Psyllid ID: psy16110


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72
MRRLFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQY
cHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcccccccEEEEcccccccccccccccccccEEEEEcccccccccccHHHcccccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHcccccccHHHHHccccccccccccHHHEEccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEccccccccccHHHHHcccccccEEEccccccHHHccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccccccccHHHcccccccEEEcccccccccccHHHccccccccHHHccccccEEEEccccccccccccccccccEEEEccccccccccHHHcccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccc
MRRLFDSIVHLSILLVSIVQvssepcdtmiddfpypcrckkmsesqlamdcdnvafpngeyptlpyglnlvtfsqrwvghqilpmqifsssvssepcdtmiddfpypcrckkmsesqlamdcdnvafpngeyptlpyglnlvtfsqrwvghqilpmqifsssdipirrldfSGNALRRLSDKLFSPHRDTLQELRLadnlfgdslnpifstsefhglvnlrildlsDNQIKAIEEGILKGCDNLLELrmdhnrftsipsvslngpRALRILSMAYNRigtlkadsFLSQRWLERIILRgnrlttieggafngLAKIHILNLGynrlnklnsdtfqggafngLAKIHILNLGynrlnklnsdtfqgthiTIFSFFQDFQKLKSLDLNGNFLINlestgledtldnlnvrdnqITTLSSSALNYKLLTKLDlshnnlkeleptaftnvptlLHLNLSrnahlsslpvggfdplkklEVLDLAATGlksipqyqFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLtyldlsnnnivnlrvgslyglpsmkrldlSFNKLttfkgdyfntkskpntssleelnlnnneltylfpssftihSKLKTLKLAFNKFNYFPKELILGLSYLQEIdlsnnqlktiddydygylprlrklnlnnnnidaisetcffnssqLQIINLSFNRLEKLPERLFNTFlytnydmapnlvfqshlsghrcecaqy
MRRLFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQifsssdipIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRftsipsvslngpRALRILSMAYNRIGTlkadsflsqRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQY
MRRLFDsivhlsillvsivqvssEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSleelnlnnnelTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKlnlnnnnIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQY
***LFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFN************LNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRC*****
***LFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQY
MRRLFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQY
*RRLFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRLFDSIVHLSILLVSIVQVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSVSSEPCDTMIDDFPYPCRCKKMSESQLAMDCDNVAFPNGEYPTLPYGLNLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFNTFLYTNYDMAPNLVFQSHLSGHRCECAQY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query719 2.2.26 [Sep-21-2011]
P70389603 Insulin-like growth facto yes N/A 0.581 0.693 0.283 1e-29
P12024 1315 Chaoptin OS=Drosophila me no N/A 0.699 0.382 0.274 2e-28
P35859603 Insulin-like growth facto yes N/A 0.606 0.723 0.290 1e-27
O02833605 Insulin-like growth facto N/A N/A 0.614 0.730 0.277 2e-27
P35858605 Insulin-like growth facto yes N/A 0.635 0.755 0.268 3e-26
Q80X72 579 Leucine-rich repeat-conta no N/A 0.389 0.483 0.331 8e-26
Q9HBX8 967 Leucine-rich repeat-conta no N/A 0.549 0.408 0.284 1e-25
P40197560 Platelet glycoprotein V O no N/A 0.477 0.612 0.275 1e-24
Q8R5M3 578 Leucine-rich repeat-conta no N/A 0.456 0.567 0.306 4e-24
Q9WVB4 1523 Slit homolog 3 protein OS no N/A 0.638 0.301 0.25 5e-24
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function desciption
 Score =  132 bits (331), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 130/459 (28%), Positives = 214/459 (46%), Gaps = 41/459 (8%)

Query: 247 LRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIE 306
           L +D N  +SIPS +     +L  L++  + + +L+  + L  + L  + L  N L ++ 
Sbjct: 79  LWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLA 138

Query: 307 GGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGT 366
            G F     +  L+LG N L +L       G F GL+ +  LNLG+N L  L    FQG 
Sbjct: 139 AGLFRHTPSLASLSLGNNLLGRLEE-----GLFRGLSHLWDLNLGWNSLVVLPDTVFQG- 192

Query: 367 HITIFSFFQDFQKLKSLDLNGNFLINLEST---GLEDTLDNLNVRDNQITTLSSSA-LNY 422
                        L  L L GN L  L+     GL + L  L++  N + ++ ++  ++ 
Sbjct: 193 ----------LGNLHELVLAGNKLTYLQPALLCGLGE-LRELDLSRNALRSVKANVFIHL 241

Query: 423 KLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAAT 482
             L KL L  N +  + P AF  +  L  L+LS N  ++ L    F  L  L VL LA  
Sbjct: 242 PRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHN-RVAGLLEDTFPGLLGLHVLRLAHN 300

Query: 483 GLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYG 542
            + S+    F +L  L+ L L HN + ++ E  F+ L  L  L L++N I  ++VG+ +G
Sbjct: 301 AITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFG 360

Query: 543 LPSMKRLDLSFNKLTTFKGDYFNTKSKPNT-------------------SSLEELNLNNN 583
           L ++  ++LS N L +     F    + ++                   S L  L L +N
Sbjct: 361 LFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDN 420

Query: 584 ELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGY 643
            ++ +   S    S+L  L L  N+  + P++L  GL  L+ + LSNNQL  + +   G 
Sbjct: 421 SISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLSEDVLGP 480

Query: 644 LPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLE 682
           L R   L+L++N ++  +E  F +  +L+ +NL  N L+
Sbjct: 481 LQRAFWLDLSHNRLETPAEGLFSSLGRLRYLNLRNNSLQ 519




May have an important role in regulating the access of circulating IGFs to the tissues.
Mus musculus (taxid: 10090)
>sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 Back     alignment and function description
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description
>sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=2 SV=3 Back     alignment and function description
>sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 Back     alignment and function description
>sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query719
328712629 1358 PREDICTED: toll-like receptor 13-like [A 0.837 0.443 0.391 1e-124
270001290 1323 tartan/capricious-like protein [Triboliu 0.816 0.443 0.384 1e-117
91091760 1337 PREDICTED: similar to GA20668-PA [Tribol 0.816 0.439 0.384 1e-116
194905866 1395 GG11714 [Drosophila erecta] gi|190655911 0.823 0.424 0.384 1e-115
21358607 1392 CG7896 [Drosophila melanogaster] gi|1618 0.835 0.431 0.381 1e-113
312032497 1210 RT10543p [Drosophila melanogaster] gi|31 0.823 0.489 0.385 1e-113
311692689 1210 RT10542p [Drosophila melanogaster] 0.823 0.489 0.385 1e-113
195503085 1121 GE23905 [Drosophila yakuba] gi|194184605 0.823 0.528 0.383 1e-112
357627007 1323 hypothetical protein KGM_17936 [Danaus p 0.824 0.448 0.355 1e-110
194746084 1407 GF18811 [Drosophila ananassae] gi|190628 0.830 0.424 0.371 1e-110
>gi|328712629|ref|XP_001944209.2| PREDICTED: toll-like receptor 13-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  454 bits (1167), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 289/739 (39%), Positives = 413/739 (55%), Gaps = 137/739 (18%)

Query: 82  ILPMQIFSSSVSS-EPCDTMIDDFPYPCRCKKMSE-SQLAMDCDNVAFPNGEYPTLPYGL 139
           +  + +F+S +S+   C+ +  +F YPC C+++ +   LA++CD V +P G++  LP   
Sbjct: 11  VAALMVFNSCLSTITSCEDLRSEFRYPCVCEELRQIGGLALNCDGVVYP-GDHVNLPKDA 69

Query: 140 NLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELRLADN 199
            ++ F+QR  GH  +P Q+F S+     +LD S N++RRLS+K F+  ++T+++LRLA N
Sbjct: 70  PVLVFTQRNAGHHSVPTQLFPST----VKLDLSQNSIRRLSEKSFNTIQNTVEDLRLAGN 125

Query: 200 LFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPS 259
           L GD+LNPIFS++EFHGL  L  LDLS+N+I ++EEGILKGC +L EL++D NR   IPS
Sbjct: 126 LLGDTLNPIFSSTEFHGLSKLIRLDLSENRISSLEEGILKGCVHLEELKLDGNRLAFIPS 185

Query: 260 VSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHIL 319
            SLNGP  LR LS+  NRI +++  SFLSQ+ L +I L  NR+  IE GAF GL+ +  L
Sbjct: 186 TSLNGPETLRTLSIKNNRIDSIQQGSFLSQKSLIKIDLSSNRVNNIEIGAFEGLSVLKQL 245

Query: 320 NLGYNRLNKLNSDTFQGG-------------------AFNGLAKIHILNLGYNRLNKLNS 360
            L  NRL+K NSD F G                    A      + ILNL  N + KL +
Sbjct: 246 LLSENRLSKFNSDVFYGAEKLDKLDISNNFIVEFPSLALRKFDNLKILNLSSNLIQKLEN 305

Query: 361 DTFQGTHITIFS----------FFQDFQKLKSLDLNGNF-----------LINLESTGLE 399
                  +   S           F+  +KLK L+L  N            L NLES  LE
Sbjct: 306 SQLTSLEVLDVSRNNIGSISPGTFKSLKKLKILNLAVNMLRTVEDDAFEGLTNLESLSLE 365

Query: 400 DT---------------LDNLNVRDNQITTLSSSAL------------------------ 420
           D                L  L +  N+I  LSS+ L                        
Sbjct: 366 DNNILLIPATALSKLPRLSKLRLDFNRIAALSSNILRGLSEILIELGLSRNVIREIPPDV 425

Query: 421 --NYKLLTKLDLSHNNLKELEPTAFTNVP-TLLHLNLS---------------------- 455
             ++KLL  LDLS N L  +EP+ F+ +  TL HLNL                       
Sbjct: 426 FQDFKLLKVLDLSGNLLLSVEPSTFSGLEDTLEHLNLQGNRIASLSSEPINLQKLKTLDL 485

Query: 456 -------------------------RNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQY 490
                                     N HL+ +PV  F PL +L+ LD++ T +K +   
Sbjct: 486 SYNQLKEIPRHTFTVMSSLSSLNLSHNPHLALIPVSVFHPLTQLQKLDISFTSIKVLSPE 545

Query: 491 QFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLD 550
            F +  +L +L + +N +TE+PE MF++L NL  LDLS N I N+R+GS  GL S++ ++
Sbjct: 546 LFFKTSSLTHLYIQNNGITELPETMFQSLTNLVTLDLSENQISNIRIGSFMGLSSIRYVN 605

Query: 551 LSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFN 610
           LS NKL++FKG+YF TK + N + LEE++++NN+++YLFPS+F +H  +K +K++ NKFN
Sbjct: 606 LSKNKLSSFKGEYFITK-RSNGTPLEEIDMSNNQISYLFPSTFKVHPSIKVIKVSNNKFN 664

Query: 611 YFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQ 670
           +FP ELI GL+ LQE+DLS N LKT++++D+  LP+LRKLNL NN ID ISET F NS+Q
Sbjct: 665 FFPSELIAGLANLQEVDLSKNSLKTLEEFDFAGLPQLRKLNLANNQIDTISETTFHNSTQ 724

Query: 671 LQIINLSFNRLEKLPERLF 689
           LQ I L+ N LE++ ER F
Sbjct: 725 LQYIKLANNNLERIGERTF 743




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270001290|gb|EEZ97737.1| tartan/capricious-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91091760|ref|XP_968875.1| PREDICTED: similar to GA20668-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194905866|ref|XP_001981273.1| GG11714 [Drosophila erecta] gi|190655911|gb|EDV53143.1| GG11714 [Drosophila erecta] Back     alignment and taxonomy information
>gi|21358607|ref|NP_651754.1| CG7896 [Drosophila melanogaster] gi|16184821|gb|AAL13838.1| LD30178p [Drosophila melanogaster] gi|23172637|gb|AAF56980.2| CG7896 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|312032497|gb|ADQ26804.1| RT10543p [Drosophila melanogaster] gi|312032501|gb|ADQ26806.1| RT10545p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|311692689|gb|ADP95695.1| RT10542p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195503085|ref|XP_002098504.1| GE23905 [Drosophila yakuba] gi|194184605|gb|EDW98216.1| GE23905 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|357627007|gb|EHJ76865.1| hypothetical protein KGM_17936 [Danaus plexippus] Back     alignment and taxonomy information
>gi|194746084|ref|XP_001955514.1| GF18811 [Drosophila ananassae] gi|190628551|gb|EDV44075.1| GF18811 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query719
FB|FBgn0261269 1092 conv "convoluted" [Drosophila 0.717 0.472 0.282 2.8e-38
FB|FBgn0036494 1514 Toll-6 "Toll-6" [Drosophila me 0.623 0.295 0.266 1.3e-26
RGD|68429603 Igfals "insulin-like growth fa 0.589 0.703 0.286 6.2e-29
UNIPROTKB|F1LRE2602 Igfals "Insulin-like growth fa 0.589 0.704 0.284 3.9e-28
MGI|MGI:107973603 Igfals "insulin-like growth fa 0.579 0.691 0.292 5e-28
UNIPROTKB|F1NI07604 IGFALS "Uncharacterized protei 0.506 0.602 0.304 8.5e-28
FB|FBgn0029114 1346 Tollo "Tollo" [Drosophila mela 0.559 0.298 0.262 1.6e-27
FB|FBgn0000313 1315 chp "chaoptic" [Drosophila mel 0.607 0.332 0.284 9.2e-27
FB|FBgn0004364 1389 18w "18 wheeler" [Drosophila m 0.492 0.254 0.279 1.5e-26
FB|FBgn0028888 1443 CG4168 [Drosophila melanogaste 0.730 0.363 0.262 1.5e-25
FB|FBgn0261269 conv "convoluted" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 431 (156.8 bits), Expect = 2.8e-38, Sum P(2) = 2.8e-38
 Identities = 159/563 (28%), Positives = 258/563 (45%)

Query:   150 GH--QILPMQIFSSSDIP----IRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGD 203
             GH  Q LP  +F+  +I     I R+  +GN L  L  + F P    L++L+  D L G+
Sbjct:   156 GHAFQQLPKDLFAGQEIANSLGIIRVT-NGN-LSDLPIETFQP----LRKLKTLD-LHGN 208

Query:   204 SLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLN 263
              L  +   ++F  L  L +LD+S NQIK +E   +     L    + HN  + +   +  
Sbjct:   209 QLENL-KRNQFKNLRELEVLDISHNQIKKLEAQHIADLTKLGWCNVSHNALSELSRGTFA 267

Query:   264 GPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGY 323
                 L++L +++N+I  L A+SF   R+L R+ L  N LT I  G F  +A+I  ++L  
Sbjct:   268 RNSVLKVLHLSHNQIARLDANSFRGMRFLRRLFLSDNVLTDIGRGTFGSIARIGTIDLAR 327

Query:   324 NRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSL 383
             NRL K+    FQ   F  +  + +L+L  N + K+  ++F+  +  I +   +  +L   
Sbjct:   328 NRLKKIE---FQ--MFTQMNYVELLDLAENNITKIEKNSFKDIYQAIINVSHNALELIET 382

Query:   384 DLNGNFLINLESTGLE-DTLDNLNVRDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTA 442
                 N  +N+    L  + L N + R    TT +         T   LS+NNL  L    
Sbjct:   383 AAFEN-CVNITVLDLSHNRLANFSRRSFDETTFA---------TYFQLSYNNLTNLAQIP 432

Query:   443 FTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLC 502
               N+  L  LN S N+ ++ +P   F  L +L  +D++   + SI    F  L +L+ + 
Sbjct:   433 IQNMTGLKVLNASYNS-ITEIPKNCFPKLYELHTIDVSHNNISSIFNGVFQTLFSLRSID 491

Query:   503 LAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLT----- 557
             L+HN + EI    F  L  L  +DLS+N +V++  GSL  L S+++L L+ N+L      
Sbjct:   492 LSHNSMREIKSSTFGTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLYLNNNQLEKLFQL 551

Query:   558 --TFKGDYFNTKSKPNTSSXX---------XXXXXXXXXTYLFPSSFTIHSKLKTLKLAF 606
               +    YF+     N  S                      L   SFT    ++ LKL  
Sbjct:   552 PISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQLGDTLNGESFTGLLVVQRLKLQN 611

Query:   607 NKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKXXXXXXXIDAISETCFF 666
             N  +  PK+ +  +S LQ + L NN + T++   +G LP L +       +  IS+  F 
Sbjct:   612 NGISQPPKDAVAVMSTLQYLHLENNNITTLERSAFGKLPVLFELNLYGNQVKDISKRAFE 671

Query:   667 NSSQLQIINLSFNRLEKLPERLF 689
                QL  +NLS N ++ L   +F
Sbjct:   672 GLLQLLTLNLSSNGIQTLQNDIF 694


GO:0035151 "regulation of tube size, open tracheal system" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
FB|FBgn0036494 Toll-6 "Toll-6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|68429 Igfals "insulin-like growth factor binding protein, acid labile subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRE2 Igfals "Insulin-like growth factor-binding protein complex acid labile subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:107973 Igfals "insulin-like growth factor binding protein, acid labile subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI07 IGFALS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0029114 Tollo "Tollo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000313 chp "chaoptic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004364 18w "18 wheeler" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0028888 CG4168 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query719
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-09
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-06
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 72.6 bits (178), Expect = 4e-13
 Identities = 98/335 (29%), Positives = 146/335 (43%), Gaps = 17/335 (5%)

Query: 377 FQKLKSLDLNGNFLINL--ESTGLEDTLDNLNVRDNQITTLSSSAL-NYKLLTKLDLSHN 433
           F  LK LDL GN L+     S     +L+ L +  NQ+       L   K L  + L +N
Sbjct: 163 FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN 222

Query: 434 NLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLK-SIPQYQF 492
           NL    P     + +L HL+L  N     +P      LK L+ L L    L   IP   F
Sbjct: 223 NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQNKLSGPIPPSIF 281

Query: 493 DELLNLKYLCLAHNHLT-EIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDL 551
             L  L  L L+ N L+ EIPE++ + L NL  L L +NN       +L  LP ++ L L
Sbjct: 282 S-LQKLISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQL 339

Query: 552 SFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFN- 610
             NK +   G+      K N  +L  L+L+ N LT   P        L  L L  N    
Sbjct: 340 WSNKFS---GEIPKNLGKHN--NLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEG 394

Query: 611 YFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQ 670
             PK L    S L+ + L +N        ++  LP +  L+++NNN+     +  ++   
Sbjct: 395 EIPKSLGACRS-LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPS 453

Query: 671 LQIINLSFNR-LEKLPERLFNTFLYTNYDMAPNLV 704
           LQ+++L+ N+    LP+  F +    N D++ N  
Sbjct: 454 LQMLSLARNKFFGGLPD-SFGSKRLENLDLSRNQF 487


Length = 968

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 719
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus 873 100.0
KOG4194|consensus 873 100.0
KOG0472|consensus565 100.0
KOG0472|consensus565 100.0
KOG0618|consensus 1081 100.0
KOG0618|consensus 1081 100.0
KOG4237|consensus498 99.97
KOG0444|consensus 1255 99.96
KOG0444|consensus 1255 99.95
KOG4237|consensus498 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0617|consensus264 99.49
KOG0617|consensus264 99.48
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
KOG1909|consensus382 99.24
KOG1909|consensus382 99.19
KOG3207|consensus 505 99.18
KOG0532|consensus 722 99.15
KOG3207|consensus505 99.14
KOG1259|consensus490 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1259|consensus490 99.08
KOG0531|consensus414 99.07
KOG0532|consensus 722 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
KOG0531|consensus414 99.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
PLN03150623 hypothetical protein; Provisional 98.82
KOG4658|consensus889 98.81
PLN03150623 hypothetical protein; Provisional 98.73
KOG1859|consensus 1096 98.73
KOG4658|consensus889 98.67
KOG1859|consensus 1096 98.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.44
KOG4579|consensus177 98.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.39
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.28
KOG2982|consensus418 98.21
KOG1644|consensus233 98.19
KOG4579|consensus177 98.19
KOG1644|consensus233 98.18
KOG2982|consensus 418 98.16
KOG2120|consensus419 98.15
KOG2120|consensus419 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.82
PRK15386 426 type III secretion protein GogB; Provisional 97.81
KOG4341|consensus483 97.79
KOG4341|consensus483 97.6
KOG2123|consensus388 97.37
KOG3665|consensus699 97.35
KOG3665|consensus699 97.23
KOG2123|consensus388 96.97
KOG2739|consensus260 96.82
KOG2739|consensus260 96.73
KOG1947|consensus482 96.17
KOG1947|consensus482 95.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.07
smart0037026 LRR Leucine-rich repeats, outliers. 95.07
KOG4308|consensus 478 95.03
KOG4308|consensus 478 94.97
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.49
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.4
cd0177597 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase 93.91
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.85
smart0037026 LRR Leucine-rich repeats, outliers. 92.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.58
KOG3864|consensus221 90.73
KOG3864|consensus221 88.33
KOG0473|consensus326 86.4
KOG0473|consensus 326 86.27
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 81.28
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.9
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-51  Score=494.17  Aligned_cols=526  Identities=25%  Similarity=0.254  Sum_probs=376.2

Q ss_pred             hcccccCCcCccccccCCCCcccEEEcCCCCcc-ccCcccccchhccccEEEcCCCcCCCcCCCCCCcccccCCCCCCEE
Q psy16110        145 SQRWVGHQILPMQIFSSSDIPIRRLDFSGNALR-RLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRIL  223 (719)
Q Consensus       145 ~~~~~~~~~lp~~~~~~~~~~L~~L~Ls~n~i~-~l~~~~f~~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~~l~~L~~L  223 (719)
                      .+...++.......|... ++|+.|+|++|++. .+|..+|. .+++|++|+|++|.+.+.+|.       +.+++|++|
T Consensus        75 ~L~~~~i~~~~~~~~~~l-~~L~~L~Ls~n~~~~~ip~~~~~-~l~~L~~L~Ls~n~l~~~~p~-------~~l~~L~~L  145 (968)
T PLN00113         75 DLSGKNISGKISSAIFRL-PYIQTINLSNNQLSGPIPDDIFT-TSSSLRYLNLSNNNFTGSIPR-------GSIPNLETL  145 (968)
T ss_pred             EecCCCccccCChHHhCC-CCCCEEECCCCccCCcCChHHhc-cCCCCCEEECcCCccccccCc-------cccCCCCEE
Confidence            333334433333344433 46888888888876 67777663 567888888888887765542       357778888


Q ss_pred             ECcCCCCcccCcCccCCCccCcEEECCCCcCCcCCCCCCCCCCCCcEEEcCCCcCcccCCCcccCCCccCEEEccCCCCc
Q psy16110        224 DLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLT  303 (719)
Q Consensus       224 ~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~i~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~  303 (719)
                      +|++|.+....+..++++++|++|++++|.+....+..++++++|++|++++|.+....|..+..+++|++|++++|.+.
T Consensus       146 ~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~  225 (968)
T PLN00113        146 DLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLS  225 (968)
T ss_pred             ECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccC
Confidence            88888877665666777888888888888776443346778888888888888877777777778888888888888887


Q ss_pred             ccCcccccCcccCcEEEcCCCCCCCcCCCccccccccCCCCCCEEeCCCCCCCccccccccCcccccccccccCCCccEE
Q psy16110        304 TIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSL  383 (719)
Q Consensus       304 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~i~~~~f~~~~~~~~~~l~~~~~L~~L  383 (719)
                      +..+..++++++|++|++++|.+++..+.     .+..+++|++|++++|+++           +.+|..+..+++|++|
T Consensus       226 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-----~l~~l~~L~~L~L~~n~l~-----------~~~p~~l~~l~~L~~L  289 (968)
T PLN00113        226 GEIPYEIGGLTSLNHLDLVYNNLTGPIPS-----SLGNLKNLQYLFLYQNKLS-----------GPIPPSIFSLQKLISL  289 (968)
T ss_pred             CcCChhHhcCCCCCEEECcCceeccccCh-----hHhCCCCCCEEECcCCeee-----------ccCchhHhhccCcCEE
Confidence            77777788888888888888877654433     4566778888888887763           2345556667788888


Q ss_pred             ECCCCCCcCcCC--cchhccCCEEEccCCcccccccC-ccCCCCccEEEccCCCCCCcCcccccCCCcCcEEeCcCCCCC
Q psy16110        384 DLNGNFLINLES--TGLEDTLDNLNVRDNQITTLSSS-ALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHL  460 (719)
Q Consensus       384 ~L~~n~l~~~~~--~~~~~~L~~L~l~~n~l~~~~~~-~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~~l  460 (719)
                      ++++|.+....+  +..+++|+.|++++|.+.+..+. ...+++|+.|++++|.+.+..+..++.+++|+.|++++|...
T Consensus       290 ~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~  369 (968)
T PLN00113        290 DLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLT  369 (968)
T ss_pred             ECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeE
Confidence            888887764433  34556788888888877654433 334777888888888887766777777788888888887433


Q ss_pred             CCCCCCCCCCCCCccEEEcCCCCCCCCCchhhcCCCCccEEEccCCcCCCCChhhhcCCCCCCEEeCCCCccccccCCcc
Q psy16110        461 SSLPVGGFDPLKKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSL  540 (719)
Q Consensus       461 ~~l~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~l  540 (719)
                      +.+|. .+..+++|+.|++++|.+.+..+..+..+++|+.|++++|.++...+..|..+++|+.|++++|.+++..+..+
T Consensus       370 ~~~p~-~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~  448 (968)
T PLN00113        370 GEIPE-GLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK  448 (968)
T ss_pred             eeCCh-hHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhh
Confidence            44443 35567778888888887777666677778888888888887775555567778888888888888877777777


Q ss_pred             CCCCCCCEEEccCCcCCcccCCcCCCCCCCCCCCCcEEECcCCCCCCcCcCcccCCCCccEEEcCCCCCCCcChhhhcCC
Q psy16110        541 YGLPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGL  620 (719)
Q Consensus       541 ~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l  620 (719)
                      ..+++|+.|++++|++.+..+..+.      .++|+.|++++|++++..|..+..+++|++|++++|++.+..+..+.++
T Consensus       449 ~~l~~L~~L~L~~n~~~~~~p~~~~------~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  522 (968)
T PLN00113        449 WDMPSLQMLSLARNKFFGGLPDSFG------SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSC  522 (968)
T ss_pred             ccCCCCcEEECcCceeeeecCcccc------cccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCc
Confidence            7778888888888877654444332      3678888888888887777777788888888888888876666667778


Q ss_pred             CCCCEEECCCCCCcccCcccCCCCCCCCEEeCCCCcCCCCCcccCCCCCCCcEEECCCCcCC-CcChHhhcCcccc-EEe
Q psy16110        621 SYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLE-KLPERLFNTFLYT-NYD  698 (719)
Q Consensus       621 ~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~-~i~~~~~~~l~~L-~L~  698 (719)
                      ++|++|+|++|.+++..+..+..+++|+.|++++|++++..|..+..+++|++|++++|+++ .+|..  ..+..+ ...
T Consensus       523 ~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~--~~~~~~~~~~  600 (968)
T PLN00113        523 KKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST--GAFLAINASA  600 (968)
T ss_pred             cCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc--chhcccChhh
Confidence            88888888888888777777778888888888888888777777777788888888888776 45542  222334 445


Q ss_pred             cCCCce
Q psy16110        699 MAPNLV  704 (719)
Q Consensus       699 l~~N~l  704 (719)
                      +.+|+.
T Consensus       601 ~~~n~~  606 (968)
T PLN00113        601 VAGNID  606 (968)
T ss_pred             hcCCcc
Confidence            566664



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd01775 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query719
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 7e-19
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-11
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-14
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-08
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 6e-14
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 3e-12
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 7e-14
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 9e-13
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-12
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 7e-10
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-13
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 5e-05
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-13
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 5e-12
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 4e-09
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-13
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-10
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-13
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-10
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-13
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-06
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 5e-13
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 6e-13
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 2e-12
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-12
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 6e-12
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-09
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 7e-12
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 6e-06
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 6e-06
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 9e-12
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 6e-06
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-11
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 6e-06
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-11
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-10
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 1e-11
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 3e-11
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 4e-09
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 6e-11
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 5e-08
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 8e-11
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-04
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 1e-10
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 2e-07
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 1e-10
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 2e-10
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 2e-05
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 5e-10
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-09
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 9e-06
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-09
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-05
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-09
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 5e-09
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 5e-09
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-08
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-08
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-08
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-08
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-08
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 6e-08
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 7e-08
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 7e-08
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 6e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 8e-08
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 9e-08
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-07
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-07
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 1e-07
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 1e-07
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-07
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 2e-07
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 2e-07
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 3e-07
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 3e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 3e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 5e-07
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 4e-07
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 4e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 5e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 7e-07
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 7e-07
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-06
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-05
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 6e-05
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 4e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 5e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 9e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 7e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-04
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 9e-06
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 3e-04
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 9e-06
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-05
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 1e-05
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-04
4ay9_X350 Structure Of Follicle-Stimulating Hormone In Comple 3e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-05
2z7x_A 549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 5e-05
2z7x_A 549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 4e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 5e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
1xwd_C252 Crystal Structure Of Human Follicle Stimulating Hor 2e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 6e-04
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 9e-04
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Iteration: 1

Score = 92.4 bits (228), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 85/317 (26%), Positives = 146/317 (46%), Gaps = 23/317 (7%) Query: 253 RFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNG 312 RF ++P P R+L + NRI TL D F S LE + L N ++ +E GAFN Sbjct: 22 RFVAVPE---GIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNN 78 Query: 313 LAKIHILNLGYNRLNKLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFS 372 L + L L NRL + G F GL+ + L++ N++ I + Sbjct: 79 LFNLRTLGLRSNRLKLI-----PLGVFTGLSNLTKLDISENKIV-----------ILLDY 122 Query: 373 FFQDFQKLKSLDLNGNFLINLESTGLE--DTLDNLNVRDNQITTLSSSALNY-KLLTKLD 429 FQD LKSL++ N L+ + ++L+ L + +T++ + AL++ L L Sbjct: 123 MFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLR 182 Query: 430 LSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSIPQ 489 L H N+ + +F + L L +S +L ++ L L L + L ++P Sbjct: 183 LRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGL-NLTSLSITHCNLTAVPY 241 Query: 490 YQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRL 549 L+ L++L L++N ++ I M LL L + L + + + GL ++ L Sbjct: 242 LAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVL 301 Query: 550 DLSFNKLTTFKGDYFNT 566 ++S N+LTT + F++ Sbjct: 302 NVSGNQLTTLEESVFHS 318
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|4AY9|X Chain X, Structure Of Follicle-Stimulating Hormone In Complex With The Entire Ectodomain Of Its Receptor Length = 350 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1XWD|C Chain C, Crystal Structure Of Human Follicle Stimulating Hormone Complexed With Its Receptor Length = 252 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query719
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-71
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-47
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-71
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-81
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-80
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-73
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-66
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-57
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-72
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-69
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-44
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-44
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-41
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-68
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-66
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-65
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-61
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-44
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-63
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-54
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-52
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-51
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-46
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-60
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-55
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-47
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-38
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-58
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-52
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-50
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-54
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-51
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-49
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-47
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-41
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-52
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-51
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-51
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-49
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-49
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-42
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-52
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-49
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-45
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-52
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-48
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-44
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-39
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-51
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-47
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-46
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-44
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-51
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-51
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-44
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-49
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-37
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-49
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-44
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-48
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-48
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-47
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-46
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-47
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-40
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-38
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-38
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-33
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-32
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-30
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-47
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-46
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-35
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-33
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-46
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-43
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-42
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-20
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-45
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-28
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-42
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-38
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-40
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-40
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-38
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-35
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-38
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-35
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-32
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-30
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-29
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-28
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-36
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-32
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-35
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-30
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-34
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-31
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-30
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-23
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-32
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-32
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-31
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-25
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-24
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-31
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-15
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-31
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-31
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-30
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-26
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-28
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-28
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-24
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-27
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-27
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-27
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-25
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-23
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-21
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-20
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-20
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-18
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 6e-07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 3e-05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-04
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
 Score =  303 bits (779), Expect = 2e-93
 Identities = 120/569 (21%), Positives = 220/569 (38%), Gaps = 52/569 (9%)

Query: 166 IRRLDFSGNALRRLSDKLFSPHRDTLQELRLADNLFGDSLNPIFSTSEFHGLVNLRILDL 225
           +  LD   N + +L  +L       L+ L L  N          S   F    NL  L L
Sbjct: 51  LTSLDVGFNTISKLEPELCQKLPM-LKVLNLQHNELSQ-----LSDKTFAFCTNLTELHL 104

Query: 226 SDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADS 285
             N I+ I+        NL+ L + HN  +S    +      L+ L ++ N+I  LK++ 
Sbjct: 105 MSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEE 164

Query: 286 F--LSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLNKLNSDTFQGGAFNGLA 343
               +   L+++ L  N++     G F+ + ++  L L   +L    ++           
Sbjct: 165 LDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKL--CLELANT 222

Query: 344 KIHILNLGYNRLNKLNSDTFQGTHIT---------------IFSFFQDFQKLKSLDLNGN 388
            I  L+L  ++L+  ++ TF G   T                   F    +L+   L  N
Sbjct: 223 SIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYN 282

Query: 389 FLI-----------NLESTGLEDTLDNLNVRDNQITTLSSSAL-NYKLLTKLDLSHNNLK 436
            +            N+    L+ +    ++    +  +   +    K L  L++  N++ 
Sbjct: 283 NIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIP 342

Query: 437 ELEPTAFTNVPTLLHLNLSRNA-HLSSLPVGGFDPL--KKLEVLDLAATGLKSIPQYQFD 493
            ++   FT +  L +L+LS +   L +L    F  L    L +L+L    +  I    F 
Sbjct: 343 GIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFS 402

Query: 494 ELLNLKYLCLAHNHLT-EIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLS 552
            L +L+ L L  N +  E+    ++ L N+  + LS N  + L   S   +PS++RL L 
Sbjct: 403 WLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLR 462

Query: 553 FNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYF 612
              L        +        +L  L+L+NN +  +         KL+ L L  N     
Sbjct: 463 RVALKNV---DSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARL 519

Query: 613 PKE--------LILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETC 664
            K          + GLS+L  ++L +N    I    +  L  L+ ++L  NN++ +  + 
Sbjct: 520 WKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASV 579

Query: 665 FFNSSQLQIINLSFNRLEKLPERLFNTFL 693
           F N   L+ +NL  N +  + +++F    
Sbjct: 580 FNNQVSLKSLNLQKNLITSVEKKVFGPAF 608


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query719
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.81
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.79
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.78
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.01
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.52
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 89.1
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.3
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-59  Score=541.66  Aligned_cols=561  Identities=25%  Similarity=0.339  Sum_probs=393.9

Q ss_pred             ccccccccccCCCCCCCCCCCC--chhhhhcccccCCcCccccccCCCCcccEEEcCCCCccccCcccccchhccccEEE
Q psy16110        118 LAMDCDNVAFPNGEYPTLPYGL--NLVTFSQRWVGHQILPMQIFSSSDIPIRRLDFSGNALRRLSDKLFSPHRDTLQELR  195 (719)
Q Consensus       118 ~~~~c~~~~l~~~~~~~~p~~~--~~~~l~~~~~~~~~lp~~~~~~~~~~L~~L~Ls~n~i~~l~~~~f~~~~~~L~~L~  195 (719)
                      ..++|.+..++     ++|..+  .+..+.+..++++.+|...|... .+|++|+|++|.++.++...|. .+++|++|+
T Consensus         7 ~~~~cs~~~L~-----~ip~~~~~~l~~L~Ls~n~l~~~~~~~~~~l-~~L~~L~Ls~n~l~~~~~~~~~-~l~~L~~L~   79 (680)
T 1ziw_A            7 EVADCSHLKLT-----QVPDDLPTNITVLNLTHNQLRRLPAANFTRY-SQLTSLDVGFNTISKLEPELCQ-KLPMLKVLN   79 (680)
T ss_dssp             SEEECCSSCCS-----SCCSCSCTTCSEEECCSSCCCCCCGGGGGGG-TTCSEEECCSSCCCCCCTTHHH-HCTTCCEEE
T ss_pred             CeeECCCCCcc-----ccccccCCCCcEEECCCCCCCCcCHHHHhCC-CcCcEEECCCCccCccCHHHHh-cccCcCEEE
Confidence            46899887776     333332  12333344444555555444433 3456666666655555554443 445566666


Q ss_pred             cCCCcCCCcCCCCCCcccccCCCCCCEEECcCCCCcccCcCccCCCccCcEEECCCCcCCcCCCCCCCCCCCCcEEEcCC
Q psy16110        196 LADNLFGDSLNPIFSTSEFHGLVNLRILDLSDNQIKAIEEGILKGCDNLLELRMDHNRFTSIPSVSLNGPRALRILSMAY  275 (719)
Q Consensus       196 Ls~n~i~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~i~~~~l~~l~~L~~L~Ls~  275 (719)
                      |++|.+++     +.+.+|+++++|++|+|++|++..+++..|+++++|++|++++|.++.+++..++++++|++|++++
T Consensus        80 L~~n~l~~-----l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~  154 (680)
T 1ziw_A           80 LQHNELSQ-----LSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN  154 (680)
T ss_dssp             CCSSCCCC-----CCTTTTTTCTTCSEEECCSSCCCCCCSCTTTTCTTCCEEECCSSCCSCCCCCSSSCCTTCCEEECCS
T ss_pred             CCCCccCc-----cChhhhccCCCCCEEECCCCccCccChhHccccCCCCEEECCCCcccccCchhhcccccCCEEEccC
Confidence            66555553     2223455556666666666655555555555556666666666655555544555555666666666


Q ss_pred             CcCcccCCCccc--CCCccCEEEccCCCCcccCcccccCccc---------------------------CcEEEcCCCCC
Q psy16110        276 NRIGTLKADSFL--SQRWLERIILRGNRLTTIEGGAFNGLAK---------------------------IHILNLGYNRL  326 (719)
Q Consensus       276 n~i~~~~~~~~~--~l~~L~~L~Ls~n~i~~~~~~~~~~l~~---------------------------L~~L~L~~n~l  326 (719)
                      |.++.+.+..+.  .+++|++|++++|.++++.+..|..+.+                           |++|++++|.+
T Consensus       155 n~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~~l~~~~L~~L~L~~n~l  234 (680)
T 1ziw_A          155 NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQL  234 (680)
T ss_dssp             SCCCCBCHHHHGGGTTCEESEEECTTCCCCCBCTTGGGGSSEECEEECTTCCCHHHHHHHHHHHHTTSCCCEEECTTSCC
T ss_pred             CcccccCHHHhhccccccccEEECCCCcccccChhhhhhhhhhhhhhccccccChhhHHHHHHHhhhccccEEEccCCcc
Confidence            655555444332  3355566666666555555554443332                           33333334433


Q ss_pred             CCcCCCccccccccCCC--CCCEEeCCCCCCCccccccccCcccccccccccCCCccEEECCCCCCcCcCC--cchhccC
Q psy16110        327 NKLNSDTFQGGAFNGLA--KIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLES--TGLEDTL  402 (719)
Q Consensus       327 ~~~~~~~~~~~~l~~l~--~L~~L~L~~n~l~~i~~~~f~~~~~~~~~~l~~~~~L~~L~L~~n~l~~~~~--~~~~~~L  402 (719)
                      +++.+..     +..++  +|++|++++|+++.+.           +..+..+++|++|++++|.+..+.+  +..+++|
T Consensus       235 ~~~~~~~-----~~~l~~~~L~~L~Ls~n~l~~~~-----------~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L  298 (680)
T 1ziw_A          235 STTSNTT-----FLGLKWTNLTMLDLSYNNLNVVG-----------NDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNV  298 (680)
T ss_dssp             CEECTTT-----TGGGGGSCCCEEECTTSCCCEEC-----------TTTTTTCTTCCEEECCSCCBSEECTTTTTTCTTC
T ss_pred             cccChhH-----hhccCcCCCCEEECCCCCcCccC-----------cccccCcccccEeeCCCCccCccChhhhcCCCCc
Confidence            3333322     22222  2555555555544332           3345567788888888887776654  4556778


Q ss_pred             CEEEccCCccc---------cccc-CccCCCCccEEEccCCCCCCcCcccccCCCcCcEEeCcCCCC-CCCCCCCCCCCC
Q psy16110        403 DNLNVRDNQIT---------TLSS-SALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAH-LSSLPVGGFDPL  471 (719)
Q Consensus       403 ~~L~l~~n~l~---------~~~~-~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~~-l~~l~~~~~~~l  471 (719)
                      +.|++++|...         .+.. ....+++|+.|++++|.+.++.+..|.++++|++|++++|.. +..++...|..+
T Consensus       299 ~~L~L~~~~~~~~~~~~~lp~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~l~~~~f~~~  378 (680)
T 1ziw_A          299 RYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSL  378 (680)
T ss_dssp             CEEECTTCBCCC------CCEECTTTTTTCTTCCEEECCSCCBCCCCTTTTTTCTTCCEEECTTCBSCCCEECTTTTGGG
T ss_pred             cEEeccchhhhcccccccccccChhhcccCCCCCEEECCCCccCCCChhHhccccCCcEEECCCCchhhhhcchhhhccc
Confidence            88888776433         2222 223478899999999999888888888899999999988832 344555545433


Q ss_pred             --CCccEEEcCCCCCCCCCchhhcCCCCccEEEccCCcCC-CCChhhhcCCCCCCEEeCCCCccccccCCccCCCCCCCE
Q psy16110        472 --KKLEVLDLAATGLKSIPQYQFDELLNLKYLCLAHNHLT-EIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKR  548 (719)
Q Consensus       472 --~~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~L~~n~l~-~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~  548 (719)
                        ++|+.|++++|+++++.+..|..+++|++|++++|.+. .++...|..+++|++|++++|++.++.+..|..+++|++
T Consensus       379 ~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~  458 (680)
T 1ziw_A          379 AHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQR  458 (680)
T ss_dssp             TTSCCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCEEECCSGGGTTCTTCCEEECCSCSEEECCTTTTTTCTTCCE
T ss_pred             ccCcCceEECCCCCCCeEChhhhhCCCCCCEEeCCCCcCccccCcccccCcccccEEecCCCCcceeChhhhhcCccccc
Confidence              58999999999999988888999999999999999987 466677889999999999999999988889999999999


Q ss_pred             EEccCCcCCcccCCcCCCCCCCCCCCCcEEECcCCCCCCcCcCcccCCCCccEEEcCCCCCCCcCh--------hhhcCC
Q psy16110        549 LDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPK--------ELILGL  620 (719)
Q Consensus       549 L~L~~n~l~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~--------~~l~~l  620 (719)
                      |++++|.+..+...   ...+..+++|++|++++|+++++.+..|..+++|++|++++|+++.++.        ..+.++
T Consensus       459 L~l~~n~l~~~~~~---p~~~~~l~~L~~L~Ls~N~l~~i~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~~~~~~l  535 (680)
T 1ziw_A          459 LMLRRVALKNVDSS---PSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGL  535 (680)
T ss_dssp             EECTTSCCBCTTCS---SCTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCGGGGSTTSTTSCCCTTTTC
T ss_pred             chhccccccccccC---CcccccCCCCCEEECCCCCCCcCChhhhccccccCEEeCCCCCccccchhhccCCcchhhcCC
Confidence            99999988643211   1223457999999999999999988899999999999999999987633        237889


Q ss_pred             CCCCEEECCCCCCcccCcccCCCCCCCCEEeCCCCcCCCCCcccCCCCCCCcEEECCCCcCCCcChHhhc-Ccccc-EEe
Q psy16110        621 SYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISETCFFNSSQLQIINLSFNRLEKLPERLFN-TFLYT-NYD  698 (719)
Q Consensus       621 ~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~i~~~~~~-~l~~L-~L~  698 (719)
                      ++|++|++++|+++.+++..|.++++|++|++++|+++++++..|..+++|+.|++++|+++.+++..|. .+++| .++
T Consensus       536 ~~L~~L~L~~N~l~~i~~~~~~~l~~L~~L~Ls~N~l~~l~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~~~~~L~~l~  615 (680)
T 1ziw_A          536 SHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELD  615 (680)
T ss_dssp             TTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECTTSCCCBCCHHHHHHHHTTCSEEE
T ss_pred             CCCCEEECCCCCCCCCCHHHcccccCcceeECCCCCCCcCCHhHhCCCCCCCEEECCCCcCCccChhHhcccccccCEEE
Confidence            9999999999999999988899999999999999999999999999999999999999999999999888 78999 999


Q ss_pred             cCCCceeeeccCCCccccC
Q psy16110        699 MAPNLVFQSHLSGHRCECA  717 (719)
Q Consensus       699 l~~N~l~~~~~~~~~C~c~  717 (719)
                      +++||+        .|+|+
T Consensus       616 l~~N~~--------~c~c~  626 (680)
T 1ziw_A          616 MRFNPF--------DCTCE  626 (680)
T ss_dssp             CTTCCC--------CBCCC
T ss_pred             ccCCCc--------ccCCc
Confidence            999999        89997



>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 719
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-09
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 99.3 bits (246), Expect = 2e-23
 Identities = 65/269 (24%), Positives = 119/269 (44%), Gaps = 21/269 (7%)

Query: 425 LTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGL 484
              LDL +N + E++   F N+  L  L L  N  +S +  G F PL KLE L L+   L
Sbjct: 33  TALLDLQNNKITEIKDGDFKNLKNLHTLILINN-KISKISPGAFAPLVKLERLYLSKNQL 91

Query: 485 KSIPQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRV--GSLYG 542
           K +P+        L+ L +  N +T++ + +F  L  +  ++L  N + +  +  G+  G
Sbjct: 92  KELPEKMPK---TLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQG 148

Query: 543 LPSMKRLDLSFNKLTTFKGDYFNTKSKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTL 602
           +  +  + ++   +TT               SL EL+L+ N++T +  +S    + L  L
Sbjct: 149 MKKLSYIRIADTNITTIPQGLP--------PSLTELHLDGNKITKVDAASLKGLNNLAKL 200

Query: 603 KLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRLRKLNLNNNNIDAISE 662
            L+FN  +      +    +L+E+ L+NN+L             ++ + L+NNNI AI  
Sbjct: 201 GLSFNSISAVDNGSLANTPHLRELHLNNNKLV-KVPGGLADHKYIQVVYLHNNNISAIGS 259

Query: 663 TCFF------NSSQLQIINLSFNRLEKLP 685
             F         +    ++L  N ++   
Sbjct: 260 NDFCPPGYNTKKASYSGVSLFSNPVQYWE 288


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query719
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=7.5e-28  Score=255.55  Aligned_cols=356  Identities=24%  Similarity=0.329  Sum_probs=193.1

Q ss_pred             ECCCCcCCcCCCCCCCCCCCCcEEEcCCCcCcccCCCcccCCCccCEEEccCCCCcccCcccccCcccCcEEEcCCCCCC
Q psy16110        248 RMDHNRFTSIPSVSLNGPRALRILSMAYNRIGTLKADSFLSQRWLERIILRGNRLTTIEGGAFNGLAKIHILNLGYNRLN  327 (719)
Q Consensus       248 ~L~~n~l~~i~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~  327 (719)
                      .++.+.++....  ...+.+|++|+++++.|+.+  +.+..+++|++|++++|+++++++  ++++++|++|++++|++.
T Consensus        28 ~l~~~~~~~~~~--~~~l~~l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~  101 (384)
T d2omza2          28 VLGKTNVTDTVS--QTDLDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIA  101 (384)
T ss_dssp             HTTCSSTTSEEC--HHHHTTCCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCC
T ss_pred             HhCCCCCCCccC--HHHhCCCCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCCcc--ccCCcccccccccccccc
Confidence            444555544321  23456777777777777765  346667777777777777777653  677777777777777776


Q ss_pred             CcCCCccccccccCCCCCCEEeCCCCCCCccccccccCcccccccccccCCCccEEECCCCCCcCcCCcchhccCCEEEc
Q psy16110        328 KLNSDTFQGGAFNGLAKIHILNLGYNRLNKLNSDTFQGTHITIFSFFQDFQKLKSLDLNGNFLINLESTGLEDTLDNLNV  407 (719)
Q Consensus       328 ~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~i~~~~f~~~~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~~L~~L~l  407 (719)
                      ++.+       +..+++|+.|+++++.++.+....             ....+.......+.+.........        
T Consensus       102 ~i~~-------l~~l~~L~~L~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~l~~~~~~~~~--------  153 (384)
T d2omza2         102 DITP-------LANLTNLTGLTLFNNQITDIDPLK-------------NLTNLNRLELSSNTISDISALSGL--------  153 (384)
T ss_dssp             CCGG-------GTTCTTCCEEECCSSCCCCCGGGT-------------TCTTCSEEEEEEEEECCCGGGTTC--------
T ss_pred             cccc-------cccccccccccccccccccccccc-------------cccccccccccccccccccccccc--------
Confidence            5542       455666666666666554432211             122333333333322222111000        


Q ss_pred             cCCcccccccCccCCCCccEEEccCCCCCCcCcccccCCCcCcEEeCcCCCCCCCCCCCCCCCCCCccEEEcCCCCCCCC
Q psy16110        408 RDNQITTLSSSALNYKLLTKLDLSHNNLKELEPTAFTNVPTLLHLNLSRNAHLSSLPVGGFDPLKKLEVLDLAATGLKSI  487 (719)
Q Consensus       408 ~~n~l~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~~l~~l~~~~~~~l~~L~~L~ls~n~l~~~  487 (719)
                                   ...............     ..+...+.........+ .....  ..+..+++++.+++++|.++.+
T Consensus       154 -------------~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~-~~~~~--~~~~~l~~~~~l~l~~n~i~~~  212 (384)
T d2omza2         154 -------------TSLQQLSFGNQVTDL-----KPLANLTTLERLDISSN-KVSDI--SVLAKLTNLESLIATNNQISDI  212 (384)
T ss_dssp             -------------TTCSEEEEEESCCCC-----GGGTTCTTCCEEECCSS-CCCCC--GGGGGCTTCSEEECCSSCCCCC
T ss_pred             -------------ccccccccccccchh-----hhhcccccccccccccc-ccccc--cccccccccceeeccCCccCCC
Confidence                         011111111111111     11223333333344333 11111  1234556666666666666665


Q ss_pred             CchhhcCCCCccEEEccCCcCCCCChhhhcCCCCCCEEeCCCCccccccCCccCCCCCCCEEEccCCcCCcccCCcCCCC
Q psy16110        488 PQYQFDELLNLKYLCLAHNHLTEIPEMMFKNLLNLTYLDLSNNNIVNLRVGSLYGLPSMKRLDLSFNKLTTFKGDYFNTK  567 (719)
Q Consensus       488 ~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~  567 (719)
                      .+  +..+++|++|++++|.++.++  .+..+++|+.|++++|++++..+  +..+++|++|++++|+++.+++  +   
T Consensus       213 ~~--~~~~~~L~~L~l~~n~l~~~~--~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~~L~l~~~~l~~~~~--~---  281 (384)
T d2omza2         213 TP--LGILTNLDELSLNGNQLKDIG--TLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISP--L---  281 (384)
T ss_dssp             GG--GGGCTTCCEEECCSSCCCCCG--GGGGCTTCSEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCCCCGG--G---
T ss_pred             Cc--ccccCCCCEEECCCCCCCCcc--hhhcccccchhccccCccCCCCc--ccccccCCEeeccCcccCCCCc--c---
Confidence            43  344566777777777666654  24566677777777776666532  5566666666666666654432  1   


Q ss_pred             CCCCCCCCcEEECcCCCCCCcCcCcccCCCCccEEEcCCCCCCCcChhhhcCCCCCCEEECCCCCCcccCcccCCCCCCC
Q psy16110        568 SKPNTSSLEELNLNNNELTYLFPSSFTIHSKLKTLKLAFNKFNYFPKELILGLSYLQEIDLSNNQLKTIDDYDYGYLPRL  647 (719)
Q Consensus       568 ~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L  647 (719)
                        ..++.++.+++++|.+++.  ..+..+++++.|++++|+++++++  +..+++|++|++++|++++++  .+.++++|
T Consensus       282 --~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l~~--l~~l~~L~~L~L~~n~l~~l~--~l~~l~~L  353 (384)
T d2omza2         282 --AGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDVS--SLANLTNI  353 (384)
T ss_dssp             --TTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCCGG--GGGCTTCCEEECCSSCCCCCG--GGGGCTTC
T ss_pred             --ccccccccccccccccccc--cccchhcccCeEECCCCCCCCCcc--cccCCCCCEEECCCCCCCCCh--hHcCCCCC
Confidence              1235566666666666553  235556666666666666666543  455666666666666666544  25566666


Q ss_pred             CEEeCCCCcCCCCCcccCCCCCCCcEEECCCC
Q psy16110        648 RKLNLNNNNIDAISETCFFNSSQLQIINLSFN  679 (719)
Q Consensus       648 ~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N  679 (719)
                      ++|++++|+++++++  +.++++|+.|+|++|
T Consensus       354 ~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         354 NWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            666666666666554  556666666666655



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure