.54
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.54
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.53
3bos_A242 Putative DNA replication factor; P-loop containing 98.53
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.48
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.47
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.42
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.4
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.38
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.38
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.35
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.26
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.22
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.21
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.2
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.18
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.16
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.07
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.04
3pvs_A 447 Replication-associated recombination protein A; ma 98.03
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.02
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.0
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.0
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 97.97
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.97
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.88
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.83
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.81
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.74
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.71
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.49
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.44
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.44
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.33
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.3
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.23
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.06
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 96.94
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 96.68
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.62
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.34
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.33
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.31
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.75
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.62
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.4
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 95.31
3f8t_A506 Predicted ATPase involved in replication control, 94.92
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.52
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.13
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 92.52
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 86.02
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 82.95
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.96  E-value=1.2e-28  Score=195.46  Aligned_cols=116  Identities=25%  Similarity=0.345  Sum_probs=106.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCCCcEEEEEeeCCCCCCCHHHHh--ccccEEEcCCCCHHHHHHHHHHHHhcCCCCChhcHHH
Q psy15623          2 KSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLEL   79 (133)
Q Consensus         2 ~~~lL~~lD~~~~~~~~~~~~~v~vi~aTn~~~~lD~al~r--Rfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~   79 (133)
                      +++||++|||+.+..      +|+||||||+|+.||||++|  |||++|+|++|+.++|.+||+.++++.++..++|++.
T Consensus       272 l~~lL~~lDg~~~~~------~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~  345 (405)
T 4b4t_J          272 MLELLNQLDGFETSK------NIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRK  345 (405)
T ss_dssp             HHHHHHHHHTTTCCC------CEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHH
T ss_pred             HHHHHHhhhccCCCC------CeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHH
Confidence            689999999998876      99999999999999999999  9999999999999999999999999999999999999


Q ss_pred             HHHHcCCCCHHHHHHHHHHHHH--HhcCCCCCCHHHHHHHHHhhhh
Q psy15623         80 VSDQLEGNAVQQKVMKSYTKKT--FCGKNSTPSQPKLLQAERPFRR  123 (133)
Q Consensus        80 la~~t~G~sgadi~~~~~~~~~--~~~~~~~i~~~dl~~a~~~~~~  123 (133)
                      ||+.|+|||||||.++|..+.+  +..++..++.+||..|++.+.+
T Consensus       346 lA~~t~G~SGADi~~l~~eA~~~Air~~~~~vt~~Df~~Al~~v~~  391 (405)
T 4b4t_J          346 VAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMN  391 (405)
T ss_dssp             HHHHCCSCCHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHHHHhC
Confidence            9999999999999987766655  4467778999999999886644



>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 133
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-20
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-18
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 4e-10
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 4e-08
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]
 Score = 80.7 bits (199), Expect = 3e-20
 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 8/88 (9%)

Query: 1   MKSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGR 58
             ++LL  MDG    T       IV++ A+N P  +D A LR  R +++I +  P   GR
Sbjct: 131 TLNQLLVEMDGFEKDTA------IVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGR 184

Query: 59  QELLRLILRQVDLASDLDLELVSDQLEG 86
           +++LR+  R   LA D+DL L++ +  G
Sbjct: 185 EQILRIHARGKPLAEDVDLALLAKRTPG 212


>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.93
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.92
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.85
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.15
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.89
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.81
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.42
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.31
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.27
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.23
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.19
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.15
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.1
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.04
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.03
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.99
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.75
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.59
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.51
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.7
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.31
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.97
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.81
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.25
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.01
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=99.93  E-value=2.3e-25  Score=165.81  Aligned_cols=114  Identities=25%  Similarity=0.423  Sum_probs=102.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCCCcEEEEEeeCCCCCCCHHHHh--ccccEEEcCCCCHHHHHHHHHHHHhcCCCCChhcHHH
Q psy15623          2 KSELLCHMDGIASTTNADPTKSIVILGASNFPWNIDDAFLR--RLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLEL   79 (133)
Q Consensus         2 ~~~lL~~lD~~~~~~~~~~~~~v~vi~aTn~~~~lD~al~r--Rfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~   79 (133)
                      +++||++||++.+++      +|+||||||+|+.||||++|  |||++|+|++|+.++|.+||+.++++.++..++++..
T Consensus       135 ~~~ll~~~d~~~~~~------~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~  208 (256)
T d1lv7a_         135 LNQMLVEMDGFEGNE------GIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAI  208 (256)
T ss_dssp             HHHHHHHHHTCCSSS------CEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHH
T ss_pred             HHHHHHHhhCCCCCC------CEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHH
Confidence            678999999998765      89999999999999999999  9999999999999999999999999998888999999


Q ss_pred             HHHHcCCCCHHHHHHHHHH--HHHHhcCCCCCCHHHHHHHHHhh
Q psy15623         80 VSDQLEGNAVQQKVMKSYT--KKTFCGKNSTPSQPKLLQAERPF  121 (133)
Q Consensus        80 la~~t~G~sgadi~~~~~~--~~~~~~~~~~i~~~dl~~a~~~~  121 (133)
                      +++.|+||||+||..++..  ..+...+...++.+||..|++.+
T Consensus       209 la~~t~G~s~adi~~l~~~A~~~a~~~~~~~i~~~d~~~Al~rv  252 (256)
T d1lv7a_         209 IARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKI  252 (256)
T ss_dssp             HHHTCTTCCHHHHHHHHHHHHHHHHHTTCSSBCHHHHHHHHHHH
T ss_pred             HHHhCCCCCHHHHHHHHHHHHHHHHHcCCCccCHHHHHHHHHHH
Confidence            9999999999999876544  34455777789999999998653



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure