Psyllid ID: psy16818


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---
MFKKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTTKQTKAAKPQVEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDIKTMAKDSDSDSDEKSHDSSQKTTQSQDISQKVLELNKKLNQAREQQLIDKLADSYPIRRAAQWVVYFTNKSKQLTEDTIKENLSKQNVDKLGEKLEAYLKNIRDQLEKKLKQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccccccccccccEccHHccccccccEEccccccccccccccccccccccccEEEEEcccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHccccccccEcccHHHHHHccccccccccccccccccccccccccEEEEEEEccccccHHcHHHccccccccccHHcccccHHcccccEcHHHHccccccccccccHHHHccccEEEEEcccccccEEEcccccccHHHHHHHHccccccEEccccccccccHHHHHHHHHHHHHHHHHHHccccccccHccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEcccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHcc
mfkkrqvkqntrkrqndsesesedETQIVRKEkkiredpnfqkttkqtkaakpqvedsesdesscqvgvsyksrkssardgpsdmgatATLEIETETDKDAQAIYEKSLKINAelkgkeddkVYRGLANYAQYFekkdtaqgnaasgfvrkgpirapanvrstvrwdyqpdickdyketgfcgfgdsckflhdrtdykygwqleqehedgdnknyeipdsdeedhlpfkcyicrnsfkdpvmtkckhyfctkcalehfkktpkcyicqkntfgefRTAEKIVQKLKDagdiktmakdsdsdsdekshdssqkttqsQDISQKVLELNKKLNQAREQQLIDKLadsypirraAQWVVYFTNKSKQLTEDTIKENLSKQNVDKLGEKLEAYLKNIRDQLEKKLKQ
mfkkrqvkqntrkrqndsesesedetqivrkekkiredpnfqkttkqtkaakpqvedsesdesscqvgvsyksrkssardgpsdmGATATleietetdkdaqAIYEKSLKinaelkgkeddkvYRGLANYAQYfekkdtaqgnaasgfvrkgpirapanvrstvrwdYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKlkdagdiktmakdsdsdsdekshdssqkttqsqdiSQKVLELNKKLNQAREQQLIDKLADSYPIRRAAQWVVYFTNKSkqltedtikenlskqnvdKLGEKLEAYLKNIRDqlekklkq
MFKKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFqkttkqtkaakPQVEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDIKTMAKdsdsdsdekshdssQKTTQSQDISQKVLELNKKLNQAREQQLIDKLADSYPIRRAAQWVVYFTNKSKQLTEDTIKENLSKQNVDKLGEKLEAYLKNIRDQLEKKLKQ
**************************************************************************************************************I*********DKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQL**********************LPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKL****************************************************LIDKLADSYPIRRAAQWVVYFTNK******************************************
MFKK**************************************************************************************LEIETET******************************AN***************************PANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFL************************EIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKL******************************************KKLNQAREQQLIDKLADSYPI*************************LSKQNVDKLGEKLEAYLKNIRDQ*E*****
***************************IVRKEKKIREDPNFQ*******************************************GATATLEIETETDKDAQAIYEKSLKINAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDI****************************SQKVLELNKKLNQAREQQLIDKLADSYPIRRAAQWVVYFTNKSKQLTEDTIKENLSKQNVDKLGEKLEAYLKNIRDQLEKKLKQ
*****************************************************************QVG***KSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDKVYRGLANYAQYFEKKD************KGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDG*******PDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDI************************************KKLNQAREQQLIDKLADSYPIRRAAQWVVYFTNK**********ENLS***VDKLGEKLEAYLKNIRDQLEKKL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTTKQTKAAKPQVEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDIKTMAKDSDSDSDEKSHDSSQKTTQxxxxxxxxxxxxxxxxxxxxxQLIDKLADSYPIRRAAQWVVYFTNKSKQLTEDTIKENLSKQNxxxxxxxxxxxxxxxxxxxxxKLKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query403 2.2.26 [Sep-21-2011]
O15541343 RING finger protein 113A yes N/A 0.744 0.874 0.512 3e-89
Q67ER4343 RING finger protein 113A yes N/A 0.741 0.871 0.517 5e-86
Q8IZP6322 RING finger protein 113B no N/A 0.694 0.869 0.466 5e-76
O17917384 RING finger protein 113 h yes N/A 0.667 0.700 0.468 8e-64
Q9FNG6378 Zinc finger CCCH domain-c yes N/A 0.669 0.714 0.408 2e-54
Q8GX84343 Zinc finger CCCH domain-c no N/A 0.684 0.804 0.416 4e-54
Q6K4V3326 Zinc finger CCCH domain-c yes N/A 0.498 0.616 0.478 7e-51
Q4P400355 Pre-mRNA-splicing factor N/A N/A 0.401 0.456 0.473 5e-46
P0CQ64329 Pre-mRNA-splicing factor yes N/A 0.446 0.547 0.460 1e-40
P0CQ65329 Pre-mRNA-splicing factor N/A N/A 0.446 0.547 0.460 1e-40
>sp|O15541|R113A_HUMAN RING finger protein 113A OS=Homo sapiens GN=RNF113A PE=1 SV=1 Back     alignment and function desciption
 Score =  329 bits (843), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 224/324 (69%), Gaps = 24/324 (7%)

Query: 1   MFKK--RQVKQNTRKRQ------NDSESESEDETQIVRKEKK-IREDPNFQKT---TKQT 48
           +FKK  R+     RKR        +S S S++   +VR EKK +  +P  QKT    KQ 
Sbjct: 18  LFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQK 77

Query: 49  KAAKPQVEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKS 108
            A      + E +     +GV YKS +S+   GP DMGATA  E++TE ++DAQAI+E+S
Sbjct: 78  AAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERS 137

Query: 109 LKINAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDY 168
            KI  EL+GKEDDK+YRG+ NY +Y + KDT+ GNA+SG VRKGPIRAP ++R+TVRWDY
Sbjct: 138 QKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDY 197

Query: 169 QPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDG-----DNKNYEIPDSDEE 223
           QPDICKDYKETGFCGFGDSCKFLHDR+DYK+GWQ+E+E ++G     +++NYE+   DEE
Sbjct: 198 QPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEE 257

Query: 224 DHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQ 283
             +PFKC+ICR SF++PV+TKC+HYFC  CAL+HF+ TP+CY+C + T G F  A++++ 
Sbjct: 258 --IPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIA 315

Query: 284 KLK-----DAGDIKTMAKDSDSDS 302
           KL+       G    + +D D D+
Sbjct: 316 KLEKHRATGEGGASDLPEDPDEDA 339





Homo sapiens (taxid: 9606)
>sp|Q67ER4|R113A_BOVIN RING finger protein 113A OS=Bos taurus GN=RNF113A PE=2 SV=1 Back     alignment and function description
>sp|Q8IZP6|R113B_HUMAN RING finger protein 113B OS=Homo sapiens GN=RNF113B PE=1 SV=3 Back     alignment and function description
>sp|O17917|RN113_CAEEL RING finger protein 113 homolog OS=Caenorhabditis elegans GN=rnf-113 PE=2 SV=2 Back     alignment and function description
>sp|Q9FNG6|C3H51_ARATH Zinc finger CCCH domain-containing protein 51 OS=Arabidopsis thaliana GN=At5g06420 PE=2 SV=1 Back     alignment and function description
>sp|Q8GX84|C3H1_ARATH Zinc finger CCCH domain-containing protein 1 OS=Arabidopsis thaliana GN=At1g01350 PE=2 SV=2 Back     alignment and function description
>sp|Q6K4V3|C3H15_ORYSJ Zinc finger CCCH domain-containing protein 15 OS=Oryza sativa subsp. japonica GN=Os02g0301000 PE=2 SV=1 Back     alignment and function description
>sp|Q4P400|CWC24_USTMA Pre-mRNA-splicing factor CWC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC24 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ64|CWC24_CRYNJ Pre-mRNA-splicing factor CWC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC24 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ65|CWC24_CRYNB Pre-mRNA-splicing factor CWC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC24 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
193676506311 PREDICTED: RING finger protein 113A-like 0.741 0.961 0.612 1e-104
239790174311 ACYPI006184 [Acyrthosiphon pisum] 0.741 0.961 0.596 1e-100
340724628325 PREDICTED: RING finger protein 113A-like 0.734 0.910 0.605 1e-99
350397659325 PREDICTED: RING finger protein 113A-like 0.734 0.910 0.601 2e-99
307195659324 RING finger protein 113A [Harpegnathos s 0.739 0.919 0.595 1e-98
91086881327 PREDICTED: similar to AGAP007068-PA [Tri 0.736 0.908 0.594 1e-98
380022343325 PREDICTED: RING finger protein 113A-like 0.697 0.864 0.603 2e-97
332017630325 RING finger protein 113A [Acromyrmex ech 0.739 0.916 0.590 3e-97
170037220321 RING finger protein 113A [Culex quinquef 0.734 0.922 0.567 5e-97
157123920317 zinc finger protein, putative [Aedes aeg 0.699 0.889 0.593 1e-95
>gi|193676506|ref|XP_001943511.1| PREDICTED: RING finger protein 113A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 233/310 (75%), Gaps = 11/310 (3%)

Query: 2   FKKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTT--KQTKAAKPQVEDSE 59
           FKKR+V QN R+R       S++E+ +V  EK+ ++   F ++T  K+ KA+ P  + SE
Sbjct: 5   FKKRKVVQNRRRRAASDSENSDEESAVVLNEKRNKKSSPFIQSTSNKKLKASGPIHDSSE 64

Query: 60  SDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKE 119
           SD  S  VGVSY+S+  +   GP DMGATAT+EI+TE DKDAQAIYE+SL++N ELKGKE
Sbjct: 65  SDNES--VGVSYRSKMDTDMSGPKDMGATATIEIDTELDKDAQAIYERSLQVNKELKGKE 122

Query: 120 DDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKET 179
           DDKVYRGLANY QY+EKKDTA GNA+SG VRKGPIRAPAN+RSTVRWDYQPDICKDYKET
Sbjct: 123 DDKVYRGLANYTQYYEKKDTALGNASSGMVRKGPIRAPANLRSTVRWDYQPDICKDYKET 182

Query: 180 GFCGFGDSCKFLHDRTDYKYGWQLEQE------HEDGDNKNYEIPDSDEEDHLPFKCYIC 233
           GFCGFGDSCKFLHDR+DYK+GWQLE E       +D D   YEI ++D +D+LPFKC IC
Sbjct: 183 GFCGFGDSCKFLHDRSDYKFGWQLEMESTQQGDSDDDDPSKYEIKEND-DDYLPFKCLIC 241

Query: 234 RNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDIKT 293
           R S+ +PVMTKCKHYFC KCAL HFKK+ KC++C+K T G F  A  I+++L  A     
Sbjct: 242 RGSYVNPVMTKCKHYFCEKCALAHFKKSTKCFVCEKQTGGFFDPATTIIERLNAANTDII 301

Query: 294 MAKDSDSDSD 303
              +SD +SD
Sbjct: 302 HQCNSDEESD 311




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|239790174|dbj|BAH71664.1| ACYPI006184 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340724628|ref|XP_003400683.1| PREDICTED: RING finger protein 113A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350397659|ref|XP_003484946.1| PREDICTED: RING finger protein 113A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307195659|gb|EFN77501.1| RING finger protein 113A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91086881|ref|XP_970132.1| PREDICTED: similar to AGAP007068-PA [Tribolium castaneum] gi|270010474|gb|EFA06922.1| hypothetical protein TcasGA2_TC009871 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380022343|ref|XP_003695009.1| PREDICTED: RING finger protein 113A-like [Apis florea] Back     alignment and taxonomy information
>gi|332017630|gb|EGI58327.1| RING finger protein 113A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|170037220|ref|XP_001846457.1| RING finger protein 113A [Culex quinquefasciatus] gi|167880291|gb|EDS43674.1| RING finger protein 113A [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157123920|ref|XP_001653974.1| zinc finger protein, putative [Aedes aegypti] gi|108882876|gb|EAT47101.1| AAEL001778-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
UNIPROTKB|Q67ER3328 RNF113A "Zinc finger protein 1 0.712 0.875 0.559 8.3e-90
ZFIN|ZDB-GENE-040825-1321 rnf113a "ring finger protein 1 0.712 0.894 0.538 1.6e-86
UNIPROTKB|F1RUA4344 LOC100514886 "Uncharacterized 0.704 0.825 0.519 7.2e-84
UNIPROTKB|O15541343 RNF113A "RING finger protein 1 0.704 0.827 0.518 1.2e-83
FB|FBgn0038772357 CG4973 [Drosophila melanogaste 0.702 0.792 0.532 1.5e-83
UNIPROTKB|Q67ER4343 RNF113A "RING finger protein 1 0.704 0.827 0.518 1.5e-83
UNIPROTKB|E2RE92348 LOC100855580 "Uncharacterized 0.665 0.770 0.533 1.5e-83
UNIPROTKB|Q5PPN1341 Rnf113a1 "Ring finger protein 0.702 0.829 0.52 6.4e-83
UNIPROTKB|E1BF77351 LOC518027 "Uncharacterized pro 0.662 0.760 0.521 1e-77
UNIPROTKB|E2RGA7350 LOC480186 "Uncharacterized pro 0.575 0.662 0.545 8.4e-74
UNIPROTKB|Q67ER3 RNF113A "Zinc finger protein 183" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 896 (320.5 bits), Expect = 8.3e-90, P = 8.3e-90
 Identities = 170/304 (55%), Positives = 226/304 (74%)

Query:     1 MFKKRQVK--QNTRKR-QNDSESES--EDETQIVRKEKKIREDPN-FXXXXXXXXXXXPQ 54
             +FKKR +   +  RKR  +D E ES  E+ + +VRKE++ RE PN             P 
Sbjct:    11 VFKKRGLAAGRGRRKRPSSDQEQESSGEEGSTVVRKERR-RETPNPMIQKTRRCTKERPS 69

Query:    55 --VEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKIN 112
               +  S+ D+ S ++GV+YKS +S+   GP DMGATA  E++TE DKDAQAI+E+S KI 
Sbjct:    70 YALSSSDDDDPSKEIGVTYKSTRSAKPVGPEDMGATAVYELDTEKDKDAQAIFERSQKIQ 129

Query:   113 AELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDI 172
              EL+GKEDDK+YRG+ NY +Y + KDT+ GNA+SG VRKGPIRAP ++R+TVRWDYQPDI
Sbjct:   130 EELRGKEDDKIYRGINNYQKYVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDI 189

Query:   173 CKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDG-----DNKNYEIPDSDEEDHLP 227
             CKDYKETGFCGFGDSCKFLHDR+DYK+GWQ+E+E ++G     D +NYE+  SDEED +P
Sbjct:   190 CKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVNDEENYEV-SSDEED-MP 247

Query:   228 FKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKL-K 286
             FKC+ICR+SFK+PV+TKC+HYFC  CAL+H++K+ +CY+C K T G F  A++++ KL K
Sbjct:   248 FKCFICRSSFKNPVVTKCRHYFCESCALQHYRKSQRCYVCDKQTNGVFNPAKELMAKLEK 307

Query:   287 DAGD 290
               G+
Sbjct:   308 HKGE 311




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-040825-1 rnf113a "ring finger protein 113A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUA4 LOC100514886 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O15541 RNF113A "RING finger protein 113A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0038772 CG4973 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q67ER4 RNF113A "RING finger protein 113A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE92 LOC100855580 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PPN1 Rnf113a1 "Ring finger protein 113A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF77 LOC518027 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGA7 LOC480186 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O15541R113A_HUMANNo assigned EC number0.51230.74440.8746yesN/A
O17917RN113_CAEELNo assigned EC number0.46890.66740.7005yesN/A
Q67ER4R113A_BOVINNo assigned EC number0.51700.74190.8717yesN/A
Q9FNG6C3H51_ARATHNo assigned EC number0.40890.66990.7142yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 4e-35
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-10
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-07
smart0018440 smart00184, RING, Ring finger 1e-07
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-07
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 2e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-06
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 2e-05
smart0035627 smart00356, ZnF_C3H1, zinc finger 3e-05
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 4e-05
PLN03208193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 6e-04
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 0.003
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
 Score =  129 bits (326), Expect = 4e-35
 Identities = 77/289 (26%), Positives = 121/289 (41%), Gaps = 45/289 (15%)

Query: 3   KKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTTKQTKAAKPQVEDSESDE 62
           K    ++N +KRQ  + SE +       +EK   +  +  K                 + 
Sbjct: 9   KSSSDEKNQKKRQKINFSEEKLVAS--DEEKGSSDLMSLAK---------------SGNS 51

Query: 63  SSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDK 122
            + Q+    + +     +   D+        +  T +D      K L   A+ +   DD 
Sbjct: 52  RTLQLSHENEGKLQKKGE---DLDKYTLTVNDDSTKEDLLNFERKELAEKAKKRRPSDDN 108

Query: 123 VYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFC 182
                 +       K   Q               P   R     D QPD+CKDYKETG+C
Sbjct: 109 ELVLNMSGKNKRLTKQINQ---------------PTMFRDGEVIDTQPDVCKDYKETGYC 153

Query: 183 GFGDSCKFLHDRTDYKYGWQLEQE----HEDGDNKNYEIPDSDEEDHLPFKCYICRNSFK 238
           G+GDSCKFLHDR+D+K GW+L QE    +E+    +           +PF C IC+  ++
Sbjct: 154 GYGDSCKFLHDRSDFKTGWKLNQEWNAEYEEAPVISGPGEK------IPFLCGICKKDYE 207

Query: 239 DPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKD 287
            PV+T+C H FC+ CA+  ++K  +C +C K T+G F     + + L  
Sbjct: 208 SPVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGRFWVVSDLQKMLNK 256


Length = 259

>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 403
KOG1813|consensus313 100.0
COG5152259 Uncharacterized conserved protein, contains RING a 100.0
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.09
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.02
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.96
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.94
KOG0317|consensus293 98.9
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.88
KOG0823|consensus230 98.85
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.83
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.83
PHA02929238 N1R/p28-like protein; Provisional 98.78
KOG0287|consensus 442 98.75
KOG0320|consensus187 98.75
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.74
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.69
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.62
PHA02926242 zinc finger-like protein; Provisional 98.6
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.59
PF1463444 zf-RING_5: zinc-RING finger domain 98.52
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.5
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.46
KOG2164|consensus 513 98.45
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.43
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.39
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.36
KOG1039|consensus344 98.36
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.33
KOG2177|consensus 386 98.32
KOG0978|consensus698 98.31
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.22
KOG4628|consensus348 98.01
smart0035627 ZnF_C3H1 zinc finger. 97.96
KOG4159|consensus 398 97.85
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.83
KOG0311|consensus 381 97.82
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.77
KOG0802|consensus543 97.75
KOG0824|consensus 324 97.74
KOG2660|consensus 331 97.74
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.72
PHA03096284 p28-like protein; Provisional 97.63
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.56
KOG4172|consensus62 97.52
KOG4265|consensus349 97.36
KOG2879|consensus298 97.18
COG5222427 Uncharacterized conserved protein, contains RING Z 97.17
KOG0297|consensus 391 97.15
KOG0825|consensus 1134 97.0
KOG0828|consensus636 96.98
KOG0804|consensus 493 96.98
KOG0827|consensus 465 96.83
KOG4739|consensus233 96.67
KOG1002|consensus791 96.58
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.51
KOG4692|consensus489 96.51
KOG1645|consensus 463 96.49
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.38
KOG1734|consensus328 96.37
KOG4367|consensus 699 96.2
KOG1571|consensus355 96.05
KOG1493|consensus84 96.01
KOG1785|consensus563 95.97
PF04641260 Rtf2: Rtf2 RING-finger 95.94
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.8
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.64
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.62
KOG4185|consensus 296 95.55
COG52191525 Uncharacterized conserved protein, contains RING Z 95.55
KOG3039|consensus303 95.13
KOG1677|consensus332 95.05
KOG4275|consensus350 94.95
KOG1001|consensus674 94.67
KOG0826|consensus357 94.42
KOG2932|consensus 389 94.3
KOG3800|consensus 300 94.18
KOG1814|consensus445 94.18
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.03
KOG2930|consensus114 93.5
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 93.03
KOG3970|consensus299 92.75
KOG4445|consensus368 92.58
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.23
KOG0298|consensus1394 91.88
KOG1941|consensus518 91.67
KOG2114|consensus933 91.51
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 90.84
KOG3002|consensus299 90.44
KOG4362|consensus 684 89.51
COG5175 480 MOT2 Transcriptional repressor [Transcription] 89.49
KOG2817|consensus394 89.27
KOG3039|consensus303 89.23
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 88.9
KOG3161|consensus 861 88.16
KOG1940|consensus276 88.04
KOG1428|consensus3738 87.54
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 87.0
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 86.59
KOG3113|consensus293 86.38
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.05
KOG1100|consensus207 85.96
PF03194254 LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa 85.34
KOG2034|consensus911 84.8
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 84.43
KOG1039|consensus 344 84.19
KOG2185|consensus 486 82.53
KOG1677|consensus332 80.72
KOG3579|consensus352 80.27
>KOG1813|consensus Back     alignment and domain information
Probab=100.00  E-value=4.1e-67  Score=502.65  Aligned_cols=262  Identities=44%  Similarity=0.742  Sum_probs=235.3

Q ss_pred             cccc-ccccccCCCCCccccccccccCC--CCC-CCCccccccCccceEEeecCCcCCCCCCCCCCccccccccccchhH
Q psy16818         26 TQIV-RKEKKIREDPNFQKTTKQTKAAK--PQV-EDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDA  101 (403)
Q Consensus        26 ~~v~-~~~~~~~~~~~~~~t~~~~~~~~--~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~d~  101 (403)
                      ++++ .++..+..|||+|+|+.+.+...  ..+ ..+.+....+.+.|+|.|.+++.+.||.|+|||+++|.+|+..+||
T Consensus        39 ~~s~r~ek~~k~~~p~~q~~k~~~k~~~~~~~~s~~s~~~~~~ed~vv~y~s~~~~~~~g~~dsgat~t~e~~te~~~Da  118 (313)
T KOG1813|consen   39 NESSRLEKLEKKIKPETQRKKETDKVLTGEEDDSALSICQNPFEDPVVTYCSCDKCALKGHTDSGATATLEEPTEGLRDA  118 (313)
T ss_pred             cchhhhhhhhhhcchHhhhhhhhcccccccccccccccccCcccccceeeccccccccCCccccCceeEeecCcccchhH
Confidence            4455 77778889999999998876431  111 1222222346689999999999999999999999999999999999


Q ss_pred             HHHHHHHHh-hhhhhcCCCCchhhhhhhhhhhhhhcccccccCCCCCccccccccCCcceeeeeeccCCCccchhhhhhc
Q psy16818        102 QAIYEKSLK-INAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETG  180 (403)
Q Consensus       102 ~~~~~~~~~-~~~~~~~~~~~~~y~g~~~y~~~~~~~~~~~~~~~~~~~~~gp~~~~~~~r~~~~~dyqpdiCkdYk~tG  180 (403)
                      |+|++++++ +++++.|+.++.+|+|+++|.+|.++.+++.+|+++|+++  |||||+|+|++++|||||||||||++||
T Consensus       119 qa~~er~~k~~~e~~~~k~~~~lykg~~~ya~~~k~~~~~~~n~s~g~~r--pira~~~~r~~~~~d~qpDicKdykeTg  196 (313)
T KOG1813|consen  119 QAIIERRIKEEREKLRGKKDTKLYKGINTYADDAKAQKVVKMNESIGTVR--PIRAAMHTRAGERIDYQPDICKDYKETG  196 (313)
T ss_pred             HHHhhhhHHHHHHhhcchhHHHHHHHHHHHHhhhhhhhhHhhhccccccc--ccchhhhhcccceeecCchhhhhhHhhC
Confidence            999999999 8899999889999999999999999999999999999987  9999999999999999999999999999


Q ss_pred             CCCCCCccccccCCCccccCcccccccccccccCcCCCCCCcCCCCccccccccccccCCcccccCCcccHHhHHHHhcc
Q psy16818        181 FCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKK  260 (403)
Q Consensus       181 ~CgfGDsCkflHdr~dy~~gwqle~e~e~~~~~~~ei~~~deed~~~l~C~IC~~~~~~Pv~t~CgH~FC~~Ci~~~~~~  260 (403)
                      ||||||||+|||+|+||++||+|+.+|+...+..+.+.. |++. +||.|.||...|.+||++.|+|+||..|....+++
T Consensus       197 ycg~gdSckFlh~r~DyK~GWqi~~e~d~~ke~~~~~~~-D~~~-~Pf~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk  274 (313)
T KOG1813|consen  197 YCGYGDSCKFLHDRSDYKAGWQIEFEWDSAKEKKRVKIE-DIEL-LPFKCFICRKYFYRPVVTKCGHYFCEVCALKPYQK  274 (313)
T ss_pred             cccccchhhhhhhhhhccccceeehhhhccccccceecC-Cccc-CCccccccccccccchhhcCCceeehhhhcccccc
Confidence            999999999999999999999999999988888887765 5566 99999999999999999999999999999999999


Q ss_pred             CCCccccCccccccccchHHHHHHHHHHhhH
Q psy16818        261 TPKCYICQKNTFGEFRTAEKIVQKLKDAGDI  291 (403)
Q Consensus       261 ~~~CP~Cr~~~~~~~~~~~~Li~~l~~~~~~  291 (403)
                      ...|++|.+++.++|+++.+|+..|+..+..
T Consensus       275 ~~~c~vC~~~t~g~~~~akeL~~~L~~kks~  305 (313)
T KOG1813|consen  275 GEKCYVCSQQTHGSFNVAKELLVSLKLKKSD  305 (313)
T ss_pred             CCcceecccccccccchHHHHHHHHHhhhhh
Confidence            9999999999999999999999998876443



>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG1677|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG2185|consensus Back     alignment and domain information
>KOG1677|consensus Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
2csy_A81 Solution Structure Of The Ring Domain Of The Zinc F 6e-20
>pdb|2CSY|A Chain A, Solution Structure Of The Ring Domain Of The Zinc Finger Protein 183-Like 1 Length = 81 Back     alignment and structure

Iteration: 1

Score = 95.1 bits (235), Expect = 6e-20, Method: Composition-based stats. Identities = 35/64 (54%), Positives = 52/64 (81%) Query: 226 LPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKL 285 +PF+C+ICR +F++PV+TKC+HYFC CALEHF+ TP+CYIC + T G F A++++ KL Sbjct: 14 IPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKL 73 Query: 286 KDAG 289 + +G Sbjct: 74 QKSG 77

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 4e-27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-10
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 9e-10
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-09
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-09
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-09
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 3e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-09
2ysj_A63 Tripartite motif-containing protein 31; ring-type 6e-09
2ysl_A73 Tripartite motif-containing protein 31; ring-type 7e-09
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 9e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 5e-08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 5e-08
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 6e-08
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 8e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-08
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-07
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 3e-07
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 5e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 7e-05
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 8e-05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 2e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 3e-04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 4e-04
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
 Score =  102 bits (255), Expect = 4e-27
 Identities = 37/72 (51%), Positives = 55/72 (76%)

Query: 219 DSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTA 278
              EE+ +PF+C+ICR +F++PV+TKC+HYFC  CALEHF+ TP+CYIC + T G F  A
Sbjct: 7   GGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPA 66

Query: 279 EKIVQKLKDAGD 290
           ++++ KL+ +G 
Sbjct: 67  KELMAKLQKSGP 78


>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.48
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.31
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.27
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.25
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.24
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.24
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.24
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.21
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.2
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.2
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.19
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.18
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.18
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.17
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.16
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.16
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.16
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.14
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.13
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.13
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.12
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.12
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.1
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.1
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.1
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.09
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.08
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.08
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.07
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.06
2ect_A78 Ring finger protein 126; metal binding protein, st 99.04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.03
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.03
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.01
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.0
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.98
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.98
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.97
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.96
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.92
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.91
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.9
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.84
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.83
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.83
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.82
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.79
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.78
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.78
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.74
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.71
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.66
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.64
2ea5_A68 Cell growth regulator with ring finger domain prot 98.62
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.57
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.56
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.42
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.4
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.38
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.27
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.88
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.87
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.6
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.41
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 97.11
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.65
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.54
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 96.42
2rhk_C72 Cleavage and polyadenylation specificity factor su 96.15
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 96.01
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 96.0
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.72
3nw0_A238 Non-structural maintenance of chromosomes element 95.4
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 95.24
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 94.36
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.08
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 93.43
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 93.01
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 92.6
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 92.5
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 92.06
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 91.44
2rhk_C72 Cleavage and polyadenylation specificity factor su 90.23
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 88.79
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 88.1
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 86.4
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 84.02
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 80.47
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.48  E-value=2.1e-14  Score=113.60  Aligned_cols=62  Identities=55%  Similarity=1.325  Sum_probs=56.9

Q ss_pred             CccccccccccccCCcccccCCcccHHhHHHHhccCCCccccCccccccccchHHHHHHHHH
Q psy16818        226 LPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKD  287 (403)
Q Consensus       226 ~~l~C~IC~~~~~~Pv~t~CgH~FC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~Li~~l~~  287 (403)
                      ..+.|+||++.|.+|++++|||+||..||..|+.....||+||..+...++++..|+..+..
T Consensus        14 ~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~l~~~~~~   75 (81)
T 2csy_A           14 IPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQK   75 (81)
T ss_dssp             CCSBCSSSCSBCCSEEECTTSCEEEHHHHHHHHHHCSBCSSSCCBCCSCCEECHHHHHHHSS
T ss_pred             CCCCCcCCCchhcCeeEccCCCHhHHHHHHHHHHCCCcCCCcCccccccCCcHHHHHHHHHh
Confidence            66899999999999999999999999999999998889999999999888888888777654



>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 403
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 9e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 8e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-07
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-06
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 2e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 6e-04
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 0.001
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 0.001
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 0.001
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 51.8 bits (124), Expect = 2e-09
 Identities = 19/66 (28%), Positives = 24/66 (36%), Gaps = 4/66 (6%)

Query: 205 QEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFK-KTPK 263
           + H        + P    +      C IC +   DPV T CKH FC  C L   K     
Sbjct: 4   KIHLSTKLLAVDFPAHFVKS---ISCQICEHILADPVETSCKHLFCRICILRCLKVMGSY 60

Query: 264 CYICQK 269
           C  C+ 
Sbjct: 61  CPSCRY 66


>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.34
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.25
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.22
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.22
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.17
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.15
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.14
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.14
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.05
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.95
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.93
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.91
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.72
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.71
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.49
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.01
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.78
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.62
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.6
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.47
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 95.02
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 89.9
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.34  E-value=2.8e-13  Score=107.96  Aligned_cols=60  Identities=32%  Similarity=0.652  Sum_probs=49.6

Q ss_pred             CccccccccccccCCcccccCCcccHHhHHHHhc-cCCCccccCcccc--ccccchHHHHHHH
Q psy16818        226 LPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFK-KTPKCYICQKNTF--GEFRTAEKIVQKL  285 (403)
Q Consensus       226 ~~l~C~IC~~~~~~Pv~t~CgH~FC~~Ci~~~~~-~~~~CP~Cr~~~~--~~~~~~~~Li~~l  285 (403)
                      ..+.|+||++.+.+|++++|||+||..||.+|+. ....||+||.++.  ...++++.++..+
T Consensus        22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~P~~~~l~~l   84 (86)
T d1rmda2          22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNIL   84 (86)
T ss_dssp             HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBCCCHHHHHHH
T ss_pred             cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccCHHHHHHHHh
Confidence            3478999999999999999999999999999997 4568999999984  3345566666554



>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure