Psyllid ID: psy16532


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MTSCDQETQFVSNCSDHENDETCRKKRCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD
ccccccccEEcccccccccHHHHHHHHHccccccccEEEcccccEEcEEEEEEccccEEccccccccccccEEEcccccccccc
ccccccccEEEEccccccccHHHHHcccccccccHHHHHccccccEEEEEEEcccccEEEEcccccccccEEEEEccccccccc
mtscdqetqfvsncsdhendetcrkkrctdrydssessdrtddlkfgtLVGVDKlgnkyyenkhyfygrnrWVVYHEKFGLNYD
mtscdqetqfvsncsdhendetcrkkrctdrydssessdrtddlkfgtlvgvdklgnkyyenkhyfygrnrWVVYHEKFGLNYD
MTSCDQETQFVSNCSDHENDETCRKKRCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD
*******************************************LKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGL***
*************C******ETCRKKRCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD
*****************************************DDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD
*******TQFVSNCSDHENDETCRKKRCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSCDQETQFVSNCSDHENDETCRKKRCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q54MV7138 NADH dehydrogenase [ubiqu yes N/A 0.416 0.253 0.714 7e-09
Q0MQ86145 NADH dehydrogenase [ubiqu N/A N/A 0.428 0.248 0.694 1e-07
Q0MQ87145 NADH dehydrogenase [ubiqu yes N/A 0.428 0.248 0.694 2e-07
Q9UI09145 NADH dehydrogenase [ubiqu yes N/A 0.428 0.248 0.694 2e-07
Q0MQ85145 NADH dehydrogenase [ubiqu N/A N/A 0.428 0.248 0.694 2e-07
Q9N2W7146 Probable NADH dehydrogena yes N/A 0.511 0.294 0.558 3e-07
Q7TMF3145 NADH dehydrogenase [ubiqu yes N/A 0.428 0.248 0.611 3e-07
O97725145 NADH dehydrogenase [ubiqu yes N/A 0.428 0.248 0.611 7e-07
>sp|Q54MV7|NDUAC_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Dictyostelium discoideum GN=ndufa12 PE=2 SV=2 Back     alignment and function desciption
 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (85%)

Query: 41 TDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVY 75
          T +LKFGTLVGVDK+GN+YYEN+   YGR+RWV Y
Sbjct: 26 TGELKFGTLVGVDKVGNRYYENRQEIYGRHRWVEY 60




Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Dictyostelium discoideum (taxid: 44689)
>sp|Q0MQ86|NDUAC_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Gorilla gorilla gorilla GN=NDUFA12 PE=2 SV=1 Back     alignment and function description
>sp|Q0MQ87|NDUAC_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Pan troglodytes GN=NDUFA12 PE=2 SV=1 Back     alignment and function description
>sp|Q9UI09|NDUAC_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens GN=NDUFA12 PE=1 SV=1 Back     alignment and function description
>sp|Q0MQ85|NDUAC_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Pongo pygmaeus GN=NDUFA12 PE=2 SV=1 Back     alignment and function description
>sp|Q9N2W7|NDUAC_CAEEL Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Caenorhabditis elegans GN=Y94H6A.8 PE=3 SV=2 Back     alignment and function description
>sp|Q7TMF3|NDUAC_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Mus musculus GN=Ndufa12 PE=1 SV=2 Back     alignment and function description
>sp|O97725|NDUAC_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Bos taurus GN=NDUFA12 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
56756378136 SJCHGC08585 protein [Schistosoma japonic 0.535 0.330 0.711 3e-11
242007248141 NADH-ubiquinone oxidoreductase subunit B 0.547 0.326 0.673 4e-11
332017162142 Putative NADH dehydrogenase [ubiquinone] 0.535 0.316 0.688 1e-10
383861823139 PREDICTED: probable NADH dehydrogenase [ 0.535 0.323 0.711 2e-10
307204005133 NADH dehydrogenase [ubiquinone] 1 alpha 0.630 0.398 0.566 3e-10
322784947140 hypothetical protein SINV_07082 [Solenop 0.535 0.321 0.666 3e-10
256086393136 NADH-ubiquinone oxidoreductase [Schistos 0.535 0.330 0.644 4e-10
442756971140 Putative nadh:ubiquinone oxidoreductase 0.559 0.335 0.659 5e-10
195437282141 GK24493 [Drosophila willistoni] gi|19416 0.535 0.319 0.622 9e-10
241106593140 NADH:ubiquinone oxidoreductase, putative 0.559 0.335 0.638 1e-09
>gi|56756378|gb|AAW26362.1| SJCHGC08585 protein [Schistosoma japonicum] gi|226467670|emb|CAX69711.1| NADH dehydrogenase [Schistosoma japonicum] gi|226481527|emb|CAX73661.1| NADH dehydrogenase [Schistosoma japonicum] Back     alignment and taxonomy information
 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%)

Query: 40 RTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD 84
          RTDDLK+G LVG DK GNKYYEN  YF GRNRWVVY  +FG +Y+
Sbjct: 29 RTDDLKWGNLVGTDKFGNKYYENNKYFVGRNRWVVYSNRFGWDYE 73




Source: Schistosoma japonicum

Species: Schistosoma japonicum

Genus: Schistosoma

Family: Schistosomatidae

Order: Strigeidida

Class: Trematoda

Phylum: Platyhelminthes

Superkingdom: Eukaryota

>gi|242007248|ref|XP_002424454.1| NADH-ubiquinone oxidoreductase subunit B17.2, putative [Pediculus humanus corporis] gi|212507854|gb|EEB11716.1| NADH-ubiquinone oxidoreductase subunit B17.2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332017162|gb|EGI57961.1| Putative NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383861823|ref|XP_003706384.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307204005|gb|EFN82909.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322784947|gb|EFZ11718.1| hypothetical protein SINV_07082 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|256086393|ref|XP_002579384.1| NADH-ubiquinone oxidoreductase [Schistosoma mansoni] gi|350645231|emb|CCD60060.1| NADH-ubiquinone oxidoreductase subunit B17.2,putative [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|442756971|gb|JAA70644.1| Putative nadh:ubiquinone oxidoreductase b17.2 subunit [Ixodes ricinus] Back     alignment and taxonomy information
>gi|195437282|ref|XP_002066569.1| GK24493 [Drosophila willistoni] gi|194162654|gb|EDW77555.1| GK24493 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|241106593|ref|XP_002410063.1| NADH:ubiquinone oxidoreductase, putative [Ixodes scapularis] gi|215492875|gb|EEC02516.1| NADH:ubiquinone oxidoreductase, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
FB|FBgn0031436142 CG3214 [Drosophila melanogaste 0.535 0.316 0.622 5.6e-13
UNIPROTKB|F1NW95149 NDUFA12 "Uncharacterized prote 0.511 0.288 0.681 7.4e-11
DICTYBASE|DDB_G0285783138 ndufa12 "NADH dehydrogenase ub 0.416 0.253 0.714 3.2e-10
UNIPROTKB|F8VRD899 NDUFA12 "NADH dehydrogenase [u 0.428 0.363 0.694 1.1e-09
UNIPROTKB|Q9UI09145 NDUFA12 "NADH dehydrogenase [u 0.428 0.248 0.694 1.1e-09
UNIPROTKB|F1PWZ9145 NDUFA12 "Uncharacterized prote 0.428 0.248 0.638 1.8e-09
MGI|MGI:1913664145 Ndufa12 "NADH dehydrogenase (u 0.428 0.248 0.611 3.6e-09
RGD|1311462148 Ndufa12 "NADH dehydrogenase (u 0.428 0.243 0.611 3.6e-09
UNIPROTKB|O97725145 NDUFA12 "NADH dehydrogenase [u 0.428 0.248 0.611 5.9e-09
UNIPROTKB|F1SQP4147 NDUFA12 "Uncharacterized prote 0.428 0.244 0.611 5.9e-09
FB|FBgn0031436 CG3214 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 28/45 (62%), Positives = 35/45 (77%)

Query:    40 RTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD 84
             R DDLK GTLVG+DK GNKY+EN +YFYGRNRW+ +     ++YD
Sbjct:    32 RNDDLKIGTLVGIDKYGNKYFENPYYFYGRNRWIEFAPHVNMDYD 76




GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=ISS
GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISS
GO:0006120 "mitochondrial electron transport, NADH to ubiquinone" evidence=ISS
GO:0003954 "NADH dehydrogenase activity" evidence=ISS
GO:0009055 "electron carrier activity" evidence=IEA
UNIPROTKB|F1NW95 NDUFA12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285783 ndufa12 "NADH dehydrogenase ubiquinone 1 alpha subcomplex subunit 12" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F8VRD8 NDUFA12 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UI09 NDUFA12 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWZ9 NDUFA12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913664 Ndufa12 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311462 Ndufa12 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O97725 NDUFA12 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQP4 NDUFA12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9N2W7NDUAC_CAEELNo assigned EC number0.55810.51190.2945yesN/A
O97725NDUAC_BOVINNo assigned EC number0.61110.42850.2482yesN/A
Q9UI09NDUAC_HUMANNo assigned EC number0.69440.42850.2482yesN/A
Q7TMF3NDUAC_MOUSENo assigned EC number0.61110.42850.2482yesN/A
Q54MV7NDUAC_DICDINo assigned EC number0.71420.41660.2536yesN/A
Q0MQ87NDUAC_PANTRNo assigned EC number0.69440.42850.2482yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
pfam05071100 pfam05071, NDUFA12, NADH ubiquinone oxidoreductase 2e-14
PLN03095115 PLN03095, PLN03095, NADH:ubiquinone oxidoreductase 4e-11
PLN02732159 PLN02732, PLN02732, Probable NADH dehydrogenase [u 4e-08
PRK08183133 PRK08183, PRK08183, NADH dehydrogenase; Validated 3e-06
>gnl|CDD|218414 pfam05071, NDUFA12, NADH ubiquinone oxidoreductase subunit NDUFA12 Back     alignment and domain information
 Score = 62.3 bits (152), Expect = 2e-14
 Identities = 21/33 (63%), Positives = 24/33 (72%)

Query: 47 GTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKF 79
          GTLVG D+ GNKYYENK    GR RWV+Y+ K 
Sbjct: 1  GTLVGEDEFGNKYYENKDELGGRRRWVIYNGKA 33


This family contains the 17.2 kD subunit of complex I (NDUFA12) and its homologues. The family also contains a second related eukaryotic protein of unknown function, . Length = 100

>gnl|CDD|215571 PLN03095, PLN03095, NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional Back     alignment and domain information
>gnl|CDD|215389 PLN02732, PLN02732, Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit Back     alignment and domain information
>gnl|CDD|236176 PRK08183, PRK08183, NADH dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
KOG3382|consensus151 99.73
PLN02732159 Probable NADH dehydrogenase [ubiquinone] 1 alpha s 99.66
PLN03095115 NADH:ubiquinone oxidoreductase 18 kDa subunit; Pro 99.61
PRK0663099 hypothetical protein; Provisional 99.56
PRK08183133 NADH dehydrogenase; Validated 99.54
PF05071105 NDUFA12: NADH ubiquinone oxidoreductase subunit ND 99.43
COG3761118 NADH:ubiquinone oxidoreductase 17.2 kD subunit [En 99.14
PF1561338 WHIM2: WSTF, HB1, Itc1p, MBD9 motif 2 93.84
>KOG3382|consensus Back     alignment and domain information
Probab=99.73  E-value=1.4e-18  Score=125.62  Aligned_cols=58  Identities=55%  Similarity=0.898  Sum_probs=54.9

Q ss_pred             cccchhHHHhhhhccCccccceEEeecCCCCEEeeeCCCCCCcccEEEeCCccccccC
Q psy16532         27 RCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD   84 (84)
Q Consensus        27 ~c~~~~~~~~~L~r~~t~k~G~lVG~D~fGNKYYE~~~~~~GRrRWViY~~~~~~~Yd   84 (84)
                      .=||-+.++..|++..+.+.|+|||+|.|||||||++.++.||+|||+|+.+.+|+||
T Consensus        27 e~Gglr~~~~k~yrtd~~kiGTLVG~DkfGNkYyen~~~fygRhRWVeya~kv~~Dyd   84 (151)
T KOG3382|consen   27 EEGGLRCLLDKLYRTDDHKIGTLVGVDKFGNKYYENNDYFYGRHRWVEYASKVNWDYD   84 (151)
T ss_pred             hhccHHHHHHHHHhcccccceeeeeecccccchhcccceecccceeEEeccccccccc
Confidence            3478889999999999999999999999999999999989999999999999999997



>PLN02732 Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit Back     alignment and domain information
>PLN03095 NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional Back     alignment and domain information
>PRK06630 hypothetical protein; Provisional Back     alignment and domain information
>PRK08183 NADH dehydrogenase; Validated Back     alignment and domain information
>PF05071 NDUFA12: NADH ubiquinone oxidoreductase subunit NDUFA12; InterPro: IPR007763 NADH:ubiquinone oxidoreductase (complex I) (1 Back     alignment and domain information
>COG3761 NADH:ubiquinone oxidoreductase 17 Back     alignment and domain information
>PF15613 WHIM2: WSTF, HB1, Itc1p, MBD9 motif 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00