Psyllid ID: psy15801

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
ASAKEALAFAVLKYALGAGPAKTGKNQRSTNSKGLSRTPGRESLDESHHFSPPQALQASIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEVEAVSSSDVSAKRSFAAQPATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQGNEKKKKKNKKKKKKKKKKKKKKKKKKKKETIKKKEEKEVNG
ccHHHHHHHHHHHHHHccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEcccccEEEEEcccccEEEEEEEEEccccccccccccHHHHHHHHcccccccccHHHHHHHHHHcccEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHHHHHHccccHHHcccccccccccccccccHHHHHHHHHcccccHccccHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccccccccccccccccccccEEEEcccccEEEEEcccccEEEEEEEEcccHHHcccccccHHHHHHccccccEccEcHHHHHHHHHHcccEEEEEEccccEEEEEEEEHHHHHHHHHHHHHHHHcEcccHHHHHHHcHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccc
ASAKEALAFAVLKYAlgagpaktgknqrstnskglsrtpgresldeshhfsppqaLQASIDVVrgagikdadIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEVEAvsssdvsakrsfaaqpatkalfspdiqsgtsynkVKVVSVNETSPIARISVAFKAgaryetpdnlgiTHVLRsaaglsteefthFGIIRHVQQaggslyatvdREGIVYTIEAVRKEIGHVHKFLASVVgktefrpwevsdltprlkydrltrpsqgnekkkKKNKKKKKKKKKKKKKKKKKKKKETIKKKEEKEVNG
ASAKEALAFAVLKYalgagpaktgknqrstnskglsRTPGRESLDESHHFSPPQALQASIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEVEAvsssdvsakrsfaaqpatkalfspdiqsgtsyNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLAsvvgktefrpwevsdltprlkydrltrpsqgnekkkkknkkkkkkkkkkkkkkkkkkkketikkkeekevng
ASAKEALAFAVLKYALGAGPAKTGKNQRSTNSKGLSRTPGRESLDESHHFSPPQALQASIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLaeveavsssdvsaKRSFAAQPATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQGNekkkkknkkkkkkkkkkkkkkkkkkkketikkkeekeVNG
******LAFAVLKYALG*****************************************SIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEV*******************************TSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRL****************************************************
***KEALAFAVLKYAL******************LSRTPGRESLDESHHFSPPQALQASIDVVRGAGIKDADIARGKALLKRHLADSF*************************LLAEVEAVSSSDVSAKRSFAAQPATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLK***************************************************
ASAKEALAFAVLKYALGAG**********************************QALQASIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEV***************AQPATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRP********************************************
*S*KEALAFAVLKYALGAGPA***********KGLSRTPGRESLDESHHFSPPQALQASIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEVEAVSSS**************KALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQGNEKKKKKNKKKKKKKKKKKKKKKKKK***TIKKKEE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ASAKEALAFAVLKYALGAGPAKTGKNQRSTNSKGLSRTPGRESLDESHHFSPPQALQASIDVVRGAGIKDADIARGKALLKRHLADSFETLDSTVDSVVRQAVTTGVVKSLPDLLAEVEAVSSSDVSAKRSFAAQPATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
P22695 453 Cytochrome b-c1 complex s yes N/A 0.298 0.209 0.415 5e-22
P23004 453 Cytochrome b-c1 complex s yes N/A 0.298 0.209 0.389 2e-20
Q9DB77 453 Cytochrome b-c1 complex s yes N/A 0.279 0.196 0.398 2e-20
P32551 452 Cytochrome b-c1 complex s yes N/A 0.305 0.214 0.389 3e-19
P29677 504 Mitochondrial-processing N/A N/A 0.355 0.224 0.345 3e-12
Q9ZU25 503 Probable mitochondrial-pr yes N/A 0.364 0.230 0.327 1e-10
O04308 499 Probable mitochondrial-pr no N/A 0.364 0.232 0.301 2e-09
P78761 426 Cytochrome b-c1 complex s yes N/A 0.349 0.260 0.330 3e-07
Q6C2E3 417 Cytochrome b-c1 complex s yes N/A 0.374 0.285 0.295 4e-07
Q75CW5 366 Cytochrome b-c1 complex s yes N/A 0.295 0.256 0.302 1e-05
>sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 74/118 (62%)

Query: 153 NKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQ 212
           N + + S+   SP++RI +  KAG+RYE   NLG TH+LR  + L+T+  + F I R ++
Sbjct: 45  NGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIE 104

Query: 213 QAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDR 270
             GG L  T  RE + YT+E +R ++  + +FL +V    EFR WEV+DL P+LK D+
Sbjct: 105 AVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDK 162
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.
Homo sapiens (taxid: 9606)
>sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 Back     alignment and function description
>sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 Back     alignment and function description
>sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 Back     alignment and function description
>sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 Back     alignment and function description
>sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=1 SV=1 Back     alignment and function description
>sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 Back     alignment and function description
>sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 Back     alignment and function description
>sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 Back     alignment and function description
>sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
332375921 442 unknown [Dendroctonus ponderosae] 0.364 0.262 0.477 4e-29
307205462 445 Cytochrome b-c1 complex subunit 2, mitoc 0.452 0.323 0.448 9e-28
163838684 437 ubiquinol-cytochrome c reductase core pr 0.411 0.299 0.458 6e-27
389611395216 ubiquinol-cytochrome c reductase complex 0.449 0.662 0.440 1e-26
389609555 438 ubiquinol-cytochrome c reductase complex 0.449 0.326 0.440 1e-26
307191193 445 Cytochrome b-c1 complex subunit 2, mitoc 0.408 0.292 0.450 3e-26
157109295 441 ubiquinol-cytochrome c reductase complex 0.380 0.274 0.447 3e-26
348502449 448 PREDICTED: cytochrome b-c1 complex subun 0.443 0.314 0.434 6e-26
47226060 454 unnamed protein product [Tetraodon nigro 0.405 0.284 0.461 1e-25
288856313 441 cytochrome b-c1 complex subunit 2, mitoc 0.383 0.276 0.442 2e-25
>gi|332375921|gb|AEE63101.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  134 bits (338), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 88/134 (65%)

Query: 143 SPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEF 202
           S D+++    NK+ VV+    SPI+R+S+ F+AGAR ET +N+G+THVLR AAGLST   
Sbjct: 30  SYDVKTSLLPNKLVVVAAENESPISRVSIVFRAGARNETAENVGVTHVLRVAAGLSTRNK 89

Query: 203 THFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDL 262
           + F I+R+VQQ G +L AT DRE I YT+E  R+ +     FL  V  +  F+PWEV +L
Sbjct: 90  SQFAIVRNVQQLGANLIATADRETISYTLEGTRQAVEQALPFLTEVATQQVFKPWEVVEL 149

Query: 263 TPRLKYDRLTRPSQ 276
           + RLK +   RP Q
Sbjct: 150 SDRLKLELAVRPLQ 163

Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307205462|gb|EFN83794.1| Cytochrome b-c1 complex subunit 2, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|163838684|ref|NP_001106225.1| ubiquinol-cytochrome c reductase core protein II [Bombyx mori] gi|87248249|gb|ABD36177.1| ubiquinol-cytochrome c reductase core protein II [Bombyx mori] Back     alignment and taxonomy information
>gi|389611395|dbj|BAM19309.1| ubiquinol-cytochrome c reductase complex core protein [Papilio polytes] Back     alignment and taxonomy information
>gi|389609555|dbj|BAM18389.1| ubiquinol-cytochrome c reductase complex core protein [Papilio xuthus] Back     alignment and taxonomy information
>gi|307191193|gb|EFN74890.1| Cytochrome b-c1 complex subunit 2, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157109295|ref|XP_001650609.1| ubiquinol-cytochrome c reductase complex core protein [Aedes aegypti] gi|157109297|ref|XP_001650610.1| ubiquinol-cytochrome c reductase complex core protein [Aedes aegypti] gi|157109299|ref|XP_001650611.1| ubiquinol-cytochrome c reductase complex core protein [Aedes aegypti] gi|108879066|gb|EAT43291.1| AAEL005269-PA [Aedes aegypti] gi|108879067|gb|EAT43292.1| AAEL005269-PB [Aedes aegypti] gi|108879068|gb|EAT43293.1| AAEL005269-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|348502449|ref|XP_003438780.1| PREDICTED: cytochrome b-c1 complex subunit 2, mitochondrial-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|47226060|emb|CAG04434.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|288856313|ref|NP_001165809.1| cytochrome b-c1 complex subunit 2, mitochondrial [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
ZFIN|ZDB-GENE-040718-405 460 uqcrc2a "ubiquinol-cytochrome 0.421 0.291 0.402 1.4e-22
ZFIN|ZDB-GENE-030131-1269 454 uqcrc2b "ubiquinol-cytochrome 0.446 0.312 0.408 3.7e-22
UNIPROTKB|H3BSJ9 336 UQCRC2 "Cytochrome b-c1 comple 0.430 0.407 0.386 1.5e-21
UNIPROTKB|H3BP04176 UQCRC2 "Cytochrome b-c1 comple 0.371 0.670 0.415 2.4e-21
UNIPROTKB|H3BRG4 412 UQCRC2 "Cytochrome b-c1 comple 0.430 0.332 0.386 3.1e-21
UNIPROTKB|P22695 453 UQCRC2 "Cytochrome b-c1 comple 0.430 0.302 0.386 4.9e-21
UNIPROTKB|F1P582 457 UQCRC2 "Uncharacterized protei 0.440 0.306 0.392 1.1e-20
MGI|MGI:1914253 453 Uqcrc2 "ubiquinol cytochrome c 0.433 0.304 0.369 6.2e-20
UNIPROTKB|F1RPD2 459 LOC100620271 "Uncharacterized 0.433 0.300 0.369 1.8e-19
UNIPROTKB|P23004 453 UQCRC2 "Cytochrome b-c1 comple 0.371 0.260 0.389 2.9e-19
ZFIN|ZDB-GENE-040718-405 uqcrc2a "ubiquinol-cytochrome c reductase core protein IIa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 1.4e-22, P = 1.4e-22
 Identities = 54/134 (40%), Positives = 84/134 (62%)

Query:   137 ATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAG 196
             A   L   D+Q     + + V S+   SP+++I V  KAG+RYET +NLG+TH+LR AA 
Sbjct:    36 APPVLQPQDVQVSKLPSGLVVASLENYSPVSKIGVFVKAGSRYETAENLGVTHMLRLAAN 95

Query:   197 LSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRP 256
             ++T+  + F I R ++  G SL  T  RE +VY+++ +R +   V ++L  V    +FRP
Sbjct:    96 MTTKGASAFKICRSLEALGASLSVTSSREHMVYSLDFLRDDFDGVIEYLVDVTTAPDFRP 155

Query:   257 WEVSDLTPRLKYDR 270
             WE++DLTPR+K D+
Sbjct:   156 WELADLTPRVKIDK 169
GO:0003824 "catalytic activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
ZFIN|ZDB-GENE-030131-1269 uqcrc2b "ubiquinol-cytochrome c reductase core protein IIb" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H3BSJ9 UQCRC2 "Cytochrome b-c1 complex subunit 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BP04 UQCRC2 "Cytochrome b-c1 complex subunit 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BRG4 UQCRC2 "Cytochrome b-c1 complex subunit 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22695 UQCRC2 "Cytochrome b-c1 complex subunit 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P582 UQCRC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1914253 Uqcrc2 "ubiquinol cytochrome c reductase core protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPD2 LOC100620271 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P23004 UQCRC2 "Cytochrome b-c1 complex subunit 2, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
pfam00675149 pfam00675, Peptidase_M16, Insulinase (Peptidase fa 7e-18
COG0612 438 COG0612, PqqL, Predicted Zn-dependent peptidases [ 2e-10
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 2e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 3e-04
pfam10278178 pfam10278, Med19, Mediator of RNA pol II transcrip 3e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 4e-04
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 4e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 8e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 8e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 8e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 9e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.001
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 0.001
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.002
pfam07771120 pfam07771, TSGP1, Tick salivary peptide group 1 0.002
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.002
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.002
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.003
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.003
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.003
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.003
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.003
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.003
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.003
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 0.003
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.004
>gnl|CDD|216056 pfam00675, Peptidase_M16, Insulinase (Peptidase family M16) Back     alignment and domain information 
 Score = 78.5 bits (194), Expect = 7e-18
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 156 KVVSV-NETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQA 214
           +V S  +  +  + + +   AG+RYE  DN G+ H L   A   T+++    +   +++ 
Sbjct: 1   RVASEHDPPADTSAVGLWIDAGSRYEPDDNNGLAHFLEHMAFKGTKKYPSEDLEEELEKL 60

Query: 215 GGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEV 259
           GGSL A   RE  VY +E +  ++      LA       F P EV
Sbjct: 61  GGSLNAYTSREHTVYYVEVLNDDLPKAVDRLADFFLNPLFSPSEV 105

Length = 149
>gnl|CDD|223685 COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219564 pfam07771, TSGP1, Tick salivary peptide group 1 Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG0960|consensus 467 99.92
TIGR02110 696 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable pe 99.91
PF00675149 Peptidase_M16: Insulinase (Peptidase family M16) T 99.9
COG0612 438 PqqL Predicted Zn-dependent peptidases [General fu 99.88
PRK15101 961 protease3; Provisional 99.88
KOG2067|consensus 472 99.84
KOG2583|consensus 429 99.79
KOG2067|consensus472 99.73
COG1025 937 Ptr Secreted/periplasmic Zn-dependent peptidases, 99.72
KOG0959|consensus 974 99.66
KOG0960|consensus467 99.6
PRK15101 961 protease3; Provisional 99.57
PTZ00432 1119 falcilysin; Provisional 99.42
PTZ00432 1119 falcilysin; Provisional 99.26
KOG2019|consensus 998 98.77
COG1026 978 Predicted Zn-dependent peptidases, insulinase-like 98.74
PF08367248 M16C_assoc: Peptidase M16C associated; InterPro: I 98.41
COG0612438 PqqL Predicted Zn-dependent peptidases [General fu 98.31
KOG2583|consensus429 98.09
COG1026 978 Predicted Zn-dependent peptidases, insulinase-like 97.39
KOG0961|consensus 1022 96.92
PF05193184 Peptidase_M16_C: Peptidase M16 inactive domain; In 96.57
TIGR02110 696 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable pe 93.44
PF03410 590 Peptidase_M44: Protein G1; InterPro: IPR005072 In 92.33
KOG2019|consensus 998 92.31
KOG0959|consensus974 91.69
PHA03081 595 putative metalloprotease; Provisional 90.11
PF05193184 Peptidase_M16_C: Peptidase M16 inactive domain; In 89.56
COG1025 937 Ptr Secreted/periplasmic Zn-dependent peptidases, 85.68
KOG0961|consensus1022 82.56
>KOG0960|consensus Back     alignment and domain information 
Probab=99.92  E-value=8.9e-25  Score=202.77  Aligned_cols=139  Identities=21%  Similarity=0.284  Sum_probs=133.7

Q ss_pred             CCCCCcEEEEcCCCcEEEEEecCCCEEEEEEEEecCCCCCCCCCccHHHHHHHHHhCCCCCCCHHHHHHHHHHhCCeEeE
Q psy15801        141 LFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYA  220 (318)
Q Consensus       141 ~~~~~~~~~~L~NGlkv~~~~~~~p~v~v~l~~~~Gs~~e~~~~~Gla~ll~~ml~~GT~~~s~~~i~~~l~~lG~~l~~  220 (318)
                      ...|+.+.++|+||++|.+.++..++++|+++|++||++|.+.++|.+||++||.|+||.+++...+..+++.+|+.+|+
T Consensus        29 ~~~P~t~vttL~NGlrVaTE~~~a~TATVGVwidaGSR~EnekNNG~ahFLEhlaFKGT~~Rs~~alElEieniGahLNA  108 (467)
T KOG0960|consen   29 LSVPETEVTTLPNGLRVATEHNSASTATVGVWIDAGSRFENEKNNGTAHFLEHLAFKGTKNRSQAALELEIENIGAHLNA  108 (467)
T ss_pred             ccCCcceEEEcCCCcEEEeccCCCcceEEEEEeccCccccccccccHHHHHHHHHhcCCCcchhHHHHHHHHHHHHHhcc
Confidence            34578899999999999999998899999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCceEEEEEEecCCcHHHHHHHHHHhhccCCCCHHHHhhhhhhHHHHHhhCCCChhh
Q psy15801        221 TVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQGNE  279 (318)
Q Consensus       221 ~~~~d~~~~~~~~l~~~l~~~l~ll~d~l~~P~f~e~e~~~~k~~i~~ei~~~~~~~~~  279 (318)
                      +++||+|.|+..++++++++++++|+||++|..+.+.+|+++|..|+.|+++.+.+.++
T Consensus       109 ytSReqT~yyakal~~dv~kavdiLaDIlqns~L~~s~IerER~vILrEmqevd~~~~e  167 (467)
T KOG0960|consen  109 YTSREQTVYYAKALSKDVPKAVDILADILQNSKLEESAIERERDVILREMQEVDKNHQE  167 (467)
T ss_pred             cccccceeeehhhccccchHHHHHHHHHHHhCccchhHHHHHHHHHHHHHHHHHhhhhH
Confidence            99999999999999999999999999999999999999999999999999998877664

>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information
>PF00675 Peptidase_M16: Insulinase (Peptidase family M16) This is family M16 in the peptidase classification Back     alignment and domain information
>COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>PRK15101 protease3; Provisional Back     alignment and domain information
>KOG2067|consensus Back     alignment and domain information
>KOG2583|consensus Back     alignment and domain information
>KOG2067|consensus Back     alignment and domain information
>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0959|consensus Back     alignment and domain information
>KOG0960|consensus Back     alignment and domain information
>PRK15101 protease3; Provisional Back     alignment and domain information
>PTZ00432 falcilysin; Provisional Back     alignment and domain information
>PTZ00432 falcilysin; Provisional Back     alignment and domain information
>KOG2019|consensus Back     alignment and domain information
>COG1026 Predicted Zn-dependent peptidases, insulinase-like [General function prediction only] Back     alignment and domain information
>PF08367 M16C_assoc: Peptidase M16C associated; InterPro: IPR013578 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>KOG2583|consensus Back     alignment and domain information
>COG1026 Predicted Zn-dependent peptidases, insulinase-like [General function prediction only] Back     alignment and domain information
>KOG0961|consensus Back     alignment and domain information
>PF05193 Peptidase_M16_C: Peptidase M16 inactive domain; InterPro: IPR007863 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information
>PF03410 Peptidase_M44: Protein G1; InterPro: IPR005072 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2019|consensus Back     alignment and domain information
>KOG0959|consensus Back     alignment and domain information
>PHA03081 putative metalloprotease; Provisional Back     alignment and domain information
>PF05193 Peptidase_M16_C: Peptidase M16 inactive domain; InterPro: IPR007863 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0961|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
3cwb_B 441 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 2e-23
3bcc_B 422 Stigmatellin And Antimycin Bound Cytochrome Bc1 Com 1e-22
1bcc_B 422 Cytochrome Bc1 Complex From Chicken Length = 422 1e-22
1sqb_B 453 Crystal Structure Analysis Of Bovine Bc1 With Azoxy 1e-21
1bgy_B 439 Cytochrome Bc1 Complex From Bovine Length = 439 1e-21
1qcr_B 423 Crystal Structure Of Bovine Mitochondrial Cytochrom 1e-21
1ezv_B 352 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 6e-07
1bcc_A 446 Cytochrome Bc1 Complex From Chicken Length = 446 5e-06
1sqb_A 480 Crystal Structure Analysis Of Bovine Bc1 With Azoxy 6e-05
1bgy_A 446 Cytochrome Bc1 Complex From Bovine Length = 446 7e-05
1qcr_A 446 Crystal Structure Of Bovine Mitochondrial Cytochrom 7e-05
1hr6_A 475 Yeast Mitochondrial Processing Peptidase Length = 4 2e-04
3cwb_A 446 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 7e-04
>pdb|3CWB|B Chain B, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 441 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 73/118 (61%)
Query: 153 NKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQ 212
           N + + S+   SP +RI V  KAG+RYET  NLG  H+LR A+ L+T+  + F I R ++
Sbjct: 33  NGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTKGASSFRITRGIE 92
Query: 213 QAGGSLYATVDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDR 270
             GGSL     RE + Y +E +R  +  V ++L +V    EFRPWEV+DL P+LK D+
Sbjct: 93  AVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDK 150
>pdb|3BCC|B Chain B, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex From Chicken Length = 422 Back     alignment and structure
>pdb|1BCC|B Chain B, Cytochrome Bc1 Complex From Chicken Length = 422 Back     alignment and structure
>pdb|1SQB|B Chain B, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin Length = 453 Back     alignment and structure
>pdb|1BGY|B Chain B, Cytochrome Bc1 Complex From Bovine Length = 439 Back     alignment and structure
>pdb|1QCR|B Chain B, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 423 Back     alignment and structure
>pdb|1EZV|B Chain B, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 352 Back     alignment and structure
>pdb|1BCC|A Chain A, Cytochrome Bc1 Complex From Chicken Length = 446 Back     alignment and structure
>pdb|1SQB|A Chain A, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin Length = 480 Back     alignment and structure
>pdb|1BGY|A Chain A, Cytochrome Bc1 Complex From Bovine Length = 446 Back     alignment and structure
>pdb|1QCR|A Chain A, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 446 Back     alignment and structure
>pdb|1HR6|A Chain A, Yeast Mitochondrial Processing Peptidase Length = 475 Back     alignment and structure
>pdb|3CWB|A Chain A, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 446 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1pp9_B 439 Ubiquinol-cytochrome C reductase complex core Pro 6e-25
1pp9_B439 Ubiquinol-cytochrome C reductase complex core Pro 6e-10
3cx5_B 352 Cytochrome B-C1 complex subunit 2, mitochondrial; 8e-21
1hr6_A 475 Alpha-MPP, mitochondrial processing peptidase alph 3e-12
1hr6_A475 Alpha-MPP, mitochondrial processing peptidase alph 4e-06
1pp9_A 446 Ubiquinol-cytochrome C reductase complex core Pro 9e-11
1pp9_A446 Ubiquinol-cytochrome C reductase complex core Pro 1e-06
1hr6_B 443 Beta-MPP, mitochondrial processing peptidase beta 1e-08
1hr6_B443 Beta-MPP, mitochondrial processing peptidase beta 2e-06
3amj_B 424 Zinc peptidase inactive subunit; alpha/beta, zinc 3e-08
3gwb_A 434 Peptidase M16 inactive domain family protein; pept 5e-08
3cx5_A 431 Cytochrome B-C1 complex subunit 1, mitochondrial; 9e-08
3cx5_A431 Cytochrome B-C1 complex subunit 1, mitochondrial; 3e-06
3hdi_A421 Processing protease; CAGE structure, M16B peptidas 6e-06
3hdi_A 421 Processing protease; CAGE structure, M16B peptidas 2e-05
3eoq_A406 Putative zinc protease; two similar domains of bet 1e-05
3ami_A 445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 5e-04
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Length = 439 Back     alignment and structure
 Score =  103 bits (258), Expect = 6e-25
 Identities = 52/147 (35%), Positives = 82/147 (55%)

Query: 123 SSDVSAKRSFAAQPATKALFSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETP 182
           S  V+ K      PA       D++     N + + S+   +P +RI +  KAG+RYE  
Sbjct: 1   SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENS 60

Query: 183 DNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDREGIVYTIEAVRKEIGHVH 242
           +NLG +H+LR A+ L+T+  + F I R ++  GG L  T  RE + YT+E +R ++  + 
Sbjct: 61  NNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILM 120

Query: 243 KFLASVVGKTEFRPWEVSDLTPRLKYD 269
           +FL +V    EFR WEV+ L P+L+ D
Sbjct: 121 EFLLNVTTAPEFRRWEVAALQPQLRID 147
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Length = 439 Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Length = 352 Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Length = 475 Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Length = 475 Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Length = 446 Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Length = 446 Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Length = 443 Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Length = 443 Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Length = 424 Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} Length = 434 Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Length = 431 Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Length = 431 Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Length = 421 Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Length = 421 Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Length = 406 Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Length = 445 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
3eoq_A 406 Putative zinc protease; two similar domains of bet 99.91
3hdi_A 421 Processing protease; CAGE structure, M16B peptidas 99.9
1pp9_A 446 Ubiquinol-cytochrome C reductase complex core Pro 99.89
1hr6_A 475 Alpha-MPP, mitochondrial processing peptidase alph 99.89
3ami_A 445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 99.88
1hr6_B 443 Beta-MPP, mitochondrial processing peptidase beta 99.88
3go9_A 492 Insulinase family protease; IDP00573, structural g 99.86
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 99.85
1pp9_B 439 Ubiquinol-cytochrome C reductase complex core Pro 99.85
3amj_B 424 Zinc peptidase inactive subunit; alpha/beta, zinc 99.85
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 99.84
3gwb_A 434 Peptidase M16 inactive domain family protein; pept 99.84
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 99.83
3cx5_B 352 Cytochrome B-C1 complex subunit 2, mitochondrial; 99.81
3s5m_A 1193 Falcilysin; M16 metalloprotease, peptidase, hydrol 99.77
3cx5_A 431 Cytochrome B-C1 complex subunit 1, mitochondrial; 99.75
3d3y_A 425 Uncharacterized protein; APC29635, conserved prote 99.71
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 99.7
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 99.62
3s5m_A 1193 Falcilysin; M16 metalloprotease, peptidase, hydrol 99.6
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 99.55
3ih6_A197 Putative zinc protease; bordetella pertussis toham 99.43
3eoq_A406 Putative zinc protease; two similar domains of bet 99.27
3hdi_A421 Processing protease; CAGE structure, M16B peptidas 99.2
1hr6_A475 Alpha-MPP, mitochondrial processing peptidase alph 99.06
1pp9_B439 Ubiquinol-cytochrome C reductase complex core Pro 98.99
3d3y_A425 Uncharacterized protein; APC29635, conserved prote 98.98
3ami_A445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 98.96
1pp9_A446 Ubiquinol-cytochrome C reductase complex core Pro 98.94
1hr6_B443 Beta-MPP, mitochondrial processing peptidase beta 98.92
3gwb_A434 Peptidase M16 inactive domain family protein; pept 98.91
3cx5_A431 Cytochrome B-C1 complex subunit 1, mitochondrial; 98.89
3amj_B424 Zinc peptidase inactive subunit; alpha/beta, zinc 98.75
3go9_A492 Insulinase family protease; IDP00573, structural g 98.0
3cx5_B352 Cytochrome B-C1 complex subunit 2, mitochondrial; 96.77
3ih6_A197 Putative zinc protease; bordetella pertussis toham 94.25
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Back     alignment and structure
Probab=99.91  E-value=1.1e-23  Score=201.46  Aligned_cols=130  Identities=15%  Similarity=0.186  Sum_probs=124.4

Q ss_pred             cEEEEcCCCcEEEEEec-CCCEEEEEEEEecCCCCCCCCCccHHHHHHHHHhCCCCCCCHHHHHHHHHHhCCeEeEEecC
Q psy15801        146 IQSGTSYNKVKVVSVNE-TSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYATVDR  224 (318)
Q Consensus       146 ~~~~~L~NGlkv~~~~~-~~p~v~v~l~~~~Gs~~e~~~~~Gla~ll~~ml~~GT~~~s~~~i~~~l~~lG~~l~~~~~~  224 (318)
                      ++..+|+||++|++.++ ..|.++++++|++|+++|+++..|++||++||+|+||.+++..+|.+.++.+||.+++++++
T Consensus         2 ~~~~~L~NGl~v~~~~~~~~~~~~~~l~~~~Gs~~e~~~~~G~ah~lehmlf~Gt~~~~~~~~~~~l~~~G~~~na~t~~   81 (406)
T 3eoq_A            2 FREAELRNGLRVIAEVVPGARSVALGYFVKTGARDETKEESGVSHFLEHMVFKGPEDMDALAVNRAFDRMGAQYNAFTSE   81 (406)
T ss_dssp             EEEEECTTSCEEEEEECTTCSCEEEEEEESCSGGGSCGGGTTHHHHHHHHHTTCCTTCCHHHHHHHHHHTTCEEEEEECS
T ss_pred             ceeEEcCCCCEEEEEECCCCCeEEEEEEEccccCCCCCCCCCHHHHHHHHHhCCCCCCCHHHHHHHHHHhCCCccceecC
Confidence            57889999999999998 46999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEEEEEecCCcHHHHHHHHHHhhccCCCCHHHHhhhhhhHHHHHhhCCCC
Q psy15801        225 EGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQ  276 (318)
Q Consensus       225 d~~~~~~~~l~~~l~~~l~ll~d~l~~P~f~e~e~~~~k~~i~~ei~~~~~~  276 (318)
                      |+|.|++++++++++.+|++++|++ +|.|++++|++++..+.+|++....+
T Consensus        82 d~t~y~~~~~~~~l~~~l~ll~d~~-~p~f~~~~~~~ek~~v~~e~~~~~~~  132 (406)
T 3eoq_A           82 EATVYYGAVLPEFAYDLLGLFAKLL-RPALREEDFQTEKLVILEEIARYQDR  132 (406)
T ss_dssp             SCEEEEEEECGGGHHHHHHHHHHHT-SCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CeEEEEEEecHHHHHHHHHHHHHHh-cCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence            9999999999999999999999999 99999999999999999999876443
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Back     alignment and structure
>3s5m_A Falcilysin; M16 metalloprotease, peptidase, hydrolase; 1.55A {Plasmodium falciparum} PDB: 3s5i_A 3s5k_A 3s5h_A Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, enterococcus faecalis V583, STR genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis} Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3s5m_A Falcilysin; M16 metalloprotease, peptidase, hydrolase; 1.55A {Plasmodium falciparum} PDB: 3s5i_A 3s5k_A 3s5h_A Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Back     alignment and structure
>3ih6_A Putative zinc protease; bordetella pertussis tohama I, struc genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 2.15A {Bordetella pertussis} PDB: 3ivl_A Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, enterococcus faecalis V583, STR genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis} Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Back     alignment and structure
>3ih6_A Putative zinc protease; bordetella pertussis tohama I, struc genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 2.15A {Bordetella pertussis} PDB: 3ivl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1ppjb1219 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 4e-11
d3cx5b1202 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 9e-11
d1ppja1232 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 2e-10
d1hr6a1220 d.185.1.1 (A:14-233) Mitochondrial processing pept 2e-10
d3cx5a1213 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 4e-08
d1hr6b1222 d.185.1.1 (B:24-245) Mitochondrial processing pept 4e-08
d1ppjb2204 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 1e-04
d1hr6b2217 d.185.1.1 (B:246-462) Mitochondrial processing pep 9e-04
d1d7qa_ 143 b.40.4.5 (A:) Translation initiation factor-1a, eI 0.004
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 219 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Cytochrome bc1 core subunit 2
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 59.6 bits (143), Expect = 4e-11
 Identities = 33/89 (37%), Positives = 53/89 (59%)

Query: 144 PDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFT 203
            D++     N + + S+   +P +RI +  KAG+RYE  +NLG +H+LR A+ L+T+  +
Sbjct: 6   QDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGAS 65

Query: 204 HFGIIRHVQQAGGSLYATVDREGIVYTIE 232
            F I R ++  GG L  T  RE + YT+E
Sbjct: 66  SFKITRGIEAVGGKLSVTSTRENMAYTVE 94
>d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 202 Back     information, alignment and structure
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 220 Back     information, alignment and structure
>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1ppjb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1hr6b2 d.185.1.1 (B:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure
>d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1ppjb1219 Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [T 99.94
d1hr6a1220 Mitochondrial processing peptidase (MPP) alpha cha 99.92
d1ppja1232 Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [T 99.91
d1hr6b1222 Mitochondrial processing peptidase (MPP) beta chai 99.9
d1q2la4240 Protease III {Escherichia coli [TaxId: 562]} 99.89
d3cx5a1213 Cytochrome bc1 core subunit 1 {Baker's yeast (Sacc 99.85
d3cx5b1202 Cytochrome bc1 core subunit 2 {Baker's yeast (Sacc 99.81
d1ppjb2204 Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [T 99.67
d1hr6b2217 Mitochondrial processing peptidase (MPP) beta chai 99.63
d1hr6a2237 Mitochondrial processing peptidase (MPP) alpha cha 99.63
d1ppja2209 Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [T 99.53
d3cx5a2218 Cytochrome bc1 core subunit 1 {Baker's yeast (Sacc 99.52
d2fgea4257 Presequence protease 1, PREP1 {Thale cress (Arabid 99.52
d1q2la1229 Protease III {Escherichia coli [TaxId: 562]} 99.29
d2fgea2196 Presequence protease 1, PREP1 {Thale cress (Arabid 98.93
d2fgea1258 Presequence protease 1, PREP1 {Thale cress (Arabid 98.64
d3cx5b2150 Cytochrome bc1 core subunit 2 {Baker's yeast (Sacc 98.31
d2fgea3268 Presequence protease 1, PREP1 {Thale cress (Arabid 96.93
d1q2la2228 Protease III {Escherichia coli [TaxId: 562]} 95.93
d1ppjb2204 Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [T 93.87
d1q2la1229 Protease III {Escherichia coli [TaxId: 562]} 91.58
d1hr6a2237 Mitochondrial processing peptidase (MPP) alpha cha 89.14
d1ppja2209 Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [T 84.28
d3cx5a2218 Cytochrome bc1 core subunit 1 {Baker's yeast (Sacc 81.93
d1hr6b2217 Mitochondrial processing peptidase (MPP) beta chai 81.33
d1hr6b1222 Mitochondrial processing peptidase (MPP) beta chai 80.26
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Cytochrome bc1 core subunit 2
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.94  E-value=8.4e-27  Score=204.29  Aligned_cols=137  Identities=34%  Similarity=0.606  Sum_probs=130.7

Q ss_pred             CCCCcEEEEcCCCcEEEEEecCCCEEEEEEEEecCCCCCCCCCccHHHHHHHHHhCCCCCCCHHHHHHHHHHhCCeEeEE
Q psy15801        142 FSPDIQSGTSYNKVKVVSVNETSPIARISVAFKAGARYETPDNLGITHVLRSAAGLSTEEFTHFGIIRHVQQAGGSLYAT  221 (318)
Q Consensus       142 ~~~~~~~~~L~NGlkv~~~~~~~p~v~v~l~~~~Gs~~e~~~~~Gla~ll~~ml~~GT~~~s~~~i~~~l~~lG~~l~~~  221 (318)
                      .|+++++++|+|||+|++.++..|+++|+++|++|+++|+.+..|++||++||+++||.+++..+|.+.++.+|+.++++
T Consensus         4 ~~~~~~~~~L~NGl~v~~~~~~~p~v~i~~~v~~Gs~~e~~~~~G~ahlle~l~~~gt~~~s~~~i~~~~~~~G~~~n~~   83 (219)
T d1ppjb1           4 HPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVT   83 (219)
T ss_dssp             -CCCCEEEECTTSCEEEEECCCCSEEEEEEEESCSGGGCCTTSTTHHHHHHHCTTSCBSSSCHHHHHHHHHHTTCEEEEE
T ss_pred             CCCceeEEECCCCCEEEEEeCCCCEEEEEEEEcccccccCCCCccHHHHHHHHHhhccccchhHHHHHHHHHhccchhhh
Confidence            35789999999999998887788999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCceEEEEEEecCCcHHHHHHHHHHhhccCCCCHHHHhhhhhhHHHHHhhCCCChh
Q psy15801        222 VDREGIVYTIEAVRKEIGHVHKFLASVVGKTEFRPWEVSDLTPRLKYDRLTRPSQGN  278 (318)
Q Consensus       222 ~~~d~~~~~~~~l~~~l~~~l~ll~d~l~~P~f~e~e~~~~k~~i~~ei~~~~~~~~  278 (318)
                      +++|++.|++++++++++.++++|++++.+|.|+++++++++.++..++.....++.
T Consensus        84 t~~d~t~~~~~~~~~~~~~~l~ll~~~l~~p~~~~~~~~~~~~~i~~e~~~~~~~p~  140 (219)
T d1ppjb1          84 STRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQ  140 (219)
T ss_dssp             ECSSCEEEEEEEEGGGHHHHHHHHHHHHHCBCCCHHHHHHHTHHHHHHHHHHTTSHH
T ss_pred             hhhheeeeeeeeecchhHHHHHHHHHhccCCcchhhhhhhhhHHHHHHHHHHhhccc
Confidence            999999999999999999999999999999999999999999999999888777654
>d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ppjb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hr6b2 d.185.1.1 (B:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hr6a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ppja2 d.185.1.1 (A:234-442) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cx5a2 d.185.1.1 (A:240-457) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q2la1 d.185.1.1 (A:504-732) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgea2 d.185.1.1 (A:798-993) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fgea1 d.185.1.1 (A:540-797) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3cx5b2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fgea3 d.185.1.1 (A:272-539) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q2la2 d.185.1.1 (A:733-960) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ppjb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q2la1 d.185.1.1 (A:504-732) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hr6a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ppja2 d.185.1.1 (A:234-442) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cx5a2 d.185.1.1 (A:240-457) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hr6b2 d.185.1.1 (B:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure