Psyllid ID: psy16204


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------
MDLTFSRLPFYYSTASPNPGLNHMARLMDSLILDSFSPFSFTKITTTRRPVRMNANNTRRQQSKQQHVTPQMLYRAKSQATYQEEKKPSANKEPDSIADRWINSLRKRDPEIQPTLPAIIPSRSRSCSHPTTLKKTTRSFGSNTSASSTKKERKLGFKPAVKKIIAANASENSVSHEANEKDGVFRQDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFGSH
ccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccHHHHHHHHcccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccccHHHcccccccccEEEEEcccccccccccccccccccccccccccccccHHHHcccccccccccEEEEEEccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccc
ccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEcccccccccccccHcccccccEEEEEccccccEEEEccccccccccccccccccccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHEEEccccccccccHHHccccccccccccccHHHHHEEEcccccHHccccHHHHHHHHHHHHcccccccHHccEEEEEccccccHHHHHHHHHHHcccEEEEEccHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEEccHcccccEEEEcccccccccccccccEEcccccccccHHcHHHHHHHHcccccccccEEEEEEEcccccccHHHHHHHccccHHHHHHHHHHHHHccccEEEHHHccHHHccccccccccHHHHHHHHEEccccccccccccEEEEEcccccccHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccc
mdltfsrlpfyystaspnpglnHMARLMDSLildsfspfsftkitttrrpvrmnanntrrqqskqqhvtpQMLYRaksqatyqeekkpsankepdsIADRWINSlrkrdpeiqptlpaiipsrsrscshpttlkkttrsfgsntsasstkkerklgfKPAVKKIIAAnasensvsheanekdgvfrQDIREKIFYSTGFEPSLIETLEKDIlqnnpnvqwnKVAGLTEAKAILQEAMVLPTIMPEFFKEALErhshgtgkTMLAKAVATecgttffnvssstltskyrgeSEKLVRLLFEMVSFLVGLHSNKTFYLVGvlngeptttfAYNKQILQMNRRVLKGAlttaptraenqesgpsIFSVMVDGLGKGPWSMVAVVATHFtwgkkgtcqsheghsgrinknslfqarcyapstifIDEVDslcsmrgsdsehEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMlegytgsdiaNLARDAAMMSIRRKIMGQTPAQIKEIkqedidlpvtEKDFREAIARCRKsvtahdlskydswmnefgsh
mdltfsrlpfyystaspnpgLNHMARLMDSLILDSFSPFsftkitttrrpvrmnanntrrqqskqqhvtpqMLYRAKSQATYqeekkpsankepdsiADRWINSlrkrdpeiqptlpaiipsrsrscshpttlkkttrsfgsntsasstkkerklgfkPAVKKIIAanasensvsheanekdgvfrqDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTffnvssstltskyrGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAptraenqesgpsIFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMlegytgsdiaNLARDAAMMSIRRKIMGQTPAQIkeikqedidlpvTEKDFREAIARCRksvtahdlskydswmnefgsh
MDLTFSRLPFYYSTASPNPGLNHMARLMDSLILDSFSPFSFTKITTTRRPVRMNANNTRRQQSKQQHVTPQMLYRAKSQATYQEEKKPSANKEPDSIADRWINSLRKRDPEIQPTLPAIIPSRSRSCSHPTTLKKTTRSFGSNTSASSTKKERKLGFKPAVKKIIAANASENSVSHEANEKDGVFRQDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFGSH
******RLPFYYSTA****GLNHMARLMDSLILDSFSPFSFTKIT******************************************************************************************************************************************VFRQDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALT**************IFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLC**************FKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMG*****I**I***DIDLPVTEKDFREAIARCRKSVTAHDLSKY**********
*****SR***************************************************************************************************************************************************************************************************LIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQM************************IFSVMVDGLGKGPWSMVAVVATHFTWGKKGT*********RINKNSLFQARCYAPSTIFIDEVDSLCSMRGS*S*HEASRRFKAELLIQMDG***SLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRK****************IDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFG**
MDLTFSRLPFYYSTASPNPGLNHMARLMDSLILDSFSPFSFTKITTTRRPVRMNA****************MLYRA*****************PDSIADRWINSLRKRDPEIQPTLPAIIPSRSRSCSHPTTLK*******************KLGFKPAVKKIIAANASENSVSHEANEKDGVFRQDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFSVMVDGLGKGPWSMVAVVATHFTWGKK*********SGRINKNSLFQARCYAPSTIFIDEVDSLC***********SRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFGSH
*****SR****YSTASPNPGLN****LMDSLILDSFSPFSFTKITTTRRPVRMNANNTRRQQSKQQHVTPQMLYRAKSQATYQEEKKPSANKEPDSIADRWINSLRKRDPEIQPTLPAIIPSRSRSCSHPTTLKKTTRSFGSNTSASSTKKERKLGFKPAVKKIIAANASENSVSHEANEKDGVFRQDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLTFSRLPFYYSTASPNPGLNHMARLMDSLILDSFSPFSFTKITTTRRPVRMNANNTRRQQSKQQHVTPQMLYRAKSQATYQEEKKPSANKEPDSIADRWINSLRKRDPEIQPTLPAIIPSRSRSCSHPTTLKKTTRSFGSNTSASSTKKERKLGFKPAVKKIIAANASENSVSHEANEKDGVFRQDIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFGSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query577 2.2.26 [Sep-21-2011]
Q5U3S1488 Katanin p60 ATPase-contai yes N/A 0.523 0.618 0.373 3e-58
B4USW8490 Katanin p60 ATPase-contai N/A N/A 0.535 0.630 0.369 8e-57
B7NZ88490 Katanin p60 ATPase-contai yes N/A 0.571 0.673 0.358 2e-56
Q9BW62490 Katanin p60 ATPase-contai yes N/A 0.512 0.604 0.371 2e-56
A9RA82490 Katanin p60 ATPase-contai N/A N/A 0.512 0.604 0.371 4e-56
B5X3X5486 Katanin p60 ATPase-contai N/A N/A 0.542 0.644 0.370 5e-56
Q5XIK7488 Katanin p60 ATPase-contai yes N/A 0.573 0.678 0.345 1e-55
Q8K0T4488 Katanin p60 ATPase-contai yes N/A 0.535 0.633 0.364 2e-55
Q5RII9485 Katanin p60 ATPase-contai no N/A 0.516 0.614 0.382 6e-55
Q0IIR9492 Katanin p60 ATPase-contai no N/A 0.516 0.605 0.366 1e-54
>sp|Q5U3S1|KATL1_DANRE Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (577), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 150/402 (37%), Positives = 209/402 (51%), Gaps = 100/402 (24%)

Query: 188 DIREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFF 247
           D+ +K F  TG++  L++ LE+DI+  NPN+ W+ +A L +AK +L+EA+VLP  MP+FF
Sbjct: 173 DVEQKKFDGTGYDSDLVDALERDIVSRNPNIHWDDIADLEDAKKLLREAVVLPMWMPDFF 232

Query: 248 KE-------ALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFE 300
           K         L     GTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFE
Sbjct: 233 KGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFE 292

Query: 301 MVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGP 360
           M  F                   PTT F    +I  +  R        A  R +++    
Sbjct: 293 MARFYA-----------------PTTIFI--DEIDSICGRRGTSDEHEASRRVKSE---- 329

Query: 361 SIFSVMVDGLG-----KGPWSMVAVV-ATHFTWGKKGTCQSHEGHSGRINKNSLFQARCY 414
               V +DG+G     + P  MV V+ AT+F W         E    R+ K      R Y
Sbjct: 330 --LLVQMDGVGGAQESEDPSKMVMVLAATNFPW------DIDEALRRRLEK------RIY 375

Query: 415 APSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPY 474
            P          L + +G           +AEL                           
Sbjct: 376 IP----------LPTAKG-----------RAEL--------------------------- 387

Query: 475 QLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEI 534
             L + L  V +  ++D    ++ +EGY+G+DI N+ RDA+MM++RR+I G +P +I+ +
Sbjct: 388 --LKINLREVDVASDVDLTVFAEKIEGYSGADITNVCRDASMMAMRRRIQGLSPEEIRAL 445

Query: 535 KQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFGS 576
            ++++ +PVT +DF  A+ +  KSV+A DL KY+SWM+EFGS
Sbjct: 446 SKDELQMPVTMEDFELALKKISKSVSAADLEKYESWMSEFGS 487




Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 3
>sp|B4USW8|KATL1_OTOGA Katanin p60 ATPase-containing subunit A-like 1 OS=Otolemur garnettii GN=KATNAL1 PE=3 SV=1 Back     alignment and function description
>sp|B7NZ88|KATL1_RABIT Katanin p60 ATPase-containing subunit A-like 1 OS=Oryctolagus cuniculus GN=KATNAL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9BW62|KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens GN=KATNAL1 PE=1 SV=1 Back     alignment and function description
>sp|A9RA82|KATL1_PAPAN Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1 Back     alignment and function description
>sp|B5X3X5|KTNA1_SALSA Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 Back     alignment and function description
>sp|Q5XIK7|KATL1_RAT Katanin p60 ATPase-containing subunit A-like 1 OS=Rattus norvegicus GN=Katnal1 PE=2 SV=1 Back     alignment and function description
>sp|Q8K0T4|KATL1_MOUSE Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus GN=Katnal1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IIR9|KTNA1_XENTR Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
432112800562 Katanin p60 ATPase-containing subunit A1 0.566 0.581 0.409 5e-77
405971029 1717 Katanin p60 ATPase-containing subunit [C 0.530 0.178 0.370 8e-63
242024677483 conserved hypothetical protein [Pediculu 0.469 0.561 0.5 2e-62
357612799530 putative Katanin p60 ATPase-containing s 0.504 0.549 0.397 1e-59
157112522624 aaa atpase [Aedes aegypti] gi|108878039| 0.490 0.453 0.445 7e-59
170030497640 AAA family ATPase [Culex quinquefasciatu 0.490 0.442 0.422 2e-58
328719677474 PREDICTED: katanin p60 ATPase-containing 0.367 0.447 0.508 2e-58
55925351488 katanin p60 ATPase-containing subunit A- 0.523 0.618 0.373 2e-56
449269674488 Katanin p60 ATPase-containing subunit A- 0.639 0.756 0.341 5e-56
390178459610 GA30160, isoform A [Drosophila pseudoobs 0.367 0.347 0.462 7e-56
>gi|432112800|gb|ELK35398.1| Katanin p60 ATPase-containing subunit A1 [Myotis davidii] Back     alignment and taxonomy information
 Score =  295 bits (755), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 171/418 (40%), Positives = 237/418 (56%), Gaps = 91/418 (21%)

Query: 194 FYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKE---- 249
           F STG++  L+E LE+DI+  NPNV+W+ +A L EAK +L+EA+VLP  MPEFFK     
Sbjct: 200 FDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRRP 259

Query: 250 ---ALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLV 306
               L     GTGKT+LAKAVATEC TTFFNVSSSTLTSKYRGESEKLVRLLFEM     
Sbjct: 260 WKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEM----- 314

Query: 307 GLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFSVM 366
                      GVL   P  T           + +L  A+ T        E   + F+V 
Sbjct: 315 -----------GVLMVGPPGT----------GKTLLAKAVAT--------ECKTTFFNVS 345

Query: 367 VDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDS 426
              L                         + G S ++ +     AR Y+P+TIFIDE+DS
Sbjct: 346 SSTL----------------------TSKYRGESEKLVRLLFEMARFYSPATIFIDEIDS 383

Query: 427 LCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYED---KIIMILAATNHPY--------- 474
           +CS RG+  EHEASRR KAELL+QMDG+  +   D   K++M+LAATN P+         
Sbjct: 384 ICSRRGTSEEHEASRRVKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDEALRRR 443

Query: 475 ----------------QLLTLCLEGVVIDVNLDFHKISKMLEGYTGSDIANLARDAAMMS 518
                           +LL + L  + +  ++D  +I++ +EGY+G+DI N+ RDA++M+
Sbjct: 444 LEKRIYIPLPSAKGREELLRISLRELELADDVDLARIAENMEGYSGADITNVCRDASLMA 503

Query: 519 IRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVTAHDLSKYDSWMNEFGS 576
           +RR+I G TP +I+ + +E++ +P T +DF  A+ +  KSV+A D+ +Y+ W+ EFGS
Sbjct: 504 MRRRIEGLTPEEIRNLSREEMHMPTTMEDFEMALKKVSKSVSAADIERYEKWILEFGS 561




Source: Myotis davidii

Species: Myotis davidii

Genus: Myotis

Family: Vespertilionidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|405971029|gb|EKC35887.1| Katanin p60 ATPase-containing subunit [Crassostrea gigas] Back     alignment and taxonomy information
>gi|242024677|ref|XP_002432753.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518238|gb|EEB20015.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357612799|gb|EHJ68174.1| putative Katanin p60 ATPase-containing subunit [Danaus plexippus] Back     alignment and taxonomy information
>gi|157112522|ref|XP_001651818.1| aaa atpase [Aedes aegypti] gi|108878039|gb|EAT42264.1| AAEL006182-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170030497|ref|XP_001843125.1| AAA family ATPase [Culex quinquefasciatus] gi|167867366|gb|EDS30749.1| AAA family ATPase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328719677|ref|XP_001952578.2| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|55925351|ref|NP_001007432.1| katanin p60 ATPase-containing subunit A-like 1 [Danio rerio] gi|82232967|sp|Q5U3S1.1|KATL1_DANRE RecName: Full=Katanin p60 ATPase-containing subunit A-like 1; Short=Katanin p60 subunit A-like 1; AltName: Full=p60 katanin-like 1 gi|55250013|gb|AAH85416.1| Zgc:101696 [Danio rerio] Back     alignment and taxonomy information
>gi|449269674|gb|EMC80425.1| Katanin p60 ATPase-containing subunit A-like 1 [Columba livia] Back     alignment and taxonomy information
>gi|390178459|ref|XP_003736652.1| GA30160, isoform A [Drosophila pseudoobscura pseudoobscura] gi|388859454|gb|EIM52725.1| GA30160, isoform A [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
FB|FBgn0037375673 kat-60L1 "katanin p60-like 1" 0.199 0.170 0.688 1.2e-76
ZFIN|ZDB-GENE-041114-141488 katnal1 "katanin p60 subunit A 0.447 0.528 0.373 5.3e-59
UNIPROTKB|E1BSZ5489 KATNAL1 "Uncharacterized prote 0.331 0.390 0.438 1.7e-58
UNIPROTKB|E2QSK3492 KATNAL1 "Uncharacterized prote 0.336 0.394 0.447 2.6e-58
UNIPROTKB|F6V168490 KATNAL1 "Uncharacterized prote 0.336 0.395 0.451 1.9e-57
FB|FBgn0040208572 Kat60 "Katanin 60" [Drosophila 0.299 0.302 0.468 3e-57
UNIPROTKB|Q9BW62490 KATNAL1 "Katanin p60 ATPase-co 0.336 0.395 0.442 4.8e-57
UNIPROTKB|B5X3X5486 katna1 "Katanin p60 ATPase-con 0.353 0.419 0.435 1.1e-56
UNIPROTKB|E1BHF2490 KATNAL1 "Uncharacterized prote 0.336 0.395 0.447 1.4e-56
UNIPROTKB|E1BH39491 KATNA1 "Uncharacterized protei 0.247 0.291 0.54 3.4e-56
FB|FBgn0037375 kat-60L1 "katanin p60-like 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 389 (142.0 bits), Expect = 1.2e-76, Sum P(4) = 1.2e-76
 Identities = 84/122 (68%), Positives = 92/122 (75%)

Query:   190 REKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFFKE 249
             + K F   G+E  L++TLEKDILQ +P ++W  VAGL EAK ILQEA+VLP IMPEFFK 
Sbjct:   363 KAKHFSPLGYEVHLVDTLEKDILQRHPCIKWTDVAGLNEAKTILQEAVVLPVIMPEFFKG 422

Query:   250 -------ALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMV 302
                     L     GTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEM 
Sbjct:   423 IRRPWRGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMA 482

Query:   303 SF 304
              F
Sbjct:   483 RF 484


GO:0005783 "endoplasmic reticulum" evidence=ISS
GO:0016887 "ATPase activity" evidence=ISS
GO:0051013 "microtubule severing" evidence=ISS
GO:0008352 "katanin complex" evidence=ISS
GO:0005875 "microtubule associated complex" evidence=ISS
GO:0007017 "microtubule-based process" evidence=ISS
GO:0008017 "microtubule binding" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0016322 "neuron remodeling" evidence=IMP
GO:0005874 "microtubule" evidence=IDA
GO:0050775 "positive regulation of dendrite morphogenesis" evidence=IMP
ZFIN|ZDB-GENE-041114-141 katnal1 "katanin p60 subunit A-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSZ5 KATNAL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSK3 KATNAL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6V168 KATNAL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0040208 Kat60 "Katanin 60" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BW62 KATNAL1 "Katanin p60 ATPase-containing subunit A-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B5X3X5 katna1 "Katanin p60 ATPase-containing subunit A1" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHF2 KATNAL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH39 KATNA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-21
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-20
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-20
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-16
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 1e-15
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-15
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-15
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 5e-15
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 4e-14
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-13
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 5e-13
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-12
pfam00004131 pfam00004, AAA, ATPase family associated with vari 9e-12
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-10
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-10
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 4e-10
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-09
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 7e-09
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-08
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 5e-08
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-07
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-07
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 7e-07
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 3e-06
CHL00176638 CHL00176, ftsH, cell division protein; Validated 7e-06
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 8e-06
pfam0933662 pfam09336, Vps4_C, Vps4 C terminal oligomerisation 2e-05
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 8e-05
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-04
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 0.002
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 0.002
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 0.004
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 97.2 bits (242), Expect = 2e-21
 Identities = 58/192 (30%), Positives = 91/192 (47%), Gaps = 53/192 (27%)

Query: 401 GRINKN--SLFQ-ARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSS 457
           G   KN   LF+ AR  APS IFIDE+DSL S RG  SE  + RR   +LL ++DG+  +
Sbjct: 318 GESEKNIRELFEKARKLAPSIIFIDEIDSLASGRG-PSEDGSGRRVVGQLLTELDGIEKA 376

Query: 458 LYEDKIIMILAATNHP---------------------------YQLLTLCLEGVVIDV-- 488
             E   ++++AATN P                            ++  + L      +  
Sbjct: 377 --EG--VLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKPPLAE 432

Query: 489 NLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDF 548
           ++D  +++++ EGY+G+DIA L R+AA+ ++R                E     VT  DF
Sbjct: 433 DVDLEELAEITEGYSGADIAALVREAALEALR----------------EARRREVTLDDF 476

Query: 549 REAIARCRKSVT 560
            +A+ + + SVT
Sbjct: 477 LDALKKIKPSVT 488


Length = 494

>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|204202 pfam09336, Vps4_C, Vps4 C terminal oligomerisation domain Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 577
KOG0738|consensus491 100.0
KOG0733|consensus802 100.0
KOG0730|consensus693 100.0
KOG0736|consensus953 100.0
KOG0739|consensus439 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0737|consensus386 100.0
KOG0740|consensus428 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0734|consensus 752 100.0
KOG0728|consensus404 100.0
KOG0735|consensus952 100.0
KOG0731|consensus 774 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
KOG0727|consensus408 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0729|consensus435 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0726|consensus440 99.98
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.98
PRK03992389 proteasome-activating nucleotidase; Provisional 99.98
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.97
KOG0652|consensus424 99.97
KOG0741|consensus 744 99.97
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.97
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.96
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.96
CHL00176 638 ftsH cell division protein; Validated 99.96
KOG0651|consensus388 99.95
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.95
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.95
CHL00206 2281 ycf2 Ycf2; Provisional 99.95
KOG0733|consensus 802 99.94
KOG0732|consensus 1080 99.94
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.93
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.89
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.88
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.87
KOG2004|consensus 906 99.86
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.86
PF00004132 AAA: ATPase family associated with various cellula 99.82
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.76
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.76
KOG0730|consensus 693 99.76
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.73
KOG0744|consensus423 99.72
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.72
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.71
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.7
KOG0736|consensus 953 99.69
CHL00181287 cbbX CbbX; Provisional 99.68
CHL00095821 clpC Clp protease ATP binding subunit 99.68
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.67
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.65
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.64
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.62
KOG0742|consensus630 99.62
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.62
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.62
KOG0735|consensus 952 99.61
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.61
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.59
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.59
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.59
KOG0743|consensus457 99.58
PRK10865857 protein disaggregation chaperone; Provisional 99.57
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.55
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.52
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.51
KOG2028|consensus554 99.51
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.49
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.48
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.48
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.48
KOG1051|consensus898 99.48
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK13342413 recombination factor protein RarA; Reviewed 99.44
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.44
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.44
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.44
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.43
PRK04195 482 replication factor C large subunit; Provisional 99.43
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.42
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.41
CHL00095 821 clpC Clp protease ATP binding subunit 99.41
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.41
PLN03025319 replication factor C subunit; Provisional 99.4
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.4
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.38
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.38
KOG0989|consensus346 99.38
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.38
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.37
PRK10865 857 protein disaggregation chaperone; Provisional 99.36
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.36
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.36
PRK07940394 DNA polymerase III subunit delta'; Validated 99.36
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.35
PRK12402337 replication factor C small subunit 2; Reviewed 99.35
PHA02544316 44 clamp loader, small subunit; Provisional 99.35
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.34
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.33
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.33
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.31
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.3
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.29
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.29
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.28
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.28
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.28
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.28
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.27
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.26
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.26
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.25
KOG0745|consensus564 99.24
PRK13341 725 recombination factor protein RarA/unknown domain f 99.22
PRK00440319 rfc replication factor C small subunit; Reviewed 99.21
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.2
COG2204464 AtoC Response regulator containing CheY-like recei 99.2
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.19
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.18
PTZ001121164 origin recognition complex 1 protein; Provisional 99.18
COG1221403 PspF Transcriptional regulators containing an AAA- 99.16
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.16
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.14
PRK00149450 dnaA chromosomal replication initiation protein; R 99.14
COG0714329 MoxR-like ATPases [General function prediction onl 99.1
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.07
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.06
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.04
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.04
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.03
PRK14088440 dnaA chromosomal replication initiation protein; P 99.0
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.0
KOG1969|consensus 877 98.99
PRK05564313 DNA polymerase III subunit delta'; Validated 98.98
PRK15424538 propionate catabolism operon regulatory protein Pr 98.98
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.97
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.96
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.96
PRK12422445 chromosomal replication initiation protein; Provis 98.96
PRK07471365 DNA polymerase III subunit delta'; Validated 98.95
PF07726131 AAA_3: ATPase family associated with various cellu 98.94
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.93
PRK11608326 pspF phage shock protein operon transcriptional ac 98.93
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.92
smart00382148 AAA ATPases associated with a variety of cellular 98.91
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.9
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.88
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.88
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.86
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.86
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.85
PRK14086617 dnaA chromosomal replication initiation protein; P 98.85
PRK06893229 DNA replication initiation factor; Validated 98.85
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.85
PRK09112351 DNA polymerase III subunit delta'; Validated 98.85
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.82
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.81
PRK13531 498 regulatory ATPase RavA; Provisional 98.81
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.8
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.8
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.8
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.79
PRK13765 637 ATP-dependent protease Lon; Provisional 98.79
PHA02244383 ATPase-like protein 98.77
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.73
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.71
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.69
PRK15115444 response regulator GlrR; Provisional 98.69
PRK08084235 DNA replication initiation factor; Provisional 98.68
PRK08058329 DNA polymerase III subunit delta'; Validated 98.68
KOG1942|consensus456 98.68
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.68
PRK07399314 DNA polymerase III subunit delta'; Validated 98.68
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.68
PRK05642234 DNA replication initiation factor; Validated 98.67
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.64
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.64
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.63
PRK14087450 dnaA chromosomal replication initiation protein; P 98.61
PRK04132846 replication factor C small subunit; Provisional 98.61
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.6
KOG0991|consensus333 98.6
PRK05707328 DNA polymerase III subunit delta'; Validated 98.6
smart00350509 MCM minichromosome maintenance proteins. 98.56
PRK08727233 hypothetical protein; Validated 98.55
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.54
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.48
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.48
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.48
KOG0741|consensus744 98.48
PRK12377248 putative replication protein; Provisional 98.47
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.45
PRK06620214 hypothetical protein; Validated 98.42
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.42
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.39
PRK08116268 hypothetical protein; Validated 98.39
PRK09862506 putative ATP-dependent protease; Provisional 98.38
PRK06964342 DNA polymerase III subunit delta'; Validated 98.37
PF0933662 Vps4_C: Vps4 C terminal oligomerisation domain; In 98.36
PRK07952244 DNA replication protein DnaC; Validated 98.35
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.34
PRK07993334 DNA polymerase III subunit delta'; Validated 98.31
PRK06871325 DNA polymerase III subunit delta'; Validated 98.3
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.29
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.29
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.26
KOG1514|consensus767 98.26
PRK08181269 transposase; Validated 98.25
PRK08769319 DNA polymerase III subunit delta'; Validated 98.25
KOG2680|consensus454 98.24
KOG2227|consensus529 98.24
PRK06526254 transposase; Provisional 98.21
PRK08939306 primosomal protein DnaI; Reviewed 98.2
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.19
PF13173128 AAA_14: AAA domain 98.18
PRK06835329 DNA replication protein DnaC; Validated 98.16
PRK09183259 transposase/IS protein; Provisional 98.14
PRK09087226 hypothetical protein; Validated 98.13
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.11
PRK06090319 DNA polymerase III subunit delta'; Validated 98.11
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.11
KOG0990|consensus360 98.1
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.1
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.05
PRK08699325 DNA polymerase III subunit delta'; Validated 98.05
COG0593408 DnaA ATPase involved in DNA replication initiation 98.01
KOG2170|consensus344 97.96
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.95
PF05729166 NACHT: NACHT domain 97.92
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.9
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.87
PRK06921266 hypothetical protein; Provisional 97.85
PF14516331 AAA_35: AAA-like domain 97.84
PRK05917290 DNA polymerase III subunit delta'; Validated 97.84
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.81
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.8
KOG1970|consensus 634 97.76
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.76
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.73
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 97.73
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.71
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.67
PRK15455 644 PrkA family serine protein kinase; Provisional 97.66
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.64
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.62
PHA00729226 NTP-binding motif containing protein 97.61
PRK00771437 signal recognition particle protein Srp54; Provisi 97.6
PRK07276290 DNA polymerase III subunit delta'; Validated 97.59
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.56
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.55
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.54
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.52
PRK07132299 DNA polymerase III subunit delta'; Validated 97.5
PRK08118167 topology modulation protein; Reviewed 97.5
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.5
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.48
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.47
PRK00131175 aroK shikimate kinase; Reviewed 97.46
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.46
PRK11823446 DNA repair protein RadA; Provisional 97.45
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.44
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.44
PRK13947171 shikimate kinase; Provisional 97.43
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.36
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.36
PRK03839180 putative kinase; Provisional 97.35
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.35
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.34
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.31
KOG2035|consensus351 97.28
PRK14974336 cell division protein FtsY; Provisional 97.28
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.26
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.24
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.22
PRK00625173 shikimate kinase; Provisional 97.22
PRK06067234 flagellar accessory protein FlaH; Validated 97.2
PRK07261171 topology modulation protein; Provisional 97.2
PRK14532188 adenylate kinase; Provisional 97.2
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.18
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.17
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.16
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.15
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.15
PRK13949169 shikimate kinase; Provisional 97.11
PRK06217183 hypothetical protein; Validated 97.09
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.09
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.09
PRK05818261 DNA polymerase III subunit delta'; Validated 97.08
PRK10867433 signal recognition particle protein; Provisional 97.07
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.07
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.07
PRK03731171 aroL shikimate kinase II; Reviewed 97.05
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.04
COG1485367 Predicted ATPase [General function prediction only 97.03
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.02
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.02
cd01394218 radB RadB. The archaeal protein radB shares simila 97.02
PRK14530215 adenylate kinase; Provisional 97.0
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.99
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 96.98
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.97
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.97
PRK09376416 rho transcription termination factor Rho; Provisio 96.96
PRK14531183 adenylate kinase; Provisional 96.96
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.96
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 96.94
KOG2543|consensus438 96.93
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.91
COG1241682 MCM2 Predicted ATPase involved in replication cont 96.91
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.91
PRK06762166 hypothetical protein; Provisional 96.9
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.9
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.89
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.89
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.89
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.88
PRK08154309 anaerobic benzoate catabolism transcriptional regu 96.88
COG0703172 AroK Shikimate kinase [Amino acid transport and me 96.88
KOG3347|consensus176 96.88
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.87
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.86
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.85
PRK13946184 shikimate kinase; Provisional 96.85
KOG2383|consensus467 96.84
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 96.84
cd01128249 rho_factor Transcription termination factor rho is 96.83
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.83
KOG0477|consensus854 96.82
cd03115173 SRP The signal recognition particle (SRP) mediates 96.81
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.81
PRK04328249 hypothetical protein; Provisional 96.81
PRK10536262 hypothetical protein; Provisional 96.81
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.79
PRK02496184 adk adenylate kinase; Provisional 96.77
PRK14528186 adenylate kinase; Provisional 96.77
KOG1968|consensus 871 96.76
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.76
PRK05057172 aroK shikimate kinase I; Reviewed 96.75
KOG0652|consensus424 96.75
PRK14737186 gmk guanylate kinase; Provisional 96.74
PTZ00088229 adenylate kinase 1; Provisional 96.72
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.71
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.7
PRK13808333 adenylate kinase; Provisional 96.7
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.7
PRK06696223 uridine kinase; Validated 96.69
PRK04182180 cytidylate kinase; Provisional 96.68
PRK13948182 shikimate kinase; Provisional 96.68
PRK00279215 adk adenylate kinase; Reviewed 96.68
PLN02200234 adenylate kinase family protein 96.66
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.63
TIGR00959428 ffh signal recognition particle protein. This mode 96.63
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 96.62
PRK06547172 hypothetical protein; Provisional 96.61
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.61
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 96.61
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 96.6
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.6
PRK04296190 thymidine kinase; Provisional 96.59
PRK10416318 signal recognition particle-docking protein FtsY; 96.57
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 96.56
TIGR00064272 ftsY signal recognition particle-docking protein F 96.56
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.56
KOG0482|consensus721 96.55
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.54
KOG1051|consensus 898 96.54
PRK04040188 adenylate kinase; Provisional 96.54
COG1117253 PstB ABC-type phosphate transport system, ATPase c 96.54
PRK09302 509 circadian clock protein KaiC; Reviewed 96.53
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 96.51
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.51
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 96.5
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.48
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.47
PHA02530300 pseT polynucleotide kinase; Provisional 96.45
PRK08233182 hypothetical protein; Provisional 96.45
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.43
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.43
PRK14527191 adenylate kinase; Provisional 96.42
KOG0480|consensus764 96.41
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.41
PRK01184184 hypothetical protein; Provisional 96.4
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 96.4
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.39
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.39
KOG0478|consensus804 96.38
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.38
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.37
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.37
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 96.36
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 96.35
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.33
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.33
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.32
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.3
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 96.3
PRK05973237 replicative DNA helicase; Provisional 96.3
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.29
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.29
PRK09354349 recA recombinase A; Provisional 96.29
cd03246173 ABCC_Protease_Secretion This family represents the 96.29
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.28
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.27
PHA02624647 large T antigen; Provisional 96.24
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.24
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.22
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 96.22
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.2
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.2
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 96.18
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 96.17
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 96.17
PTZ00035337 Rad51 protein; Provisional 96.15
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.15
PRK04220301 2-phosphoglycerate kinase; Provisional 96.14
PRK14526211 adenylate kinase; Provisional 96.14
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 96.13
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.11
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.1
COG4619223 ABC-type uncharacterized transport system, ATPase 96.09
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.09
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.07
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.07
cd03269210 ABC_putative_ATPase This subfamily is involved in 96.04
TIGR00767415 rho transcription termination factor Rho. Members 96.03
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.02
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.02
KOG0058|consensus716 96.02
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.02
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.01
PLN02674244 adenylate kinase 96.0
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.99
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 95.98
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.96
PF04851184 ResIII: Type III restriction enzyme, res subunit; 95.96
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.96
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 95.95
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.94
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 95.94
COG4178604 ABC-type uncharacterized transport system, permeas 95.94
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 95.93
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.93
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 95.92
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.91
PRK12339197 2-phosphoglycerate kinase; Provisional 95.91
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.9
PRK11607377 potG putrescine transporter ATP-binding subunit; P 95.9
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 95.9
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 95.9
PF1324576 AAA_19: Part of AAA domain 95.89
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.88
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 95.88
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 95.86
COG1127263 Ttg2A ABC-type transport system involved in resist 95.85
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.85
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.84
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.83
PRK12608380 transcription termination factor Rho; Provisional 95.83
PRK13975196 thymidylate kinase; Provisional 95.82
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 95.82
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 95.81
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 95.81
PRK00889175 adenylylsulfate kinase; Provisional 95.79
PRK05541176 adenylylsulfate kinase; Provisional 95.78
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 95.77
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.77
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 95.76
PRK05480209 uridine/cytidine kinase; Provisional 95.75
PRK13833323 conjugal transfer protein TrbB; Provisional 95.75
PRK14529223 adenylate kinase; Provisional 95.74
PLN02199303 shikimate kinase 95.73
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.73
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.72
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 95.72
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 95.72
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 95.71
PRK04132 846 replication factor C small subunit; Provisional 95.7
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 95.69
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 95.69
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.69
cd03215182 ABC_Carb_Monos_II This family represents domain II 95.68
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 95.68
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 95.67
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 95.67
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 95.66
>KOG0738|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-59  Score=490.76  Aligned_cols=279  Identities=59%  Similarity=0.954  Sum_probs=265.4

Q ss_pred             HHHHhhhhcCCCchhhhHHHhhhhhcCCCCCcccccCcHHHHHHHHHHHHCcCCCcccc-------ceeEEecCCCCChH
Q psy16204        189 IREKIFYSTGFEPSLIETLEKDILQNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFF-------KEALERHSHGTGKT  261 (577)
Q Consensus       189 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~v~~~dIiG~~~ak~~L~e~l~~pl~~~~~~-------k~ILL~GPpGtGKT  261 (577)
                      -....|.+.|++..|.+.++.++++++|++.|+||.|+.+||+.|++++++|+..|++|       +|||++||||||||
T Consensus       180 ~~~~~f~~~~~d~~Lve~lerdIl~~np~ikW~DIagl~~AK~lL~EAVvlPi~mPe~F~GirrPWkgvLm~GPPGTGKT  259 (491)
T KOG0738|consen  180 GEDKKFDSLGYDADLVEALERDILQRNPNIKWDDIAGLHEAKKLLKEAVVLPIWMPEFFKGIRRPWKGVLMVGPPGTGKT  259 (491)
T ss_pred             cccCCCCcccchHHHHHHHHHHHhccCCCcChHhhcchHHHHHHHHHHHhhhhhhHHHHhhcccccceeeeeCCCCCcHH
Confidence            35567888999999999999999999999999999999999999999999999999988       57899999999999


Q ss_pred             HHHHHHHHHhCCeEEEEecCccccccccchHHHHHHHHHHhhhhhccccCcceeeccccCCCCCccchhhHHHHHHHHHh
Q psy16204        262 MLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRV  341 (577)
Q Consensus       262 ~LAkaLA~el~~~fv~v~~s~l~~k~~G~~e~~vr~lF~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  341 (577)
                      +||||||.||+..||+|+++.+++||.|++|++||-||++                                        
T Consensus       260 lLAKAvATEc~tTFFNVSsstltSKwRGeSEKlvRlLFem----------------------------------------  299 (491)
T KOG0738|consen  260 LLAKAVATECGTTFFNVSSSTLTSKWRGESEKLVRLLFEM----------------------------------------  299 (491)
T ss_pred             HHHHHHHHhhcCeEEEechhhhhhhhccchHHHHHHHHHH----------------------------------------
Confidence            9999999999999999999999999999999999999998                                        


Q ss_pred             hcccccCCcccccccCCCCccccccccCCCCCCcchhhhhhhhcccCCCCcccCCCCcchhhhhhhHHHHHhcCCeEEEE
Q psy16204        342 LKGALTTAPTRAENQESGPSIFSVMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFI  421 (577)
Q Consensus       342 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~a~~~~p~IIfI  421 (577)
                                                                                           |+.++|++|||
T Consensus       300 ---------------------------------------------------------------------ARfyAPStIFi  310 (491)
T KOG0738|consen  300 ---------------------------------------------------------------------ARFYAPSTIFI  310 (491)
T ss_pred             ---------------------------------------------------------------------HHHhCCceeeh
Confidence                                                                                 99999999999


Q ss_pred             ccccccccCCCCCChhHHHHHHHHHHHHHHhCCCCCcCCCceEEEEEecCCchhhHHHhhcCc-----------------
Q psy16204        422 DEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGV-----------------  484 (577)
Q Consensus       422 DEID~l~~~r~~~~~~~~~~~v~~~LL~~mD~~~~~~~~~~~VlIIatTN~p~~L~~allrr~-----------------  484 (577)
                      ||||.||+.||+.++|++++||+++||.+|||++......+.|+|+||||.||+||.+++||+                 
T Consensus       311 DEIDslcs~RG~s~EHEaSRRvKsELLvQmDG~~~t~e~~k~VmVLAATN~PWdiDEAlrRRlEKRIyIPLP~~~~R~~L  390 (491)
T KOG0738|consen  311 DEIDSLCSQRGGSSEHEASRRVKSELLVQMDGVQGTLENSKVVMVLAATNFPWDIDEALRRRLEKRIYIPLPDAEARSAL  390 (491)
T ss_pred             hhHHHHHhcCCCccchhHHHHHHHHHHHHhhccccccccceeEEEEeccCCCcchHHHHHHHHhhheeeeCCCHHHHHHH
Confidence            999999999999999999999999999999999987555577999999999999999999986                 


Q ss_pred             --------ccccccCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHhcCChhHHhhhhccCCCCCCCHHHHHHHHHHhC
Q psy16204        485 --------VIDVNLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCR  556 (577)
Q Consensus       485 --------~i~~~vdl~~LA~~t~G~sgsDI~~l~~~Aa~~airr~~~~~~~~~~~~~~~~~~~~~It~~df~~Al~~~~  556 (577)
                              ..+.+++++.||+.++||||+||.++|++|+|+++||.+.+.++.+|..+..+....+|+.+||++|+.+++
T Consensus       391 i~~~l~~~~~~~~~~~~~lae~~eGySGaDI~nvCreAsm~~mRR~i~g~~~~ei~~lakE~~~~pv~~~Dfe~Al~~v~  470 (491)
T KOG0738|consen  391 IKILLRSVELDDPVNLEDLAERSEGYSGADITNVCREASMMAMRRKIAGLTPREIRQLAKEEPKMPVTNEDFEEALRKVR  470 (491)
T ss_pred             HHHhhccccCCCCccHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHhcCCcHHhhhhhhhccccccchhhHHHHHHHcC
Confidence                    233467899999999999999999999999999999999999999999999998889999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHhhCC
Q psy16204        557 KSVTAHDLSKYDSWMNEFGS  576 (577)
Q Consensus       557 psv~~~~~~~~~~~~~~~~~  576 (577)
                      |||++.++.+|++|+++|||
T Consensus       471 pSvs~~d~~k~ekW~~efGS  490 (491)
T KOG0738|consen  471 PSVSAADLEKYEKWMDEFGS  490 (491)
T ss_pred             cCCCHHHHHHHHHHHHHhcC
Confidence            99999999999999999998



>KOG0733|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>KOG2383|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>KOG1968|consensus Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-20
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-20
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 1e-20
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-20
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-20
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-20
3b9p_A297 Spastin Length = 297 8e-20
3b9p_A297 Spastin Length = 297 2e-19
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 3e-18
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 4e-15
1xwi_A322 Crystal Structure Of Vps4b Length = 322 4e-17
1xwi_A322 Crystal Structure Of Vps4b Length = 322 2e-16
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 9e-12
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-10
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 4e-05
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 3e-10
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 7e-10
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-09
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-09
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-09
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-09
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 2e-09
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 2e-09
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 2e-09
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-09
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-07
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 2e-09
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 3e-09
2ce7_A 476 Edta Treated Length = 476 3e-09
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 3e-09
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 3e-08
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 3e-09
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 2e-08
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 1e-05
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 2e-08
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 2e-08
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 2e-07
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 7e-06
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 3e-05
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-05
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 6e-05
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 6e-05
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-05
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure

Iteration: 1

Score = 98.2 bits (243), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 71/232 (30%), Positives = 105/232 (45%), Gaps = 56/232 (24%) Query: 398 GHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSS 457 G S ++ K AR PS IFID+VD+L RG + E EASRR K ELL+QM+G+ + Sbjct: 126 GESEKLVKQLFAMARENKPSIIFIDQVDALTGTRG-EGESEASRRIKTELLVQMNGVGN- 183 Query: 458 LYEDKIIMILAATNHPYQLLT----------------LCLEGVVIDVNL----------D 491 + + +++L ATN P+QL + L + ++N+ D Sbjct: 184 --DSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPSVLTKED 241 Query: 492 FHKISKMLEGYTGSDIANLARDAAMMSIR------------------RKIMGQTPAQIKE 533 + + M EGY+GSDIA + +DA M IR RK+ +P Sbjct: 242 YRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSTEDDETRKLTPSSPGDDGA 301 Query: 534 IKQEDIDLPVTE--------KDFREAIARCRKSVTAHDLSKYDSWMNEFGSH 577 I+ D+ E KDF +AI R +V DL K + + +FG Sbjct: 302 IEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVNEDDLLKQEQFTRDFGQE 353
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 7e-56
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-40
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-54
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-43
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 6e-54
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 3e-46
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 6e-53
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 4e-38
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 3e-52
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 4e-39
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-50
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-37
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-48
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 7e-36
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-32
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-22
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 8e-32
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-23
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-22
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-18
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 9e-28
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 3e-22
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 5e-25
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-17
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 4e-20
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 9e-20
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 6e-15
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 7e-11
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-12
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 1e-07
2r62_A268 Cell division protease FTSH homolog; ATPase domain 4e-12
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-08
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-11
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 8e-09
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-11
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-08
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 3e-11
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 3e-08
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 5e-10
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-08
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 2e-06
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-08
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-06
2krk_A86 26S protease regulatory subunit 8; structural geno 5e-07
3kw6_A78 26S protease regulatory subunit 8; structural geno 5e-07
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 2e-06
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 3e-06
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 1e-05
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
 Score =  189 bits (482), Expect = 7e-56
 Identities = 69/196 (35%), Positives = 100/196 (51%), Gaps = 34/196 (17%)

Query: 408 LFQ-ARCYAPSTIFIDEVDSLCSMRGSDSEHEASRRFKAELLIQMDGLNSSLYEDKIIMI 466
           LF  AR   PS IFIDEVDSL S R S SEHEASRR K E L++ DGL  +  +   I++
Sbjct: 105 LFAVARHMQPSIIFIDEVDSLLSERSS-SEHEASRRLKTEFLVEFDGLPGN-PDGDRIVV 162

Query: 467 LAATNHPYQL-------------------------LTLCLEGVVIDVN-LDFHKISKMLE 500
           LAATN P +L                         L   L+     ++     +++K+ +
Sbjct: 163 LAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITD 222

Query: 501 GYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCRKSVT 560
           GY+GSD+  LA+DAA+  IR         Q+K +    +   +TE+DF  ++ R R+SV 
Sbjct: 223 GYSGSDLTALAKDAALEPIRELN----VEQVKCLDISAMR-AITEQDFHSSLKRIRRSVA 277

Query: 561 AHDLSKYDSWMNEFGS 576
              L+ Y+ W  ++G 
Sbjct: 278 PQSLNSYEKWSQDYGD 293


>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 100.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 100.0
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 100.0
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.98
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.97
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.96
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.96
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.96
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.95
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.93
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.93
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.93
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.91
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.88
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.88
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.87
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.86
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.75
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.75
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.74
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.73
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.72
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.72
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.7
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.69
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.65
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.64
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.61
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.61
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.6
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.6
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.6
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.58
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.57
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.56
3pvs_A447 Replication-associated recombination protein A; ma 99.56
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.52
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.5
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.5
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.49
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.48
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.47
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.46
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.46
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.45
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.44
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.44
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.43
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.43
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.42
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.42
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.42
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.41
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.41
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.41
3bos_A242 Putative DNA replication factor; P-loop containing 99.41
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.4
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.4
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.38
3co5_A143 Putative two-component system transcriptional RES 99.36
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.35
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.35
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.32
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.3
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.28
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.27
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.25
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.25
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.19
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.18
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.11
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.08
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.07
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.06
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.98
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 98.97
2krk_A86 26S protease regulatory subunit 8; structural geno 98.94
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.83
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.79
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.73
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.53
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.52
2qgz_A308 Helicase loader, putative primosome component; str 98.48
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.41
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.32
2fna_A357 Conserved hypothetical protein; structural genomic 98.32
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.19
3f8t_A506 Predicted ATPase involved in replication control, 98.17
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.12
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.06
1tue_A212 Replication protein E1; helicase, replication, E1E 97.93
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.82
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.81
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.72
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 97.65
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.61
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.53
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.44
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.44
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 97.41
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.36
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.32
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.31
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.31
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.3
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.29
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.25
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.24
1via_A175 Shikimate kinase; structural genomics, transferase 97.23
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.23
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.22
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.21
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.21
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.2
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.2
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.19
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.17
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.16
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.15
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.1
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.1
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.1
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.09
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.07
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.04
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.03
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.03
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.03
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.02
2z43_A324 DNA repair and recombination protein RADA; archaea 97.02
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.01
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.0
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.0
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.99
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.98
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.97
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.96
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.96
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.95
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.93
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.92
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.92
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.92
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.91
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.9
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.9
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.9
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.9
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.9
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.89
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.88
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.86
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.84
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.83
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.83
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.82
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.78
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.78
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.77
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.76
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.74
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.74
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.74
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.72
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.69
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.68
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.64
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.64
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.63
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.63
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.63
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.62
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.61
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.6
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.57
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.55
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.55
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.54
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.53
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.5
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.49
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.43
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.39
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.37
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.34
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.33
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.33
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.29
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.28
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.27
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.23
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.21
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.2
3io5_A333 Recombination and repair protein; storage dimer, i 96.17
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.14
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.11
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.08
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.05
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.04
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.04
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.03
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.03
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.02
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.99
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.98
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 95.98
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.97
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.94
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 95.89
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 95.88
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.87
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.87
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.86
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 95.85
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 95.85
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 95.85
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.84
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.84
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.84
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.79
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 95.77
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.74
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.74
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 95.74
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.67
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 95.62
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.61
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.6
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 95.55
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 95.53
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.53
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.51
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 95.51
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.5
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.48
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 95.47
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 95.46
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.43
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.31
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.31
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.31
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.29
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 95.26
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.24
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.23
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.23
3bor_A237 Human initiation factor 4A-II; translation initiat 95.23
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.22
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.17
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.17
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.13
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.1
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 95.06
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.05
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 94.93
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.93
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.91
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 94.76
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.74
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.7
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 94.7
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 94.69
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 94.61
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.6
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.57
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.57
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.55
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.52
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 94.4
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.39
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 94.37
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 94.35
3ice_A422 Transcription termination factor RHO; transcriptio 94.32
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 94.22
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.16
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.15
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.11
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 94.09
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 94.05
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.02
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 93.91
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 93.9
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 93.88
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.84
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.81
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.81
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 93.79
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.77
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.66
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 93.62
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.6
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 93.55
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.48
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 93.42
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.42
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 93.4
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.37
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 93.36
2ged_A193 SR-beta, signal recognition particle receptor beta 93.33
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 93.31
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.31
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 93.21
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.2
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.19
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.1
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 93.09
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.07
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.06
3kta_A182 Chromosome segregation protein SMC; structural mai 93.06
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.05
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.99
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.96
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.88
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.86
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.83
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 92.76
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.76
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 92.74
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 92.74
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.67
1p9r_A418 General secretion pathway protein E; bacterial typ 92.66
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.6
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 92.51
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.46
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 92.44
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.44
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 92.39
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.36
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.34
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 92.32
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.31
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.27
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 92.2
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 92.19
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.19
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 92.19
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.14
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 92.08
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 92.07
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 92.05
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 92.02
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 92.0
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 91.99
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 91.97
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.96
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 91.95
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 91.95
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 91.93
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 91.92
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 91.92
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 91.92
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.91
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 91.9
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.89
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 91.86
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.86
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.85
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 91.82
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.77
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.72
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 91.7
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 91.68
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 91.64
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 91.62
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.6
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 91.6
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 91.6
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.59
2og2_A359 Putative signal recognition particle receptor; nuc 91.57
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 91.57
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 91.55
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 91.55
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 91.55
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 91.52
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 91.51
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 91.49
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.48
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.47
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 91.46
1xjc_A169 MOBB protein homolog; structural genomics, midwest 91.46
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 91.43
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 91.42
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 91.41
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 91.4
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.39
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.39
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.38
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 91.37
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 91.37
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 91.35
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 91.34
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.32
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 91.31
3t1o_A198 Gliding protein MGLA; G domain containing protein, 91.3
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 91.28
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.25
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 91.2
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 91.17
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 91.12
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.07
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.04
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.02
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 90.99
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 90.94
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.89
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 90.85
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 90.84
1b0u_A262 Histidine permease; ABC transporter, transport pro 90.79
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 90.79
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 90.71
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.7
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 90.67
1g6h_A257 High-affinity branched-chain amino acid transport 90.67
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 90.66
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 90.66
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 90.65
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 90.58
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.57
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 90.55
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 90.54
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 90.54
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.54
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 90.54
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 90.52
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 90.52
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 90.51
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 90.5
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 90.5
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 90.5
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 90.48
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 90.43
2oap_1511 GSPE-2, type II secretion system protein; hexameri 90.43
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 90.42
1sgw_A214 Putative ABC transporter; structural genomics, P p 90.4
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 90.31
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 90.3
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 90.29
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 90.29
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.24
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 90.21
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 90.16
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 90.16
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.13
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 90.13
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 90.12
2ghi_A260 Transport protein; multidrug resistance protein, M 90.1
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 90.09
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 90.08
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 90.07
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 90.06
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.05
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 90.04
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 90.03
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 90.02
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.01
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 89.99
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 89.98
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 89.97
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 89.89
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 89.87
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.87
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 89.85
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 89.84
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 89.82
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 89.79
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 89.74
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 89.71
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 89.71
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 89.65
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 89.62
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 89.6
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.53
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 89.47
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 89.47
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 89.39
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 89.39
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 89.38
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 89.34
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 89.31
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 89.27
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 89.27
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.23
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 89.22
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 89.18
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 89.13
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 89.11
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-48  Score=437.99  Aligned_cols=360  Identities=24%  Similarity=0.336  Sum_probs=248.1

Q ss_pred             hcCCCCCcccccCcHHHHHHHHHHHHCcCCCcccc--------ceeEEecCCCCChHHHHHHHHHHhCCeEEEEecCccc
Q psy16204        213 QNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPEFF--------KEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLT  284 (577)
Q Consensus       213 ~~~~~v~~~dIiG~~~ak~~L~e~l~~pl~~~~~~--------k~ILL~GPpGtGKT~LAkaLA~el~~~fv~v~~s~l~  284 (577)
                      ...+.+.|+||+|++++++.|++.+.+|+.+|+++        +|||||||||||||+|||+||++++++|+.++++++.
T Consensus       196 ~~~~~v~~~dIgGl~~~~~~l~e~v~~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l~  275 (806)
T 3cf2_A          196 ESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIM  275 (806)
T ss_dssp             CCSSSCCGGGCCSCCTTHHHHHHHHHHHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHHH
T ss_pred             ccCCCCChhhhcCHHHHHHHHHHHHHHHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHhh
Confidence            34678999999999999999999999999988765        6899999999999999999999999999999999999


Q ss_pred             cccccchHHHHHHHHHHhhhh------------------------------------hccccCcceee------------
Q psy16204        285 SKYRGESEKLVRLLFEMVSFL------------------------------------VGLHSNKTFYL------------  316 (577)
Q Consensus       285 ~k~~G~~e~~vr~lF~~a~~~------------------------------------~~~~~~~~~~~------------  316 (577)
                      ++|.|++++.++.+|+.|...                                    .+...+..|++            
T Consensus       276 sk~~gese~~lr~lF~~A~~~~PsIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~LD~  355 (806)
T 3cf2_A          276 SKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDP  355 (806)
T ss_dssp             SSCTTHHHHHHHHHHHHHTTSCSEEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTTSCT
T ss_pred             cccchHHHHHHHHHHHHHHHcCCeEEEEehhcccccccCCCCChHHHHHHHHHHHHHhcccccCCEEEEEecCChhhcCH
Confidence            999999999999999854311                                    11111112211            


Q ss_pred             --------------------------------------------------------------------------------
Q psy16204        317 --------------------------------------------------------------------------------  316 (577)
Q Consensus       317 --------------------------------------------------------------------------------  316 (577)
                                                                                                      
T Consensus       356 ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~~~~dvdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~  435 (806)
T 3cf2_A          356 ALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE  435 (806)
T ss_dssp             TTTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSEECTTCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCC
T ss_pred             HHhCCcccceEEecCCCCHHHHHHHHHHHhcCCCCCcccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhcccccccccc
Confidence                                                                                            


Q ss_pred             ---------------------------------ccccCCCCCccchhhHHHHHHHHHhhcccccCCcccccccCCCCccc
Q psy16204        317 ---------------------------------VGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIF  363 (577)
Q Consensus       317 ---------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~  363 (577)
                                                       +..++..|.++.|....+.++.+.+.++-..+..+...+..+|.+++
T Consensus       436 ~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r~~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvL  515 (806)
T 3cf2_A          436 TIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVL  515 (806)
T ss_dssp             CCSHHHHHHCEECTTHHHHHHSSSSCCCCCCCCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSCCCCCSCCE
T ss_pred             ccchhhhccceeeHHHHHHHHHhCCCcccccccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCceEE
Confidence                                             22233456666666777777778888888888888889999999999


Q ss_pred             cccccCCCCCCcchhhhhhhhcccCCCCccc---CCCCcchhhhhhhHHHHHhcCCeEEEEccccccccCCCCC--ChhH
Q psy16204        364 SVMVDGLGKGPWSMVAVVATHFTWGKKGTCQ---SHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSD--SEHE  438 (577)
Q Consensus       364 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~d~~~~~~~~~~~a~~~~p~IIfIDEID~l~~~r~~~--~~~~  438 (577)
                      .|+++||||+..+.+.+.+..+++.......   .++|+.++.++.+|..|+.+.||||||||||.+++.|+..  +.+.
T Consensus       516 l~GPPGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~lF~~Ar~~~P~IifiDEiDsl~~~R~~~~~~~~~  595 (806)
T 3cf2_A          516 FYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGG  595 (806)
T ss_dssp             EESSTTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHHHHHHHHTTCSEEEECSCGGGCC------------
T ss_pred             EecCCCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHHHHHHHHHcCCceeechhhhHHhhccCCCCCCCch
Confidence            9999999999888877888888887777665   5699999999999999999999999999999999998643  3456


Q ss_pred             HHHHHHHHHHHHHhCCCCCcCCCceEEEEEecCCchhhHHHhhcCccccc---------------------------ccC
Q psy16204        439 ASRRFKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVIDV---------------------------NLD  491 (577)
Q Consensus       439 ~~~~v~~~LL~~mD~~~~~~~~~~~VlIIatTN~p~~L~~allrr~~i~~---------------------------~vd  491 (577)
                      ..++++++||.+||++...    .+|+||||||+|+.|+++++|+++++.                           ++|
T Consensus       596 ~~~rv~~~lL~~mdg~~~~----~~V~vi~aTN~p~~lD~AllRpgRfd~~i~v~lPd~~~R~~il~~~l~~~~~~~~~d  671 (806)
T 3cf2_A          596 AADRVINQILTEMDGMSTK----KNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVD  671 (806)
T ss_dssp             --CHHHHHHHHHHHSSCSS----SSEEEECC-CCSSSSCHHHHSTTTSCCEEEC-----CHHHHTTTTTSSCC--CCC--
T ss_pred             HHHHHHHHHHHHHhCCCCC----CCEEEEEeCCCchhCCHhHcCCCcceEEEEECCcCHHHHHHHHHHHhcCCCCCCCCC
Confidence            7789999999999999864    679999999999999999999544432                           458


Q ss_pred             HHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHhcCChhHH--------hhhhccCCCCCCCHHHHHHHHHHhCCCCCHHH
Q psy16204        492 FHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQI--------KEIKQEDIDLPVTEKDFREAIARCRKSVTAHD  563 (577)
Q Consensus       492 l~~LA~~t~G~sgsDI~~l~~~Aa~~airr~~~~~~~~~~--------~~~~~~~~~~~It~~df~~Al~~~~psv~~~~  563 (577)
                      ++.||+.|+||||+||.++|++|++.++|+.+........        ......+....|+++||++|++.++|||++++
T Consensus       672 l~~la~~t~g~SGadi~~l~~~A~~~a~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~df~~al~~~~pSvs~~~  751 (806)
T 3cf2_A          672 LEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDND  751 (806)
T ss_dssp             --------------CHHHHHHHHHHHHHHHHHC-----------------------CCC----CCTTTC-----------
T ss_pred             HHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhccCccccccccccccCccCHHHHHHHHHhCCCCCCHHH
Confidence            9999999999999999999999999999998753211110        01111223457999999999999999999999


Q ss_pred             HHHHHHHHHhhCC
Q psy16204        564 LSKYDSWMNEFGS  576 (577)
Q Consensus       564 ~~~~~~~~~~~~~  576 (577)
                      +.+|++|.++|+.
T Consensus       752 l~~y~~~~~~f~~  764 (806)
T 3cf2_A          752 IRKYEMFAQTLQQ  764 (806)
T ss_dssp             ----CCCC-----
T ss_pred             HHHHHHHHHHHhc
Confidence            9999999998863



>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 577
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-28
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 9e-21
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-27
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-20
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-20
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-15
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 5e-15
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 2e-11
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 3e-11
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 5e-09
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 4e-08
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 0.002
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-05
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-04
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]
 Score =  111 bits (279), Expect = 2e-28
 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 50/185 (27%)

Query: 398 GHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGS--DSEHEASRRFKAELLIQMDGLN 455
           G      ++    A+ +AP  +FIDE+D++   RGS     ++   +   +LL++MDG  
Sbjct: 84  GVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRGSGVGGGNDEREQTLNQLLVEMDGFE 143

Query: 456 SSLYEDKIIMILAATNHP---------------------------YQLLTLCLEGVVIDV 488
                D  I+++AATN P                            Q+L +   G  +  
Sbjct: 144 K----DTAIVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAE 199

Query: 489 NLDFHKISKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDF 548
           ++D   ++K   G+ G+D+ NL  +AA+++ R                      +T KD 
Sbjct: 200 DVDLALLAKRTPGFVGADLENLLNEAALLAAREGRR-----------------KITMKDL 242

Query: 549 REAIA 553
            EA +
Sbjct: 243 EEAAS 247


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.89
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.89
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.86
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.83
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.8
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.78
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.74
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.66
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.65
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.63
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.61
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.61
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.52
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.52
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.47
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.43
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.42
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.4
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.3
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.27
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.24
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.15
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.12
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.12
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.95
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.78
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.71
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.47
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.27
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.18
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.12
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.95
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.86
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.85
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.78
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.76
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.69
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.67
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.56
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.56
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.56
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.5
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.49
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.46
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.42
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.35
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.34
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.34
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.3
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.29
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.29
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.26
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.22
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.21
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.19
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.18
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.17
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.15
d2qy9a2211 GTPase domain of the signal recognition particle r 97.1
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.07
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.04
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.91
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.87
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.83
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.83
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.81
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.77
d1okkd2207 GTPase domain of the signal recognition particle r 96.71
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.65
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.59
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.53
d1vmaa2213 GTPase domain of the signal recognition particle r 96.52
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.49
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.48
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.45
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.35
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.32
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.3
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.28
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.28
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.28
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.28
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.25
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.18
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.16
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.15
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.13
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.05
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.04
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.01
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.98
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.95
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.93
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.89
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.75
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.73
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.72
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.66
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.61
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.54
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.47
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.43
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.39
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.21
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.2
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.12
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.06
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.04
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.9
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.84
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.79
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.72
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.69
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.61
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.61
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.54
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.12
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.02
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.0
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.81
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.8
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.76
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.75
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.66
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.46
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.38
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.33
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.33
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.33
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.2
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.14
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.95
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.95
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.73
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.72
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.62
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.58
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.56
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.54
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.48
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.44
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.4
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.39
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.38
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.37
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.37
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.23
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.2
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.11
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.06
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.05
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.02
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.01
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.01
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.95
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.79
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.77
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.73
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.73
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.73
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.71
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.65
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.59
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.59
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.58
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.53
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.53
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.5
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.48
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.32
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.29
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.27
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.26
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 91.25
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.19
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.15
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.07
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.06
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.0
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.92
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.91
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 90.82
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.75
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.74
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.73
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.71
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 90.63
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.55
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.49
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.47
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.39
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.38
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 90.12
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.04
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.04
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.85
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.76
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.7
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.66
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 89.64
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.47
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.39
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.38
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 89.32
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.3
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 89.27
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 89.24
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 88.79
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.79
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.5
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 88.46
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.14
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.06
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.03
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.99
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 87.88
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.82
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 87.51
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.48
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 87.33
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.27
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.13
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 87.02
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.73
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 86.73
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.47
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 85.4
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.22
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.03
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 84.68
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 84.56
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 83.04
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 82.99
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 82.98
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 82.16
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2e-37  Score=306.65  Aligned_cols=213  Identities=32%  Similarity=0.467  Sum_probs=184.0

Q ss_pred             hcCCCCCcccccCcHHHHHHHHHHHHCcCCCcc--------ccceeEEecCCCCChHHHHHHHHHHhCCeEEEEecCccc
Q psy16204        213 QNNPNVQWNKVAGLTEAKAILQEAMVLPTIMPE--------FFKEALERHSHGTGKTMLAKAVATECGTTFFNVSSSTLT  284 (577)
Q Consensus       213 ~~~~~v~~~dIiG~~~ak~~L~e~l~~pl~~~~--------~~k~ILL~GPpGtGKT~LAkaLA~el~~~fv~v~~s~l~  284 (577)
                      .+.++++|+||+|++++|+.|.+.+.+ +.+++        .++++|||||||||||++|++||++++.++++++++++.
T Consensus         4 ~~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~   82 (256)
T d1lv7a_           4 EDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV   82 (256)
T ss_dssp             ECSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSST
T ss_pred             CCCCCCCHHHHhchHHHHHHHHHHHHH-HHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhh
Confidence            467789999999999999999987754 33333        247899999999999999999999999999999999999


Q ss_pred             cccccchHHHHHHHHHHhhhhhccccCcceeeccccCCCCCccchhhHHHHHHHHHhhcccccCCcccccccCCCCcccc
Q psy16204        285 SKYRGESEKLVRLLFEMVSFLVGLHSNKTFYLVGVLNGEPTTTFAYNKQILQMNRRVLKGALTTAPTRAENQESGPSIFS  364 (577)
Q Consensus       285 ~k~~G~~e~~vr~lF~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  364 (577)
                      ++|+|++++.++.+|+.                                                               
T Consensus        83 ~~~~g~~~~~l~~~f~~---------------------------------------------------------------   99 (256)
T d1lv7a_          83 EMFVGVGASRVRDMFEQ---------------------------------------------------------------   99 (256)
T ss_dssp             TSCCCCCHHHHHHHHHH---------------------------------------------------------------
T ss_pred             hcchhHHHHHHHHHHHH---------------------------------------------------------------
Confidence            99999999999999987                                                               


Q ss_pred             ccccCCCCCCcchhhhhhhhcccCCCCcccCCCCcchhhhhhhHHHHHhcCCeEEEEccccccccCCCCCC--hhHHHHH
Q psy16204        365 VMVDGLGKGPWSMVAVVATHFTWGKKGTCQSHEGHSGRINKNSLFQARCYAPSTIFIDEVDSLCSMRGSDS--EHEASRR  442 (577)
Q Consensus       365 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~a~~~~p~IIfIDEID~l~~~r~~~~--~~~~~~~  442 (577)
                                                                    |+.+.||||||||||.+++.|+.+.  .+....+
T Consensus       100 ----------------------------------------------A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~  133 (256)
T d1lv7a_         100 ----------------------------------------------AKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQ  133 (256)
T ss_dssp             ----------------------------------------------HHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHH
T ss_pred             ----------------------------------------------HHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHH
Confidence                                                          8889999999999999999875443  3456678


Q ss_pred             HHHHHHHHHhCCCCCcCCCceEEEEEecCCchhhHHHhhcCcccc---------------------------cccCHHHH
Q psy16204        443 FKAELLIQMDGLNSSLYEDKIIMILAATNHPYQLLTLCLEGVVID---------------------------VNLDFHKI  495 (577)
Q Consensus       443 v~~~LL~~mD~~~~~~~~~~~VlIIatTN~p~~L~~allrr~~i~---------------------------~~vdl~~L  495 (577)
                      +++.||..||++..+    .+|+||||||+|+.|+++++|+.+++                           .++++..|
T Consensus       134 ~~~~ll~~~d~~~~~----~~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~l  209 (256)
T d1lv7a_         134 TLNQMLVEMDGFEGN----EGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAII  209 (256)
T ss_dssp             HHHHHHHHHHTCCSS----SCEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHH
T ss_pred             HHHHHHHHhhCCCCC----CCEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHHH
Confidence            999999999998754    67999999999999999998743332                           24589999


Q ss_pred             HHHcCCCCHHHHHHHHHHHHHHHHHHHHhcCChhHHhhhhccCCCCCCCHHHHHHHHHHhC
Q psy16204        496 SKMLEGYTGSDIANLARDAAMMSIRRKIMGQTPAQIKEIKQEDIDLPVTEKDFREAIARCR  556 (577)
Q Consensus       496 A~~t~G~sgsDI~~l~~~Aa~~airr~~~~~~~~~~~~~~~~~~~~~It~~df~~Al~~~~  556 (577)
                      |+.|+||+++||.++|++|++.++|+..                 ..|+.+||++|++++-
T Consensus       210 a~~t~G~s~adi~~l~~~A~~~a~~~~~-----------------~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         210 ARGTPGFSGADLANLVNEAALFAARGNK-----------------RVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             HHTCTTCCHHHHHHHHHHHHHHHHHTTC-----------------SSBCHHHHHHHHHHHT
T ss_pred             HHhCCCCCHHHHHHHHHHHHHHHHHcCC-----------------CccCHHHHHHHHHHHh
Confidence            9999999999999999999999987642                 4699999999999863



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure