Psyllid ID: psy16818
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 403 | ||||||
| 193676506 | 311 | PREDICTED: RING finger protein 113A-like | 0.741 | 0.961 | 0.612 | 1e-104 | |
| 239790174 | 311 | ACYPI006184 [Acyrthosiphon pisum] | 0.741 | 0.961 | 0.596 | 1e-100 | |
| 340724628 | 325 | PREDICTED: RING finger protein 113A-like | 0.734 | 0.910 | 0.605 | 1e-99 | |
| 350397659 | 325 | PREDICTED: RING finger protein 113A-like | 0.734 | 0.910 | 0.601 | 2e-99 | |
| 307195659 | 324 | RING finger protein 113A [Harpegnathos s | 0.739 | 0.919 | 0.595 | 1e-98 | |
| 91086881 | 327 | PREDICTED: similar to AGAP007068-PA [Tri | 0.736 | 0.908 | 0.594 | 1e-98 | |
| 380022343 | 325 | PREDICTED: RING finger protein 113A-like | 0.697 | 0.864 | 0.603 | 2e-97 | |
| 332017630 | 325 | RING finger protein 113A [Acromyrmex ech | 0.739 | 0.916 | 0.590 | 3e-97 | |
| 170037220 | 321 | RING finger protein 113A [Culex quinquef | 0.734 | 0.922 | 0.567 | 5e-97 | |
| 157123920 | 317 | zinc finger protein, putative [Aedes aeg | 0.699 | 0.889 | 0.593 | 1e-95 |
| >gi|193676506|ref|XP_001943511.1| PREDICTED: RING finger protein 113A-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 383 bits (984), Expect = e-104, Method: Compositional matrix adjust.
Identities = 190/310 (61%), Positives = 233/310 (75%), Gaps = 11/310 (3%)
Query: 2 FKKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTT--KQTKAAKPQVEDSE 59
FKKR+V QN R+R S++E+ +V EK+ ++ F ++T K+ KA+ P + SE
Sbjct: 5 FKKRKVVQNRRRRAASDSENSDEESAVVLNEKRNKKSSPFIQSTSNKKLKASGPIHDSSE 64
Query: 60 SDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKE 119
SD S VGVSY+S+ + GP DMGATAT+EI+TE DKDAQAIYE+SL++N ELKGKE
Sbjct: 65 SDNES--VGVSYRSKMDTDMSGPKDMGATATIEIDTELDKDAQAIYERSLQVNKELKGKE 122
Query: 120 DDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKET 179
DDKVYRGLANY QY+EKKDTA GNA+SG VRKGPIRAPAN+RSTVRWDYQPDICKDYKET
Sbjct: 123 DDKVYRGLANYTQYYEKKDTALGNASSGMVRKGPIRAPANLRSTVRWDYQPDICKDYKET 182
Query: 180 GFCGFGDSCKFLHDRTDYKYGWQLEQE------HEDGDNKNYEIPDSDEEDHLPFKCYIC 233
GFCGFGDSCKFLHDR+DYK+GWQLE E +D D YEI ++D +D+LPFKC IC
Sbjct: 183 GFCGFGDSCKFLHDRSDYKFGWQLEMESTQQGDSDDDDPSKYEIKEND-DDYLPFKCLIC 241
Query: 234 RNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKDAGDIKT 293
R S+ +PVMTKCKHYFC KCAL HFKK+ KC++C+K T G F A I+++L A
Sbjct: 242 RGSYVNPVMTKCKHYFCEKCALAHFKKSTKCFVCEKQTGGFFDPATTIIERLNAANTDII 301
Query: 294 MAKDSDSDSD 303
+SD +SD
Sbjct: 302 HQCNSDEESD 311
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|239790174|dbj|BAH71664.1| ACYPI006184 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|340724628|ref|XP_003400683.1| PREDICTED: RING finger protein 113A-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350397659|ref|XP_003484946.1| PREDICTED: RING finger protein 113A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307195659|gb|EFN77501.1| RING finger protein 113A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|91086881|ref|XP_970132.1| PREDICTED: similar to AGAP007068-PA [Tribolium castaneum] gi|270010474|gb|EFA06922.1| hypothetical protein TcasGA2_TC009871 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|380022343|ref|XP_003695009.1| PREDICTED: RING finger protein 113A-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|332017630|gb|EGI58327.1| RING finger protein 113A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|170037220|ref|XP_001846457.1| RING finger protein 113A [Culex quinquefasciatus] gi|167880291|gb|EDS43674.1| RING finger protein 113A [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157123920|ref|XP_001653974.1| zinc finger protein, putative [Aedes aegypti] gi|108882876|gb|EAT47101.1| AAEL001778-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 403 | ||||||
| UNIPROTKB|Q67ER3 | 328 | RNF113A "Zinc finger protein 1 | 0.712 | 0.875 | 0.559 | 8.3e-90 | |
| ZFIN|ZDB-GENE-040825-1 | 321 | rnf113a "ring finger protein 1 | 0.712 | 0.894 | 0.538 | 1.6e-86 | |
| UNIPROTKB|F1RUA4 | 344 | LOC100514886 "Uncharacterized | 0.704 | 0.825 | 0.519 | 7.2e-84 | |
| UNIPROTKB|O15541 | 343 | RNF113A "RING finger protein 1 | 0.704 | 0.827 | 0.518 | 1.2e-83 | |
| FB|FBgn0038772 | 357 | CG4973 [Drosophila melanogaste | 0.702 | 0.792 | 0.532 | 1.5e-83 | |
| UNIPROTKB|Q67ER4 | 343 | RNF113A "RING finger protein 1 | 0.704 | 0.827 | 0.518 | 1.5e-83 | |
| UNIPROTKB|E2RE92 | 348 | LOC100855580 "Uncharacterized | 0.665 | 0.770 | 0.533 | 1.5e-83 | |
| UNIPROTKB|Q5PPN1 | 341 | Rnf113a1 "Ring finger protein | 0.702 | 0.829 | 0.52 | 6.4e-83 | |
| UNIPROTKB|E1BF77 | 351 | LOC518027 "Uncharacterized pro | 0.662 | 0.760 | 0.521 | 1e-77 | |
| UNIPROTKB|E2RGA7 | 350 | LOC480186 "Uncharacterized pro | 0.575 | 0.662 | 0.545 | 8.4e-74 |
| UNIPROTKB|Q67ER3 RNF113A "Zinc finger protein 183" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 896 (320.5 bits), Expect = 8.3e-90, P = 8.3e-90
Identities = 170/304 (55%), Positives = 226/304 (74%)
Query: 1 MFKKRQVK--QNTRKR-QNDSESES--EDETQIVRKEKKIREDPN-FXXXXXXXXXXXPQ 54
+FKKR + + RKR +D E ES E+ + +VRKE++ RE PN P
Sbjct: 11 VFKKRGLAAGRGRRKRPSSDQEQESSGEEGSTVVRKERR-RETPNPMIQKTRRCTKERPS 69
Query: 55 --VEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKIN 112
+ S+ D+ S ++GV+YKS +S+ GP DMGATA E++TE DKDAQAI+E+S KI
Sbjct: 70 YALSSSDDDDPSKEIGVTYKSTRSAKPVGPEDMGATAVYELDTEKDKDAQAIFERSQKIQ 129
Query: 113 AELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDI 172
EL+GKEDDK+YRG+ NY +Y + KDT+ GNA+SG VRKGPIRAP ++R+TVRWDYQPDI
Sbjct: 130 EELRGKEDDKIYRGINNYQKYVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDI 189
Query: 173 CKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDG-----DNKNYEIPDSDEEDHLP 227
CKDYKETGFCGFGDSCKFLHDR+DYK+GWQ+E+E ++G D +NYE+ SDEED +P
Sbjct: 190 CKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVNDEENYEV-SSDEED-MP 247
Query: 228 FKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKL-K 286
FKC+ICR+SFK+PV+TKC+HYFC CAL+H++K+ +CY+C K T G F A++++ KL K
Sbjct: 248 FKCFICRSSFKNPVVTKCRHYFCESCALQHYRKSQRCYVCDKQTNGVFNPAKELMAKLEK 307
Query: 287 DAGD 290
G+
Sbjct: 308 HKGE 311
|
|
| ZFIN|ZDB-GENE-040825-1 rnf113a "ring finger protein 113A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUA4 LOC100514886 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O15541 RNF113A "RING finger protein 113A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038772 CG4973 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q67ER4 RNF113A "RING finger protein 113A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE92 LOC100855580 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5PPN1 Rnf113a1 "Ring finger protein 113A1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF77 LOC518027 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGA7 LOC480186 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 403 | |||
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 4e-35 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-10 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-07 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-07 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-07 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 2e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 3e-06 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 2e-05 | |
| smart00356 | 27 | smart00356, ZnF_C3H1, zinc finger | 3e-05 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 4e-05 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 6e-04 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 0.003 |
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
Score = 129 bits (326), Expect = 4e-35
Identities = 77/289 (26%), Positives = 121/289 (41%), Gaps = 45/289 (15%)
Query: 3 KKRQVKQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTTKQTKAAKPQVEDSESDE 62
K ++N +KRQ + SE + +EK + + K +
Sbjct: 9 KSSSDEKNQKKRQKINFSEEKLVAS--DEEKGSSDLMSLAK---------------SGNS 51
Query: 63 SSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDK 122
+ Q+ + + + D+ + T +D K L A+ + DD
Sbjct: 52 RTLQLSHENEGKLQKKGE---DLDKYTLTVNDDSTKEDLLNFERKELAEKAKKRRPSDDN 108
Query: 123 VYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFC 182
+ K Q P R D QPD+CKDYKETG+C
Sbjct: 109 ELVLNMSGKNKRLTKQINQ---------------PTMFRDGEVIDTQPDVCKDYKETGYC 153
Query: 183 GFGDSCKFLHDRTDYKYGWQLEQE----HEDGDNKNYEIPDSDEEDHLPFKCYICRNSFK 238
G+GDSCKFLHDR+D+K GW+L QE +E+ + +PF C IC+ ++
Sbjct: 154 GYGDSCKFLHDRSDFKTGWKLNQEWNAEYEEAPVISGPGEK------IPFLCGICKKDYE 207
Query: 239 DPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKD 287
PV+T+C H FC+ CA+ ++K +C +C K T+G F + + L
Sbjct: 208 SPVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGRFWVVSDLQKMLNK 256
|
Length = 259 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| KOG1813|consensus | 313 | 100.0 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 100.0 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.09 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.02 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.96 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.94 | |
| KOG0317|consensus | 293 | 98.9 | ||
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.88 | |
| KOG0823|consensus | 230 | 98.85 | ||
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.83 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.83 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.78 | |
| KOG0287|consensus | 442 | 98.75 | ||
| KOG0320|consensus | 187 | 98.75 | ||
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.74 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.69 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.62 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.6 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.59 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.52 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.5 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.46 | |
| KOG2164|consensus | 513 | 98.45 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.43 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.39 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.36 | |
| KOG1039|consensus | 344 | 98.36 | ||
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.33 | |
| KOG2177|consensus | 386 | 98.32 | ||
| KOG0978|consensus | 698 | 98.31 | ||
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.22 | |
| KOG4628|consensus | 348 | 98.01 | ||
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 97.96 | |
| KOG4159|consensus | 398 | 97.85 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.83 | |
| KOG0311|consensus | 381 | 97.82 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.77 | |
| KOG0802|consensus | 543 | 97.75 | ||
| KOG0824|consensus | 324 | 97.74 | ||
| KOG2660|consensus | 331 | 97.74 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.72 | |
| PHA03096 | 284 | p28-like protein; Provisional | 97.63 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.56 | |
| KOG4172|consensus | 62 | 97.52 | ||
| KOG4265|consensus | 349 | 97.36 | ||
| KOG2879|consensus | 298 | 97.18 | ||
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.17 | |
| KOG0297|consensus | 391 | 97.15 | ||
| KOG0825|consensus | 1134 | 97.0 | ||
| KOG0828|consensus | 636 | 96.98 | ||
| KOG0804|consensus | 493 | 96.98 | ||
| KOG0827|consensus | 465 | 96.83 | ||
| KOG4739|consensus | 233 | 96.67 | ||
| KOG1002|consensus | 791 | 96.58 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 96.51 | |
| KOG4692|consensus | 489 | 96.51 | ||
| KOG1645|consensus | 463 | 96.49 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.38 | |
| KOG1734|consensus | 328 | 96.37 | ||
| KOG4367|consensus | 699 | 96.2 | ||
| KOG1571|consensus | 355 | 96.05 | ||
| KOG1493|consensus | 84 | 96.01 | ||
| KOG1785|consensus | 563 | 95.97 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 95.94 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.8 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 95.64 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.62 | |
| KOG4185|consensus | 296 | 95.55 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.55 | |
| KOG3039|consensus | 303 | 95.13 | ||
| KOG1677|consensus | 332 | 95.05 | ||
| KOG4275|consensus | 350 | 94.95 | ||
| KOG1001|consensus | 674 | 94.67 | ||
| KOG0826|consensus | 357 | 94.42 | ||
| KOG2932|consensus | 389 | 94.3 | ||
| KOG3800|consensus | 300 | 94.18 | ||
| KOG1814|consensus | 445 | 94.18 | ||
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 94.03 | |
| KOG2930|consensus | 114 | 93.5 | ||
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 93.03 | |
| KOG3970|consensus | 299 | 92.75 | ||
| KOG4445|consensus | 368 | 92.58 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.23 | |
| KOG0298|consensus | 1394 | 91.88 | ||
| KOG1941|consensus | 518 | 91.67 | ||
| KOG2114|consensus | 933 | 91.51 | ||
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 90.84 | |
| KOG3002|consensus | 299 | 90.44 | ||
| KOG4362|consensus | 684 | 89.51 | ||
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 89.49 | |
| KOG2817|consensus | 394 | 89.27 | ||
| KOG3039|consensus | 303 | 89.23 | ||
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 88.9 | |
| KOG3161|consensus | 861 | 88.16 | ||
| KOG1940|consensus | 276 | 88.04 | ||
| KOG1428|consensus | 3738 | 87.54 | ||
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 87.0 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 86.59 | |
| KOG3113|consensus | 293 | 86.38 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 86.05 | |
| KOG1100|consensus | 207 | 85.96 | ||
| PF03194 | 254 | LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa | 85.34 | |
| KOG2034|consensus | 911 | 84.8 | ||
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 84.43 | |
| KOG1039|consensus | 344 | 84.19 | ||
| KOG2185|consensus | 486 | 82.53 | ||
| KOG1677|consensus | 332 | 80.72 | ||
| KOG3579|consensus | 352 | 80.27 |
| >KOG1813|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.1e-67 Score=502.65 Aligned_cols=262 Identities=44% Similarity=0.742 Sum_probs=235.3
Q ss_pred cccc-ccccccCCCCCccccccccccCC--CCC-CCCccccccCccceEEeecCCcCCCCCCCCCCccccccccccchhH
Q psy16818 26 TQIV-RKEKKIREDPNFQKTTKQTKAAK--PQV-EDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDA 101 (403)
Q Consensus 26 ~~v~-~~~~~~~~~~~~~~t~~~~~~~~--~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~d~ 101 (403)
++++ .++..+..|||+|+|+.+.+... ..+ ..+.+....+.+.|+|.|.+++.+.||.|+|||+++|.+|+..+||
T Consensus 39 ~~s~r~ek~~k~~~p~~q~~k~~~k~~~~~~~~s~~s~~~~~~ed~vv~y~s~~~~~~~g~~dsgat~t~e~~te~~~Da 118 (313)
T KOG1813|consen 39 NESSRLEKLEKKIKPETQRKKETDKVLTGEEDDSALSICQNPFEDPVVTYCSCDKCALKGHTDSGATATLEEPTEGLRDA 118 (313)
T ss_pred cchhhhhhhhhhcchHhhhhhhhcccccccccccccccccCcccccceeeccccccccCCccccCceeEeecCcccchhH
Confidence 4455 77778889999999998876431 111 1222222346689999999999999999999999999999999999
Q ss_pred HHHHHHHHh-hhhhhcCCCCchhhhhhhhhhhhhhcccccccCCCCCccccccccCCcceeeeeeccCCCccchhhhhhc
Q psy16818 102 QAIYEKSLK-INAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETG 180 (403)
Q Consensus 102 ~~~~~~~~~-~~~~~~~~~~~~~y~g~~~y~~~~~~~~~~~~~~~~~~~~~gp~~~~~~~r~~~~~dyqpdiCkdYk~tG 180 (403)
|+|++++++ +++++.|+.++.+|+|+++|.+|.++.+++.+|+++|+++ |||||+|+|++++|||||||||||++||
T Consensus 119 qa~~er~~k~~~e~~~~k~~~~lykg~~~ya~~~k~~~~~~~n~s~g~~r--pira~~~~r~~~~~d~qpDicKdykeTg 196 (313)
T KOG1813|consen 119 QAIIERRIKEEREKLRGKKDTKLYKGINTYADDAKAQKVVKMNESIGTVR--PIRAAMHTRAGERIDYQPDICKDYKETG 196 (313)
T ss_pred HHHhhhhHHHHHHhhcchhHHHHHHHHHHHHhhhhhhhhHhhhccccccc--ccchhhhhcccceeecCchhhhhhHhhC
Confidence 999999999 8899999889999999999999999999999999999987 9999999999999999999999999999
Q ss_pred CCCCCCccccccCCCccccCcccccccccccccCcCCCCCCcCCCCccccccccccccCCcccccCCcccHHhHHHHhcc
Q psy16818 181 FCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKK 260 (403)
Q Consensus 181 ~CgfGDsCkflHdr~dy~~gwqle~e~e~~~~~~~ei~~~deed~~~l~C~IC~~~~~~Pv~t~CgH~FC~~Ci~~~~~~ 260 (403)
||||||||+|||+|+||++||+|+.+|+...+..+.+.. |++. +||.|.||...|.+||++.|+|+||..|....+++
T Consensus 197 ycg~gdSckFlh~r~DyK~GWqi~~e~d~~ke~~~~~~~-D~~~-~Pf~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk 274 (313)
T KOG1813|consen 197 YCGYGDSCKFLHDRSDYKAGWQIEFEWDSAKEKKRVKIE-DIEL-LPFKCFICRKYFYRPVVTKCGHYFCEVCALKPYQK 274 (313)
T ss_pred cccccchhhhhhhhhhccccceeehhhhccccccceecC-Cccc-CCccccccccccccchhhcCCceeehhhhcccccc
Confidence 999999999999999999999999999988888887765 5566 99999999999999999999999999999999999
Q ss_pred CCCccccCccccccccchHHHHHHHHHHhhH
Q psy16818 261 TPKCYICQKNTFGEFRTAEKIVQKLKDAGDI 291 (403)
Q Consensus 261 ~~~CP~Cr~~~~~~~~~~~~Li~~l~~~~~~ 291 (403)
...|++|.+++.++|+++.+|+..|+..+..
T Consensus 275 ~~~c~vC~~~t~g~~~~akeL~~~L~~kks~ 305 (313)
T KOG1813|consen 275 GEKCYVCSQQTHGSFNVAKELLVSLKLKKSD 305 (313)
T ss_pred CCcceecccccccccchHHHHHHHHHhhhhh
Confidence 9999999999999999999999998876443
|
|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG1677|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3113|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG2185|consensus | Back alignment and domain information |
|---|
| >KOG1677|consensus | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 403 | ||||
| 2csy_A | 81 | Solution Structure Of The Ring Domain Of The Zinc F | 6e-20 |
| >pdb|2CSY|A Chain A, Solution Structure Of The Ring Domain Of The Zinc Finger Protein 183-Like 1 Length = 81 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 403 | |||
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 4e-27 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-10 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 9e-10 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 1e-09 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 3e-09 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 3e-09 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 3e-09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 6e-09 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 6e-09 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 7e-09 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 9e-09 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-08 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 5e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 5e-08 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 6e-08 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 8e-08 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 8e-08 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 1e-07 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-07 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 2e-07 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 2e-07 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 2e-07 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 3e-07 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 3e-07 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 5e-07 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-07 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-06 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 2e-06 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 2e-06 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 2e-06 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 4e-06 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 6e-06 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 7e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 2e-05 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 7e-05 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 8e-05 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 1e-04 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 2e-04 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 2e-04 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 3e-04 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 4e-04 |
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
Score = 102 bits (255), Expect = 4e-27
Identities = 37/72 (51%), Positives = 55/72 (76%)
Query: 219 DSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTA 278
EE+ +PF+C+ICR +F++PV+TKC+HYFC CALEHF+ TP+CYIC + T G F A
Sbjct: 7 GGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPA 66
Query: 279 EKIVQKLKDAGD 290
++++ KL+ +G
Sbjct: 67 KELMAKLQKSGP 78
|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.48 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.31 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.27 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.25 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.24 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.24 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.24 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.21 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.2 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.2 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.19 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.18 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.18 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.17 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.16 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.16 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.16 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.14 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.13 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.12 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.12 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.11 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.1 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.1 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.1 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.09 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.09 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.08 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.08 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.07 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.07 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.07 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.06 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.06 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.04 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.03 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.03 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.01 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.0 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.98 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.98 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.97 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.96 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.92 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.91 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.9 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.84 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.83 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.83 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.82 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.79 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.78 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.78 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.74 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.71 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.66 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.64 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.62 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.57 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.56 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.42 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.4 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.38 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.27 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.88 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.87 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.6 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.41 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 97.11 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 96.65 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 96.54 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 96.42 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 96.15 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 96.01 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 96.0 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.72 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 95.4 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 95.24 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 94.36 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 94.08 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 93.43 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 93.01 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 92.6 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 92.5 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 92.06 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 91.44 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 90.23 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 88.79 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 88.1 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 86.4 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 84.02 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 80.47 |
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.48 E-value=2.1e-14 Score=113.60 Aligned_cols=62 Identities=55% Similarity=1.325 Sum_probs=56.9
Q ss_pred CccccccccccccCCcccccCCcccHHhHHHHhccCCCccccCccccccccchHHHHHHHHH
Q psy16818 226 LPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTPKCYICQKNTFGEFRTAEKIVQKLKD 287 (403)
Q Consensus 226 ~~l~C~IC~~~~~~Pv~t~CgH~FC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~Li~~l~~ 287 (403)
..+.|+||++.|.+|++++|||+||..||..|+.....||+||..+...++++..|+..+..
T Consensus 14 ~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~l~~~~~~ 75 (81)
T 2csy_A 14 IPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQK 75 (81)
T ss_dssp CCSBCSSSCSBCCSEEECTTSCEEEHHHHHHHHHHCSBCSSSCCBCCSCCEECHHHHHHHSS
T ss_pred CCCCCcCCCchhcCeeEccCCCHhHHHHHHHHHHCCCcCCCcCccccccCCcHHHHHHHHHh
Confidence 66899999999999999999999999999999998889999999999888888888777654
|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 403 | ||||
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-09 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 3e-09 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 9e-09 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-08 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 8e-08 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 9e-07 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-06 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 2e-04 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 6e-04 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 0.001 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 0.001 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 0.001 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 51.8 bits (124), Expect = 2e-09
Identities = 19/66 (28%), Positives = 24/66 (36%), Gaps = 4/66 (6%)
Query: 205 QEHEDGDNKNYEIPDSDEEDHLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFK-KTPK 263
+ H + P + C IC + DPV T CKH FC C L K
Sbjct: 4 KIHLSTKLLAVDFPAHFVKS---ISCQICEHILADPVETSCKHLFCRICILRCLKVMGSY 60
Query: 264 CYICQK 269
C C+
Sbjct: 61 CPSCRY 66
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.34 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.25 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.22 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.22 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.17 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.15 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.14 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.14 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.05 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.95 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.93 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.91 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.72 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.71 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.49 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.01 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 97.78 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 97.62 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 97.6 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 97.47 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 95.02 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 89.9 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.34 E-value=2.8e-13 Score=107.96 Aligned_cols=60 Identities=32% Similarity=0.652 Sum_probs=49.6
Q ss_pred CccccccccccccCCcccccCCcccHHhHHHHhc-cCCCccccCcccc--ccccchHHHHHHH
Q psy16818 226 LPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFK-KTPKCYICQKNTF--GEFRTAEKIVQKL 285 (403)
Q Consensus 226 ~~l~C~IC~~~~~~Pv~t~CgH~FC~~Ci~~~~~-~~~~CP~Cr~~~~--~~~~~~~~Li~~l 285 (403)
..+.|+||++.+.+|++++|||+||..||.+|+. ....||+||.++. ...++++.++..+
T Consensus 22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~P~~~~l~~l 84 (86)
T d1rmda2 22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNIL 84 (86)
T ss_dssp HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBCCCHHHHHHH
T ss_pred cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccCHHHHHHHHh
Confidence 3478999999999999999999999999999997 4568999999984 3345566666554
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|