Psyllid ID: psy17089


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE
cccEEEEEccccccHHHHHHHHHccccEEEcccccccccccccEEEEccEEEEEEEccccccccccHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHccccccEEccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccccccccccEEEccEEEEEEEccccccccccccccHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHHccEEEEEEEcccccccccHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccEEEEEEcccccccEEEEEEccccccccccccccc
cccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHccccccccccEEEEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHccHHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHcHcccccEEEEEccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccccEEEEEEccHHHcccHHHHHcc
MKPVLVLvgrpnvgkstlfnrltnsrdalvanypgltrdrhygegyigkkSFIIidtggfepevkKGIMHEMTKQTKQAIIESDIIIFIVDgrqglveqDKLITNFLRKSGQPIVLVINKseninssisldfyelgignpHIISALYGNGIKNFLENILTIElpykkffkkkeftnihSIEYIKVAIvgkpnvgkSTLINSllgenrvitydtpgttrDSIKSLFEynnkkyilidtagirrrnKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIknhppcrkklirpklryahqggknppiiviHGNRLKYIGNDYKRYLE
mkpvlvlvgrpnvgkstlfnrltnsrdaLVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINsllgenrvitydtpgttrdsikslfeynnkkyilidtagirrrnKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISaiknhppcrkKLIRPKLRyahqggknppiivihgnrlkyiGNDYKRYLE
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAiiesdiiifiVDGRQGLVEQDKLITNFLRKSGQPIVLVinkseninssisLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSiihnqrkiiknnikkklnFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE
***VLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKR***
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPY***************EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELP************IHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query419 2.2.26 [Sep-21-2011]
A6SZW6447 GTPase Der OS=Janthinobac yes N/A 0.992 0.930 0.607 1e-153
A4G4K6447 GTPase Der OS=Herminiimon yes N/A 0.992 0.930 0.604 1e-151
A0K7T2445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.576 1e-145
B1JT88445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.576 1e-145
Q1BGX0445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.576 1e-145
B4EAW5445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.576 1e-145
Q39FR3445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.571 1e-145
B1YR40445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.569 1e-145
Q63US9445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.573 1e-145
A3NA49445 GTPase Der OS=Burkholderi yes N/A 0.990 0.932 0.573 1e-145
>sp|A6SZW6|DER_JANMA GTPase Der OS=Janthinobacterium sp. (strain Marseille) GN=der PE=3 SV=1 Back     alignment and function desciption
 Score =  542 bits (1396), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/420 (60%), Positives = 334/420 (79%), Gaps = 4/420 (0%)

Query: 1   MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF 60
           MKPV+ L+GRPNVGKSTLFNRLT SRDALVA+ PGLTRDRHYGEG +G++ F++IDTGGF
Sbjct: 1   MKPVIALIGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF 60

Query: 61  EPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINK 120
           EP  K+GIMHEM KQTKQA+ E+D++IFIVDGRQGL   DK IT+FLRKSG+ ++LV+NK
Sbjct: 61  EPVAKEGIMHEMAKQTKQAVAEADVVIFIVDGRQGLTPHDKTITDFLRKSGRSVMLVVNK 120

Query: 121 SENIN-SSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHS 179
           +E +  ++++ DFYELG+G+P++ISA +G+G+ + +E  L I    +   ++   +N  S
Sbjct: 121 AEGMKYTTVTADFYELGMGDPYVISAAHGDGVNDLVEEALNIAFAQRPPEEEAPASNDRS 180

Query: 180 IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG 239
           I   K+AIVG+PNVGKSTL+N+LLGE RVI +D PGTTRDSI+  FE + K Y LIDTAG
Sbjct: 181 I---KLAIVGRPNVGKSTLVNTLLGEERVIAFDLPGTTRDSIEIPFERDGKHYTLIDTAG 237

Query: 240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVC 299
           IRRR K FE IEKFSV+KTL+SI EANVV+LLLDAQQ+IS QD +IA FI ESGR+L+V 
Sbjct: 238 IRRRGKVFEAIEKFSVVKTLQSISEANVVLLLLDAQQDISEQDAHIAGFILESGRALVVG 297

Query: 300 VNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHL 359
           VNKWD +  ++R  IK ++++KL+FLSFA  +F+SA+K + I   M+S++  Y +++ +L
Sbjct: 298 VNKWDGLTSDRRDEIKMDLERKLSFLSFAKTHFVSALKSSGIGPMMKSVDGAYAAAMSNL 357

Query: 360 STSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           ST ++TRALI A+++  P RK  IRPKLRYAHQGG NPPI+VIHGN L+ I  +YKR+LE
Sbjct: 358 STPKLTRALIEAVEHQQPRRKGSIRPKLRYAHQGGMNPPIVVIHGNALEAIDANYKRFLE 417




GTPase that plays an essential role in the late steps of ribosome biogenesis.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)
>sp|A4G4K6|DER_HERAR GTPase Der OS=Herminiimonas arsenicoxydans GN=der PE=3 SV=1 Back     alignment and function description
>sp|A0K7T2|DER_BURCH GTPase Der OS=Burkholderia cenocepacia (strain HI2424) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B1JT88|DER_BURCC GTPase Der OS=Burkholderia cenocepacia (strain MC0-3) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q1BGX0|DER_BURCA GTPase Der OS=Burkholderia cenocepacia (strain AU 1054) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B4EAW5|DER_BURCJ GTPase Der OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q39FR3|DER_BURS3 GTPase Der OS=Burkholderia sp. (strain 383) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B1YR40|DER_BURA4 GTPase Der OS=Burkholderia ambifaria (strain MC40-6) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q63US9|DER_BURPS GTPase Der OS=Burkholderia pseudomallei (strain K96243) GN=der PE=3 SV=1 Back     alignment and function description
>sp|A3NA49|DER_BURP6 GTPase Der OS=Burkholderia pseudomallei (strain 668) GN=der PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
398836196446 ribosome-associated GTPase EngA [Herbasp 0.992 0.932 0.616 1e-154
300312253447 GTP-binding protein [Herbaspirillum sero 0.992 0.930 0.609 1e-153
340787109447 GTP-binding protein [Collimonas fungivor 0.992 0.930 0.616 1e-152
409406674447 GTP-binding protein [Herbaspirillum sp. 0.990 0.928 0.610 1e-151
152981185447 GTP-binding protein EngA [Janthinobacter 0.992 0.930 0.607 1e-151
399018047447 ribosome-associated GTPase EngA [Herbasp 0.990 0.928 0.597 1e-151
445498326448 GTP-binding protein EngA [Janthinobacter 0.990 0.926 0.591 1e-150
395763286448 GTP-binding protein Der [Janthinobacteri 0.990 0.926 0.600 1e-150
134094495447 GTP-binding protein EngA [Herminiimonas 0.992 0.930 0.604 1e-149
427401453445 GTPase Der [Massilia timonae CCUG 45783] 0.990 0.932 0.591 1e-148
>gi|398836196|ref|ZP_10593542.1| ribosome-associated GTPase EngA [Herbaspirillum sp. YR522] gi|398213200|gb|EJM99794.1| ribosome-associated GTPase EngA [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/420 (61%), Positives = 333/420 (79%), Gaps = 4/420 (0%)

Query: 1   MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF 60
           MKPV+ LVGRPNVGKSTLFNRLT SRDALVA+ PGLTRDRHYGEG +G++ F++IDTGGF
Sbjct: 1   MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF 60

Query: 61  EPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINK 120
           EP  K+GIMHEM KQTKQA++E+D+++FIVDGRQGL   DK IT+FLRK G+P++LV+NK
Sbjct: 61  EPVAKEGIMHEMAKQTKQAVVEADVVVFIVDGRQGLTPHDKTITDFLRKCGRPVLLVVNK 120

Query: 121 SENIN-SSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHS 179
           SE +  +S++ DFYELG+G+P++ISA +G+G+ + +E  L +    +    + E      
Sbjct: 121 SEGMKYTSVTADFYELGMGDPYVISAAHGDGVADLVEEALNV---VEANRPEAEPEPEGQ 177

Query: 180 IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG 239
           +  IK+AIVG+PNVGKSTL+N+LLGE RVI +D PGTTRDSI+  FE + ++Y LIDTAG
Sbjct: 178 VRGIKIAIVGRPNVGKSTLVNTLLGEERVIAFDMPGTTRDSIEIPFERDGQQYTLIDTAG 237

Query: 240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVC 299
           IRRR K FE IEKFSV+KTL+SI +ANVV+LLLDAQQ+IS QD +IA FI ESGR+L+V 
Sbjct: 238 IRRRGKVFEAIEKFSVVKTLQSISDANVVLLLLDAQQDISEQDAHIAGFILESGRALVVG 297

Query: 300 VNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHL 359
           VNKWD +  +QR  IKN+I +KLNFLSFA  +F+SA+K + I   M+SIN  Y ++  +L
Sbjct: 298 VNKWDGLQSDQRDAIKNDIDRKLNFLSFANTHFVSALKNSGIGPVMKSINSAYAAATANL 357

Query: 360 STSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           ST R+TRAL  A+++  P RK  IRPKLRYAHQGG+NPP++VIHGN L  I ++YKRYLE
Sbjct: 358 STPRLTRALEQAVEHQQPPRKGSIRPKLRYAHQGGQNPPVVVIHGNALDAINDNYKRYLE 417




Source: Herbaspirillum sp. YR522

Species: Herbaspirillum sp. YR522

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|300312253|ref|YP_003776345.1| GTP-binding protein [Herbaspirillum seropedicae SmR1] gi|300075038|gb|ADJ64437.1| GTP-binding protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|340787109|ref|YP_004752574.1| GTP-binding protein [Collimonas fungivorans Ter331] gi|340552376|gb|AEK61751.1| GTP-binding protein [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|409406674|ref|ZP_11255136.1| GTP-binding protein [Herbaspirillum sp. GW103] gi|386435223|gb|EIJ48048.1| GTP-binding protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|152981185|ref|YP_001353813.1| GTP-binding protein EngA [Janthinobacterium sp. Marseille] gi|166198722|sp|A6SZW6.1|DER_JANMA RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA gi|151281262|gb|ABR89672.1| GTP-binding protein EngA [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|399018047|ref|ZP_10720233.1| ribosome-associated GTPase EngA [Herbaspirillum sp. CF444] gi|398102012|gb|EJL92204.1| ribosome-associated GTPase EngA [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|445498326|ref|ZP_21465181.1| GTP-binding protein EngA [Janthinobacterium sp. HH01] gi|444788321|gb|ELX09869.1| GTP-binding protein EngA [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|395763286|ref|ZP_10443955.1| GTP-binding protein Der [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|134094495|ref|YP_001099570.1| GTP-binding protein EngA [Herminiimonas arsenicoxydans] gi|166198721|sp|A4G4K6.1|DER_HERAR RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA gi|133738398|emb|CAL61443.1| GTP-binding protein EngA [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|427401453|ref|ZP_18892525.1| GTPase Der [Massilia timonae CCUG 45783] gi|425719562|gb|EKU82494.1| GTPase Der [Massilia timonae CCUG 45783] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
UNIPROTKB|P0A6P5490 der "50S ribosomal subunit sta 0.563 0.481 0.495 1.1e-91
UNIPROTKB|Q9KTW7494 der "GTPase Der" [Vibrio chole 0.610 0.518 0.447 1.9e-89
TIGR_CMR|VC_0763494 VC_0763 "GTP-binding protein" 0.610 0.518 0.447 1.9e-89
UNIPROTKB|Q47WC5498 der "GTPase Der" [Colwellia ps 0.613 0.516 0.461 2.4e-89
TIGR_CMR|CPS_4247498 CPS_4247 "GTP-binding protein 0.613 0.516 0.461 2.4e-89
UNIPROTKB|Q8EC36487 der "GTPase Der" [Shewanella o 0.988 0.850 0.417 8e-85
TIGR_CMR|SO_3308487 SO_3308 "GTP-binding protein E 0.988 0.850 0.417 8e-85
UNIPROTKB|Q83C83443 der "GTPase Der" [Coxiella bur 0.978 0.925 0.443 2.4e-83
TIGR_CMR|CBU_1245443 CBU_1245 "GTP-binding protein" 0.978 0.925 0.443 2.4e-83
UNIPROTKB|Q74AX4438 der "GTPase Der" [Geobacter su 0.973 0.931 0.374 2.4e-69
UNIPROTKB|P0A6P5 der "50S ribosomal subunit stability factor" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 606 (218.4 bits), Expect = 1.1e-91, Sum P(2) = 1.1e-91
 Identities = 117/236 (49%), Positives = 162/236 (68%)

Query:   183 IKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRR 242
             IK+AIVG+PNVGKSTL N +LGE RV+ YD PGTTRDSI    E + ++Y+LIDTAG+R+
Sbjct:   203 IKLAIVGRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDGREYVLIDTAGVRK 262

Query:   243 RNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNK 302
             R K  + +EKFSVIKTL++I +ANVV+L++DA++ IS QD+++  FI  SGRSL++ VNK
Sbjct:   263 RGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLSLLGFILNSGRSLVIVVNK 322

Query:   303 WDSXXXXXXXXXXXXXXXXXXFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTS 362
             WD                   F+ FA  +FISA+  + + +  ES+   YDSS   + TS
Sbjct:   323 WDGLSQEVKEQVKETLDFRLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVGTS 382

Query:   363 RITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYL 418
              +TR +  A+++H P   +  R KL+YAH GG NPPI+VIHGN++K + + YKRYL
Sbjct:   383 MLTRIMTMAVEDHQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYL 438


GO:0005829 "cytosol" evidence=IDA
GO:0006184 "GTP catabolic process" evidence=IDA
GO:0042254 "ribosome biogenesis" evidence=IEA
GO:0032794 "GTPase activating protein binding" evidence=IPI
GO:0043022 "ribosome binding" evidence=IDA
GO:0003924 "GTPase activity" evidence=IDA
GO:0005525 "GTP binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000027 "ribosomal large subunit assembly" evidence=IMP
UNIPROTKB|Q9KTW7 der "GTPase Der" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0763 VC_0763 "GTP-binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q47WC5 der "GTPase Der" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4247 CPS_4247 "GTP-binding protein EngA" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EC36 der "GTPase Der" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3308 SO_3308 "GTP-binding protein EngA" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q83C83 der "GTPase Der" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1245 CBU_1245 "GTP-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AX4 der "GTPase Der" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q46ZI7DER_CUPPJNo assigned EC number0.56900.99280.9306yesN/A
Q5P7B7DER_AROAENo assigned EC number0.52610.98320.9321yesN/A
Q0BEX1DER_BURCMNo assigned EC number0.56900.99040.9325yesN/A
Q13X32DER_BURXLNo assigned EC number0.58090.99040.9325yesN/A
B4RKD2DER_NEIG2No assigned EC number0.52020.97850.8453yesN/A
Q12AC2DER_POLSJNo assigned EC number0.50.99040.9284yesN/A
Q47BS0DER_DECARNo assigned EC number0.550.98090.9277yesN/A
B4EAW5DER_BURCJNo assigned EC number0.57610.99040.9325yesN/A
Q82XU6DER_NITEUNo assigned EC number0.550.98800.8865yesN/A
B2SXS6DER_BURPPNo assigned EC number0.57850.99040.9325yesN/A
B3R1J8DER_CUPTRNo assigned EC number0.58050.98800.9261yesN/A
B1JT88DER_BURCCNo assigned EC number0.57610.99040.9325yesN/A
A4G4K6DER_HERARNo assigned EC number0.60470.99280.9306yesN/A
B2JIU7DER_BURP8No assigned EC number0.56630.98800.9282yesN/A
A4SYD7DER_POLSQNo assigned EC number0.54840.98560.9096yesN/A
Q9JV01DER_NEIMANo assigned EC number0.52260.97850.8453yesN/A
A0K7T2DER_BURCHNo assigned EC number0.57610.99040.9325yesN/A
A4JEN6DER_BURVGNo assigned EC number0.57140.99040.9325yesN/A
Q2Y6F9DER_NITMUNo assigned EC number0.53680.98090.8819yesN/A
A1KT93DER_NEIMFNo assigned EC number0.52610.97610.8432yesN/A
Q7WHN4DER_BORBRNo assigned EC number0.53080.99040.9201yesN/A
A9IK66DER_BORPDNo assigned EC number0.53090.99520.9246yesN/A
A1TM31DER_ACIACNo assigned EC number0.50830.98800.9261yesN/A
Q3SL66DER_THIDANo assigned EC number0.53090.98090.8763yesN/A
Q1LLJ5DER_RALMENo assigned EC number0.55950.99280.9306yesN/A
Q39FR3DER_BURS3No assigned EC number0.57140.99040.9325yesN/A
A9AH00DER_BURM1No assigned EC number0.57380.99040.9325yesN/A
B1XU78DER_POLNSNo assigned EC number0.53420.98560.9096yesN/A
A3NA49DER_BURP6No assigned EC number0.57380.99040.9325yesN/A
Q21W32DER_RHOFDNo assigned EC number0.50830.98800.9261yesN/A
A1K3Z3DER_AZOSBNo assigned EC number0.52610.98320.9321yesN/A
Q0AE46DER_NITECNo assigned EC number0.52610.98800.8846yesN/A
Q7W6Q0DER_BORPANo assigned EC number0.53080.99040.9201yesN/A
Q1BGX0DER_BURCANo assigned EC number0.57610.99040.9325yesN/A
Q8Y026DER_RALSONo assigned EC number0.55230.99280.9306yesN/A
A3MK70DER_BURM7No assigned EC number0.57380.99040.9325yesN/A
B1YR40DER_BURA4No assigned EC number0.56900.99040.9325yesN/A
B2U9V3DER_RALPJNo assigned EC number0.55710.99280.9306yesN/A
Q7NS92DER_CHRVONo assigned EC number0.52140.97850.8742yesN/A
Q7VWL4DER_BORPENo assigned EC number0.53080.99040.9201yesN/A
C5CXH0DER_VARPSNo assigned EC number0.51900.99280.9306yesN/A
A3NVW6DER_BURP0No assigned EC number0.57380.99040.9325yesN/A
B9MFY0DER_ACIETNo assigned EC number0.51540.98800.9261yesN/A
O87407DER_NEIG1No assigned EC number0.52020.97850.8453yesN/A
Q63US9DER_BURPSNo assigned EC number0.57380.99040.9325yesN/A
A2S2A6DER_BURM9No assigned EC number0.57380.99040.9325yesN/A
Q9JZY1DER_NEIMBNo assigned EC number0.52740.97850.8453yesN/A
A6SZW6DER_JANMANo assigned EC number0.60710.99280.9306yesN/A
A2SHB1DER_METPPNo assigned EC number0.51190.99040.9304yesN/A
A1VNF8DER_POLNANo assigned EC number0.51060.98800.9303yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 0.0
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 0.0
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 1e-167
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase 4e-92
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Revie 2e-90
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 2e-77
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 8e-71
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 1e-35
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 5e-33
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 6e-33
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 7e-31
COG0486454 COG0486, ThdF, Predicted GTPase [General function 2e-30
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 5e-29
cd00880161 cd00880, Era_like, E 2e-27
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 1e-25
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 2e-25
cd00880161 cd00880, Era_like, E 3e-25
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 9e-25
PRK00089292 PRK00089, era, GTPase Era; Reviewed 5e-24
COG0486454 COG0486, ThdF, Predicted GTPase [General function 9e-24
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 9e-24
cd04163168 cd04163, Era, E 2e-23
cd04163168 cd04163, Era, E 2e-23
COG1159298 COG1159, Era, GTPase [General function prediction 4e-23
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 8e-23
COG1159298 COG1159, Era, GTPase [General function prediction 1e-22
PRK00089292 PRK00089, era, GTPase Era; Reviewed 2e-21
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 7e-20
TIGR00436270 TIGR00436, era, GTP-binding protein Era 7e-20
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 1e-19
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 2e-18
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 2e-16
TIGR00436270 TIGR00436, era, GTP-binding protein Era 5e-16
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-15
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 1e-15
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 2e-15
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 3e-15
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-14
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 7e-14
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 8e-14
COG2262411 COG2262, HflX, GTPases [General function predictio 3e-13
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 1e-12
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 2e-12
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 3e-12
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 4e-12
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 4e-12
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 6e-12
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 2e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 2e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 3e-11
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 4e-11
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 5e-11
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 1e-10
cd01878204 cd01878, HflX, HflX GTPase family 5e-10
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 9e-10
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 2e-09
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 4e-09
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-08
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 1e-08
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 1e-08
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-08
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 2e-08
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 3e-08
PRK15494339 PRK15494, era, GTPase Era; Provisional 3e-08
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 4e-08
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 4e-08
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 9e-08
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 2e-07
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 2e-07
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 4e-07
cd01898170 cd01898, Obg, Obg GTPase 4e-07
cd11383140 cd11383, YfjP, YfjP GTPase 5e-07
COG1163365 COG1163, DRG, Predicted GTPase [General function p 5e-07
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 5e-07
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 6e-07
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 7e-07
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 7e-07
cd01899318 cd01899, Ygr210, Ygr210 GTPase 9e-07
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 1e-06
cd01900274 cd01900, YchF, YchF GTPase 1e-06
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 1e-06
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 2e-06
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; 4e-06
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 5e-06
cd00881183 cd00881, GTP_translation_factor, GTP translation f 6e-06
cd01878204 cd01878, HflX, HflX GTPase family 7e-06
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 9e-06
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 1e-05
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 1e-05
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 2e-05
cd11383140 cd11383, YfjP, YfjP GTPase 2e-05
COG0536369 COG0536, Obg, Predicted GTPase [General function p 2e-05
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 2e-05
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 3e-05
PRK09554 772 PRK09554, feoB, ferrous iron transport protein B; 3e-05
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 3e-05
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 4e-05
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 4e-05
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 5e-05
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 7e-05
COG2262411 COG2262, HflX, GTPases [General function predictio 2e-04
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 2e-04
PRK15494339 PRK15494, era, GTPase Era; Provisional 2e-04
pfam08477116 pfam08477, Miro, Miro-like protein 2e-04
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 3e-04
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-04
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 4e-04
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 4e-04
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 5e-04
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 5e-04
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 5e-04
COG0012 372 COG0012, COG0012, Predicted GTPase, probable trans 6e-04
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 6e-04
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 0.001
COG1163365 COG1163, DRG, Predicted GTPase [General function p 0.001
COG1162301 COG1162, COG1162, Predicted GTPases [General funct 0.001
pfam03193161 pfam03193, DUF258, Protein of unknown function, DU 0.001
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 0.001
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.002
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 0.002
COG5256 428 COG5256, TEF1, Translation elongation factor EF-1a 0.002
smart00962197 smart00962, SRP54, SRP54-type protein, GTPase doma 0.003
cd04105202 cd04105, SR_beta, Signal recognition particle rece 0.003
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 0.004
PRK11058426 PRK11058, PRK11058, GTPase HflX; Provisional 0.004
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 0.004
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
 Score =  555 bits (1432), Expect = 0.0
 Identities = 198/419 (47%), Positives = 281/419 (67%), Gaps = 10/419 (2%)

Query: 2   KPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFE 61
           KPV+ +VGRPNVGKSTLFNRLT  RDA+VA+ PG+TRDR YGE     + FI+IDTGG E
Sbjct: 1   KPVVAIVGRPNVGKSTLFNRLTGKRDAIVADTPGVTRDRIYGEAEWLGREFILIDTGGIE 60

Query: 62  PEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKS 121
           P+   G   ++ +Q + AI E+D+I+F+VDGR GL   D+ I   LRKS +P++LV+NK 
Sbjct: 61  PD-DDGFEKQIREQAELAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKV 119

Query: 122 ENINSSISL-DFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSI 180
           +  +      +FY LG+G P+ ISA +G GI + L+ IL  ELP ++   +++       
Sbjct: 120 DGPDEEADAYEFYSLGLGEPYPISAEHGRGIGDLLDAILE-ELPEEEEEDEED------- 171

Query: 181 EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGI 240
           E IK+AI+G+PNVGKS+LIN+LLGE RVI  D  GTTRDSI + FE + +KY LIDTAGI
Sbjct: 172 EPIKIAIIGRPNVGKSSLINALLGEERVIVSDIAGTTRDSIDTPFERDGQKYTLIDTAGI 231

Query: 241 RRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCV 300
           RR+ K  E +EK+SVI+TLK+I  A+VV+L++DA + I+ QD+ IA    E+GR+L++ V
Sbjct: 232 RRKGKVTEGVEKYSVIRTLKAIERADVVLLVIDATEGITEQDLRIAGLALEAGRALVIVV 291

Query: 301 NKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLS 360
           NKWD +     +  K  ++++L FL +A   FISA+    ++  +E+I+  Y+++   +S
Sbjct: 292 NKWDLVDEKTMEEFKKELRRRLPFLDYAPIVFISALTGQGVDKLLEAIDEAYENANRRIS 351

Query: 361 TSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           TS + R L  A++ HPP   K  R K++YA Q G NPP  V+  N  + +   YKRYLE
Sbjct: 352 TSVLNRVLEEAVERHPPPLVKGRRLKIKYATQVGTNPPTFVLFVNDPELLPFSYKRYLE 410


Length = 435

>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|206686 cd01899, Ygr210, Ygr210 GTPase Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|236563 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224084 COG1162, COG1162, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|214940 smart00962, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP) Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|182934 PRK11058, PRK11058, GTPase HflX; Provisional Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 419
COG1160444 Predicted GTPases [General function prediction onl 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 100.0
PRK03003472 GTP-binding protein Der; Reviewed 100.0
PRK00093435 GTP-binding protein Der; Reviewed 100.0
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 100.0
COG1159298 Era GTPase [General function prediction only] 99.96
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.95
COG1159298 Era GTPase [General function prediction only] 99.95
COG0486454 ThdF Predicted GTPase [General function prediction 99.95
COG1160 444 Predicted GTPases [General function prediction onl 99.95
KOG1191|consensus531 99.95
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.94
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.94
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.94
PRK15494339 era GTPase Era; Provisional 99.93
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.93
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.93
KOG0084|consensus205 99.93
COG0486454 ThdF Predicted GTPase [General function prediction 99.93
PRK15494339 era GTPase Era; Provisional 99.92
KOG0092|consensus200 99.92
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.92
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.92
PRK00089292 era GTPase Era; Reviewed 99.92
KOG0094|consensus221 99.91
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.91
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.91
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.91
KOG0078|consensus207 99.91
KOG0084|consensus205 99.91
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.91
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.91
KOG0394|consensus210 99.91
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.91
PRK03003 472 GTP-binding protein Der; Reviewed 99.9
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.9
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.9
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.9
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.9
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.9
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.9
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.9
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.9
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.9
PRK12299335 obgE GTPase CgtA; Reviewed 99.9
KOG0094|consensus221 99.9
PRK00089292 era GTPase Era; Reviewed 99.89
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.89
KOG0092|consensus200 99.89
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.89
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.89
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.89
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.89
PRK12298390 obgE GTPase CgtA; Reviewed 99.89
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.89
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.89
COG0218200 Predicted GTPase [General function prediction only 99.89
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.89
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.89
KOG0098|consensus216 99.89
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.89
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.89
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.89
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.89
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.89
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.89
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.89
PRK00093 435 GTP-binding protein Der; Reviewed 99.89
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.89
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.88
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.88
KOG0087|consensus222 99.88
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.88
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.88
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.88
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.88
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.88
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.88
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.88
PRK11058426 GTPase HflX; Provisional 99.88
cd00881189 GTP_translation_factor GTP translation factor fami 99.88
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.88
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.88
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.88
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.88
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.88
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.88
KOG0080|consensus209 99.88
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.88
PRK12296500 obgE GTPase CgtA; Reviewed 99.88
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.88
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.88
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.88
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.88
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.88
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.88
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.88
PLN00223181 ADP-ribosylation factor; Provisional 99.88
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.88
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.88
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.88
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.88
PLN03118211 Rab family protein; Provisional 99.88
PTZ00133182 ADP-ribosylation factor; Provisional 99.88
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.88
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.87
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.87
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.87
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.87
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.87
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.87
KOG0078|consensus207 99.87
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.87
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.87
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.87
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.87
KOG0095|consensus213 99.87
PRK11058426 GTPase HflX; Provisional 99.87
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.87
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.87
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.87
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.87
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.87
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.87
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.87
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.87
PTZ00369189 Ras-like protein; Provisional 99.87
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.87
PRK12299335 obgE GTPase CgtA; Reviewed 99.87
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.87
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.87
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.87
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.87
PLN03110216 Rab GTPase; Provisional 99.87
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.87
PRK04213201 GTP-binding protein; Provisional 99.87
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.87
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.87
PRK12297424 obgE GTPase CgtA; Reviewed 99.87
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.87
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.87
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.87
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.87
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.87
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.87
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.86
KOG0079|consensus198 99.86
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.86
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.86
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.86
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.86
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.86
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.86
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.86
KOG0098|consensus216 99.86
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.86
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.86
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.86
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.86
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.86
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.86
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.86
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.86
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.86
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.86
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.86
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.86
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.86
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.86
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.86
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.86
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.86
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.86
KOG1423|consensus379 99.86
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.86
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.86
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.86
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.86
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.86
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.86
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.86
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.86
KOG0093|consensus193 99.86
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.86
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.86
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.86
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.86
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.86
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.85
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.85
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.85
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.85
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.85
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.85
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.85
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.85
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.85
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.85
PRK12298390 obgE GTPase CgtA; Reviewed 99.85
KOG0087|consensus222 99.85
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.85
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.85
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.85
COG0218200 Predicted GTPase [General function prediction only 99.85
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.85
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.85
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.85
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.85
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.85
KOG0095|consensus213 99.85
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.85
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.85
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.85
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.85
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.85
cd00881189 GTP_translation_factor GTP translation factor fami 99.85
PRK12296500 obgE GTPase CgtA; Reviewed 99.85
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.85
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.85
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.85
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.85
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.84
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.84
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.84
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.84
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.84
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.84
PRK04213201 GTP-binding protein; Provisional 99.84
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.84
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.84
PRK12297424 obgE GTPase CgtA; Reviewed 99.84
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.84
PRK09563287 rbgA GTPase YlqF; Reviewed 99.84
PLN00223181 ADP-ribosylation factor; Provisional 99.84
PRK12317 425 elongation factor 1-alpha; Reviewed 99.84
KOG0394|consensus210 99.84
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.84
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.84
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.84
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.84
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.84
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.84
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.84
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.84
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.84
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.84
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.84
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.84
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.84
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.84
PLN03108210 Rab family protein; Provisional 99.84
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.84
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.84
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.84
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.84
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.84
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.84
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.83
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.83
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.83
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.83
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.83
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.83
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.83
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.83
PTZ00369189 Ras-like protein; Provisional 99.83
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.83
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.83
KOG0080|consensus209 99.83
PTZ00133182 ADP-ribosylation factor; Provisional 99.83
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.83
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.83
KOG1191|consensus531 99.83
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.83
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.83
KOG0091|consensus213 99.83
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.83
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.83
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.83
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.83
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.83
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.83
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.83
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.83
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.83
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.83
KOG0079|consensus198 99.83
KOG1423|consensus379 99.83
KOG0086|consensus214 99.83
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.82
PLN03110216 Rab GTPase; Provisional 99.82
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.82
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.82
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.82
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.82
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.82
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.82
KOG0088|consensus218 99.82
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.82
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.82
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.82
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.82
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.82
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.82
PRK05306 787 infB translation initiation factor IF-2; Validated 99.82
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.82
PLN03118211 Rab family protein; Provisional 99.82
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.82
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.82
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.82
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.82
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.82
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.82
COG1084346 Predicted GTPase [General function prediction only 99.82
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.82
CHL00071 409 tufA elongation factor Tu 99.82
cd01896233 DRG The developmentally regulated GTP-binding prot 99.82
PRK12736 394 elongation factor Tu; Reviewed 99.82
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.82
CHL00189 742 infB translation initiation factor 2; Provisional 99.82
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.82
COG2262411 HflX GTPases [General function prediction only] 99.82
KOG0093|consensus193 99.82
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.82
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.81
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.81
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.81
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.81
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.81
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.81
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.81
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.81
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.81
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.81
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.81
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.81
KOG1489|consensus366 99.81
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.81
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.8
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.8
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.8
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.8
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.8
PLN03108210 Rab family protein; Provisional 99.8
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.8
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.8
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.8
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.8
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.8
KOG0083|consensus192 99.8
PRK12735 396 elongation factor Tu; Reviewed 99.8
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.8
PRK05306787 infB translation initiation factor IF-2; Validated 99.8
cd01896233 DRG The developmentally regulated GTP-binding prot 99.8
KOG0086|consensus214 99.8
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.8
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.79
PRK12289352 GTPase RsgA; Reviewed 99.79
PLN03127 447 Elongation factor Tu; Provisional 99.79
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.79
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.79
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.79
KOG0395|consensus196 99.79
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.79
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.79
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.79
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.79
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.79
KOG0081|consensus219 99.79
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.79
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.79
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.79
PRK00049 396 elongation factor Tu; Reviewed 99.79
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.79
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.78
COG1084346 Predicted GTPase [General function prediction only 99.78
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.78
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.78
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.78
CHL00189742 infB translation initiation factor 2; Provisional 99.78
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.78
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.78
PRK10218 607 GTP-binding protein; Provisional 99.78
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.78
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.78
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.78
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.78
PRK05433 600 GTP-binding protein LepA; Provisional 99.78
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.78
PRK09866 741 hypothetical protein; Provisional 99.77
COG1163365 DRG Predicted GTPase [General function prediction 99.77
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.77
PLN03126 478 Elongation factor Tu; Provisional 99.77
PRK12317425 elongation factor 1-alpha; Reviewed 99.77
COG2262411 HflX GTPases [General function prediction only] 99.77
PRK05433 600 GTP-binding protein LepA; Provisional 99.76
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.76
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.76
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.76
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.76
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.76
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.76
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.76
PRK04004 586 translation initiation factor IF-2; Validated 99.75
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.75
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.75
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.75
PRK10218 607 GTP-binding protein; Provisional 99.75
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.75
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.74
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.74
PTZ00141 446 elongation factor 1- alpha; Provisional 99.74
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.74
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.74
PRK12288347 GTPase RsgA; Reviewed 99.74
KOG1707|consensus 625 99.74
COG0536369 Obg Predicted GTPase [General function prediction 99.74
COG1163365 DRG Predicted GTPase [General function prediction 99.74
KOG0073|consensus185 99.74
KOG0462|consensus 650 99.73
KOG1489|consensus366 99.73
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.73
PRK13796365 GTPase YqeH; Provisional 99.73
PRK12736394 elongation factor Tu; Reviewed 99.73
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.73
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.73
KOG0088|consensus218 99.73
COG3596296 Predicted GTPase [General function prediction only 99.73
COG3596296 Predicted GTPase [General function prediction only 99.73
COG1161322 Predicted GTPases [General function prediction onl 99.73
KOG0091|consensus213 99.73
CHL00071409 tufA elongation factor Tu 99.73
KOG0097|consensus215 99.72
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.72
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.72
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.72
PRK00098298 GTPase RsgA; Reviewed 99.72
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.72
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.72
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.71
PRK00007 693 elongation factor G; Reviewed 99.71
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.71
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.7
PRK12735396 elongation factor Tu; Reviewed 99.7
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.7
PLN03127447 Elongation factor Tu; Provisional 99.7
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.7
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.7
PRK12739 691 elongation factor G; Reviewed 99.7
KOG0395|consensus196 99.7
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.69
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.69
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.69
KOG0097|consensus215 99.69
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.69
KOG1145|consensus 683 99.69
KOG1490|consensus 620 99.69
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.69
PLN00043 447 elongation factor 1-alpha; Provisional 99.69
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.69
COG2229187 Predicted GTPase [General function prediction only 99.68
PRK00049396 elongation factor Tu; Reviewed 99.68
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.68
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.68
PRK09602396 translation-associated GTPase; Reviewed 99.68
PRK13351 687 elongation factor G; Reviewed 99.68
PRK04004 586 translation initiation factor IF-2; Validated 99.67
PLN00023334 GTP-binding protein; Provisional 99.67
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.67
PRK09602396 translation-associated GTPase; Reviewed 99.67
COG1100219 GTPase SAR1 and related small G proteins [General 99.67
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.67
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.66
PRK12739 691 elongation factor G; Reviewed 99.66
cd04105203 SR_beta Signal recognition particle receptor, beta 99.66
KOG4252|consensus246 99.66
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.66
KOG0393|consensus198 99.66
KOG0075|consensus186 99.66
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.66
PLN03126478 Elongation factor Tu; Provisional 99.66
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.66
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.66
PRK00007 693 elongation factor G; Reviewed 99.66
KOG0462|consensus 650 99.65
KOG0081|consensus219 99.65
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.65
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.65
KOG0073|consensus185 99.65
COG0536369 Obg Predicted GTPase [General function prediction 99.64
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.64
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.64
KOG0083|consensus192 99.63
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.63
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.63
PRK00741526 prfC peptide chain release factor 3; Provisional 99.63
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.62
COG2229187 Predicted GTPase [General function prediction only 99.62
KOG0075|consensus186 99.62
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.62
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=5.4e-89  Score=635.44  Aligned_cols=413  Identities=46%  Similarity=0.741  Sum_probs=388.3

Q ss_pred             CC-CEEEEEcCCCCCHHHHHHHHhCCCCceecCCCCCCccceEEEEEECCeEEEEEEcCCCCCcchhhHHHHHHHHHHHH
Q psy17089          1 MK-PVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQA   79 (419)
Q Consensus         1 ~~-~~i~ivG~~~vGKSsl~n~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~   79 (419)
                      |. |.|+|+|+||||||||+|+|++++.++++++||+|+|..++.+.|.++.+.+|||+|+++..++.+.+.+..++..+
T Consensus         1 m~~~~VAIVGRPNVGKSTLFNRL~g~r~AIV~D~pGvTRDr~y~~~~~~~~~f~lIDTgGl~~~~~~~l~~~i~~Qa~~A   80 (444)
T COG1160           1 MSTPVVAIVGRPNVGKSTLFNRLTGRRIAIVSDTPGVTRDRIYGDAEWLGREFILIDTGGLDDGDEDELQELIREQALIA   80 (444)
T ss_pred             CCCCEEEEECCCCCcHHHHHHHHhCCeeeEeecCCCCccCCccceeEEcCceEEEEECCCCCcCCchHHHHHHHHHHHHH
Confidence            66 89999999999999999999999999999999999999999999999999999999999777678999999999999


Q ss_pred             HHhCCEEEEEEeCCCCCCHhHHHHHHHHHhcCCCEEEEEeccCCCCCCcc-hhHHhcCCCCeEEEeeccCCCHHHHHHHH
Q psy17089         80 IIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSIS-LDFYELGIGNPHIISALYGNGIKNFLENI  158 (419)
Q Consensus        80 ~~~~d~il~v~d~~~~~~~~~~~~~~~l~~~~~p~ilv~NK~Dl~~~~~~-~~~~~~~~~~~~~vSa~~~~~v~~l~~~i  158 (419)
                      +..||+++||+|+..+.++.|..++++|++.++|+++|+||+|....+.. .+|+.+|+++++++||.||.|+.+|++.+
T Consensus        81 i~eADvilfvVD~~~Git~~D~~ia~~Lr~~~kpviLvvNK~D~~~~e~~~~efyslG~g~~~~ISA~Hg~Gi~dLld~v  160 (444)
T COG1160          81 IEEADVILFVVDGREGITPADEEIAKILRRSKKPVILVVNKIDNLKAEELAYEFYSLGFGEPVPISAEHGRGIGDLLDAV  160 (444)
T ss_pred             HHhCCEEEEEEeCCCCCCHHHHHHHHHHHhcCCCEEEEEEcccCchhhhhHHHHHhcCCCCceEeehhhccCHHHHHHHH
Confidence            99999999999999999999999999999888999999999999865555 89999999999999999999999999999


Q ss_pred             HHhcCCcchhccccccccccccceeEEEEEeCCCCchhHHHHHHhCCceeeecCCCCccceeeeEeeEEeCeeEEEEeCC
Q psy17089        159 LTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTA  238 (419)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~G~~~~GKSslin~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtp  238 (419)
                      .+.++ .+..     ...+....+++||++|+||||||||+|+|+++++..+++.+|||+|.+...++++++.+.++||+
T Consensus       161 ~~~l~-~~e~-----~~~~~~~~~ikiaiiGrPNvGKSsLiN~ilgeeR~Iv~~~aGTTRD~I~~~~e~~~~~~~liDTA  234 (444)
T COG1160         161 LELLP-PDEE-----EEEEEETDPIKIAIIGRPNVGKSSLINAILGEERVIVSDIAGTTRDSIDIEFERDGRKYVLIDTA  234 (444)
T ss_pred             HhhcC-Cccc-----ccccccCCceEEEEEeCCCCCchHHHHHhccCceEEecCCCCccccceeeeEEECCeEEEEEECC
Confidence            99986 3210     01111136799999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcchHHHHHHHHHHHHHHHhhcCEEEEEecCCCCCCHHHHHHHHHHHHcCCcEEEEEEcccCCCh--hhHHHHHH
Q psy17089        239 GIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIH--NQRKIIKN  316 (419)
Q Consensus       239 G~~~~~~~~~~~e~~~~~~~~~~~~~ad~~i~v~d~~~~~~~~~~~~~~~~~~~~~~~iiv~NK~Dl~~~--~~~~~~~~  316 (419)
                      |+++.....+.+|.|++.+++.++..||++++|+|++.+.+.+|.++..++.+.++++++|+||||+++.  ...+....
T Consensus       235 GiRrk~ki~e~~E~~Sv~rt~~aI~~a~vvllviDa~~~~~~qD~~ia~~i~~~g~~~vIvvNKWDl~~~~~~~~~~~k~  314 (444)
T COG1160         235 GIRRKGKITESVEKYSVARTLKAIERADVVLLVIDATEGISEQDLRIAGLIEEAGRGIVIVVNKWDLVEEDEATMEEFKK  314 (444)
T ss_pred             CCCcccccccceEEEeehhhHhHHhhcCEEEEEEECCCCchHHHHHHHHHHHHcCCCeEEEEEccccCCchhhHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999876  55677888


Q ss_pred             HHHHHcCCCCCCcEEEEeccCCCCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHcCCCCCCCCCceeEEEEecCCCC
Q psy17089        317 NIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKN  396 (419)
Q Consensus       317 ~~~~~~~~~~~~~~~~~SA~~g~gv~~l~~~i~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~q~~~~  396 (419)
                      .+...+.+..+.|++++||++|.|+.++|+.+.+.+..+..+++++.||++|+.++..+|||...|++++++|++|..++
T Consensus       315 ~i~~~l~~l~~a~i~~iSA~~~~~i~~l~~~i~~~~~~~~~ri~Ts~LN~~l~~a~~~~pP~~~~G~r~ki~Ya~q~~~~  394 (444)
T COG1160         315 KLRRKLPFLDFAPIVFISALTGQGLDKLFEAIKEIYECATRRISTSLLNRVLEDAVAKHPPPVRYGRRLKIKYATQVSTN  394 (444)
T ss_pred             HHHHHhccccCCeEEEEEecCCCChHHHHHHHHHHHHHhccccCHHHHHHHHHHHHHhCCCCccCCceEEEEEEecCCCC
Confidence            89999999999999999999999999999999999999999999999999999999999877787999999999999999


Q ss_pred             CCEEEEEecCCCCCChhhhcccC
Q psy17089        397 PPIIVIHGNRLKYIGNDYKRYLE  419 (419)
Q Consensus       397 ~p~~~~~~~~~~~~~~~y~~~~~  419 (419)
                      ||+|++|||+|+.++.+|+|||+
T Consensus       395 PP~fvlf~N~~~~~~~sY~RyL~  417 (444)
T COG1160         395 PPTFVLFGNRPKALHFSYKRYLE  417 (444)
T ss_pred             CCEEEEEecchhhCchHHHHHHH
Confidence            99999999999999999999985



>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
4dcs_A456 Crystal Structure Of B. Subtilis Enga In Complex Wi 4e-66
2hjg_A436 The Crystal Structure Of The B. Subtilis Yphc Gtpas 1e-63
1mky_A439 Structural Analysis Of The Domain Interactions In D 1e-46
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 7e-20
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 4e-15
1xzp_A482 Structure Of The Gtp-Binding Protein Trme From Ther 7e-18
3geh_A462 Crystal Structure Of Mnme From Nostoc In Complex Wi 5e-15
3gee_A476 Crystal Structure Of Mnme From Chlorobium Tepidum I 2e-14
3iev_A308 Crystal Structure Of Era In Complex With Mggnp And 5e-12
3r9w_A307 Crystal Structure Of Era In Complex With Mggdpnp An 5e-12
1rfl_A172 Nmr Data Driven Structural Model Of G-Domain Of Mnm 4e-11
2gj9_A172 Structure Of The Mnme G-Domain In Complex With GdpA 1e-10
2gj8_A172 Structure Of The Mnme G-domain In Complex With Gdp* 3e-10
1wf3_A301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 7e-10
2wjg_A188 Structure And Function Of The Feob G-Domain From Me 3e-08
1x18_X292 Contact Sites Of Era Gtpase On The Thermus Thermoph 4e-08
2wjh_A166 Structure And Function Of The Feob G-Domain From Me 5e-08
1ega_A301 Crystal Structure Of A Widely Conserved Gtpase Era 5e-08
2wji_A165 Structure And Function Of The Feob G-Domain From Me 5e-08
2wjj_A168 Structure And Function Of The Feob G-Domain From Me 9e-08
3iby_A256 Structure Of Cytosolic Domain Of L. Pneumophila Feo 3e-06
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 4e-06
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 2e-05
3qq5_A 423 Crystal Structure Of The [fefe]-Hydrogenase Maturat 7e-06
2e87_A357 Crystal Structure Of Hypothetical Gtp-Binding Prote 1e-04
2dwq_A368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 1e-04
2dby_A368 Crystal Structure Of The Gtp-Binding Protein Ychf I 1e-04
3a1w_A168 Crystal Structue Of The G Domain Of T. Maritima Feo 2e-04
3pqc_A195 Crystal Structure Of Thermotoga Maritima Ribosome B 2e-04
3hyt_A270 Structural Basis Of Gdp Release And Gating In G Pro 2e-04
3i8s_A274 Structure Of The Cytosolic Domain Of E. Coli Feob, 2e-04
3a1t_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 2e-04
3a1s_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 2e-04
3hyr_A270 Structural Insight Into G Protein Coupling And Regu 2e-04
4dhe_A223 Crystal Structure Of A Probable Gtp-Binding Protein 7e-04
2qtf_A364 Crystal Structure Of A Gtp-Binding Protein From The 8e-04
>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 Back     alignment and structure

Iteration: 1

Score = 248 bits (633), Expect = 4e-66, Method: Compositional matrix adjust. Identities = 140/429 (32%), Positives = 233/429 (54%), Gaps = 28/429 (6%) Query: 2 KPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF- 60 KPV+ +VGRPNVGKST+FNR+ R ++V + PG+TRDR Y F +IDTGG Sbjct: 23 KPVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGGID 82 Query: 61 ---EPEVKKGIMHEMTKQTKQAXXXXXXXXXXVDGRQGLVEQDKLITNFLRKSGQPIVL- 116 EP + ++ +Q + A V+GR+G+ D+ + L ++ +P+VL Sbjct: 83 IGDEP-----FLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLA 137 Query: 117 VXXXXXXXXXXXXLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTN 176 V DFY LG G P+ IS +G G+ + L+ + + F N Sbjct: 138 VNKLDNTEMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAV------------AEHFKN 185 Query: 177 IHSIEY----IKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKY 232 I +Y I+ ++G+PNVGKS+L+N++LGE RVI + GTTRD++ + F YN +++ Sbjct: 186 IPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNVAGTTRDAVDTSFTYNQQEF 245 Query: 233 ILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYES 292 +++DTAG+R++ K +E EK+SV++ LK+I + VV ++LD ++ I QD IA + +E+ Sbjct: 246 VIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEA 305 Query: 293 GRSLIVCVNKWDSXXXXXXXXXXXXXXXXX--XFLSFAMFNFISAIKLNNINSFMESINH 350 G+++++ VNKWD+ FL +A F+SA+ I++ M +I Sbjct: 306 GKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIK 365 Query: 351 VYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYI 410 ++ + + T+ + ++ A+ +P R K+ YA Q PP V+ N + + Sbjct: 366 ASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELM 425 Query: 411 GNDYKRYLE 419 Y+R+LE Sbjct: 426 HFSYERFLE 434
>pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 Back     alignment and structure
>pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 Back     alignment and structure
>pdb|3GEE|A Chain A, Crystal Structure Of Mnme From Chlorobium Tepidum In Complex With Gdp And Folinic Acid Length = 476 Back     alignment and structure
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure
>pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 Back     alignment and structure
>pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 Back     alignment and structure
>pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure
>pdb|2WJG|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 188 Back     alignment and structure
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 Back     alignment and structure
>pdb|2WJH|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 166 Back     alignment and structure
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 Back     alignment and structure
>pdb|2WJI|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 165 Back     alignment and structure
>pdb|2WJJ|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 168 Back     alignment and structure
>pdb|3IBY|A Chain A, Structure Of Cytosolic Domain Of L. Pneumophila Feob Length = 256 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 Back     alignment and structure
>pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 Back     alignment and structure
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure
>pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 Back     alignment and structure
>pdb|3PQC|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Biogenesis Gtp- Binding Protein Engb (YsxcYIHA) IN COMPLEX WITH GDP Length = 195 Back     alignment and structure
>pdb|3HYT|A Chain A, Structural Basis Of Gdp Release And Gating In G Protein Coupled Fe2+ Transport Length = 270 Back     alignment and structure
>pdb|3I8S|A Chain A, Structure Of The Cytosolic Domain Of E. Coli Feob, Nucleotide-Free Form Length = 274 Back     alignment and structure
>pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 Back     alignment and structure
>pdb|3A1S|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form I Length = 258 Back     alignment and structure
>pdb|3HYR|A Chain A, Structural Insight Into G Protein Coupling And Regulation Of Fe2+ Membrane Transport Length = 270 Back     alignment and structure
>pdb|4DHE|A Chain A, Crystal Structure Of A Probable Gtp-Binding Protein Engb From Burkholderia Thailandensis Length = 223 Back     alignment and structure
>pdb|2QTF|A Chain A, Crystal Structure Of A Gtp-Binding Protein From The Hyperthermophilic Archaeon Sulfolobus Solfataricus Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 0.0
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 0.0
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 1e-73
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 4e-32
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 2e-38
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 4e-27
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 5e-35
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 8e-23
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 3e-33
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 7e-29
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 6e-32
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 2e-22
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 9e-32
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 3e-23
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 5e-31
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 2e-23
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 7e-28
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 7e-13
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 4e-25
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 6e-06
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 4e-22
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-20
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 8e-22
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 2e-20
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 1e-21
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 7e-20
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 2e-20
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 5e-09
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 2e-18
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 3e-10
2wji_A165 Ferrous iron transport protein B homolog; membrane 2e-15
2wji_A165 Ferrous iron transport protein B homolog; membrane 3e-08
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 4e-15
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 1e-07
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 5e-15
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 4e-08
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 1e-14
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 4e-08
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 1e-14
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 2e-06
3iby_A256 Ferrous iron transport protein B; G protein, G dom 2e-13
3iby_A256 Ferrous iron transport protein B; G protein, G dom 6e-08
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 3e-13
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 6e-05
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 4e-13
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 3e-07
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 4e-13
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 8e-07
3cnl_A262 YLQF, putative uncharacterized protein; circular p 1e-12
3cnl_A262 YLQF, putative uncharacterized protein; circular p 2e-07
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 5e-12
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 2e-07
3lxx_A239 GTPase IMAP family member 4; structural genomics c 5e-12
3lxx_A239 GTPase IMAP family member 4; structural genomics c 2e-08
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 4e-11
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 4e-06
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 8e-11
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 1e-07
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 1e-10
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 1e-07
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 2e-10
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 1e-06
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 2e-10
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 5e-04
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 4e-10
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3lxw_A247 GTPase IMAP family member 1; immunity, structural 6e-10
3lxw_A247 GTPase IMAP family member 1; immunity, structural 8e-05
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 6e-10
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 5e-08
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 4e-08
1wxq_A397 GTP-binding protein; structural genomics, riken st 1e-07
1wxq_A 397 GTP-binding protein; structural genomics, riken st 4e-05
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 1e-07
1jal_A363 YCHF protein; nucleotide-binding fold, structural 5e-07
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 9e-07
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 3e-06
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 4e-04
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 2e-05
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 3e-04
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 2e-04
3llu_A196 RAS-related GTP-binding protein C; structural geno 4e-04
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 5e-04
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
 Score =  540 bits (1394), Expect = 0.0
 Identities = 147/421 (34%), Positives = 256/421 (60%), Gaps = 12/421 (2%)

Query: 2   KPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFE 61
           KPV+ +VGRPNVGKST+FNR+   R ++V + PG+TRDR Y         F +IDTGG +
Sbjct: 3   KPVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGGID 62

Query: 62  PEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKS 121
               +  + ++ +Q + A+ E+D+IIF+V+GR+G+   D+ +   L ++ +P+VL +NK 
Sbjct: 63  IG-DEPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKL 121

Query: 122 ENINSSISL-DFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSI 180
           +N     ++ DFY LG G P+ IS  +G G+ + L+ +        + FK    T  +  
Sbjct: 122 DNTEMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVA-------EHFKNIPETKYNE- 173

Query: 181 EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGI 240
           E I+  ++G+PNVGKS+L+N++LGE RVI  +  GTTRD++ + F YN ++++++DTAG+
Sbjct: 174 EVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNVAGTTRDAVDTSFTYNQQEFVIVDTAGM 233

Query: 241 RRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCV 300
           R++ K +E  EK+SV++ LK+I  + VV ++LD ++ I  QD  IA + +E+G+++++ V
Sbjct: 234 RKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVV 293

Query: 301 NKWDSIIHNQRKI--IKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIH 358
           NKWD++  ++  +   + NI+    FL +A   F+SA+    I++ M +I    ++  + 
Sbjct: 294 NKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLR 353

Query: 359 LSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYL 418
           + T+ +   ++ A+  +P       R K+ YA Q    PP  V+  N  + +   Y+R+L
Sbjct: 354 VQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFL 413

Query: 419 E 419
           E
Sbjct: 414 E 414


>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 100.0
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 100.0
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 100.0
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.94
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.94
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.94
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.94
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.94
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.93
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.93
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.93
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.92
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.92
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.92
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.91
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.91
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.91
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.91
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.91
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.91
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.91
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.91
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.91
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.91
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.91
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.91
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.91
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.91
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.9
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.9
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.9
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.9
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.9
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.9
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.9
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.9
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.9
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.9
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.9
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.9
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.9
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.9
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.9
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.9
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.9
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.9
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.9
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.9
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.9
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.89
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.89
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.89
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.89
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.89
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.89
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.89
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.89
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.89
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.89
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.89
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.89
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.89
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.89
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.89
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.89
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.89
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.89
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.89
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.89
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.89
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.89
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.89
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.89
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.89
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.89
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.89
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.89
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.88
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.88
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.88
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.88
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.88
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.88
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.88
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.88
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.88
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.88
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.88
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.88
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.88
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.88
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.88
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.88
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.88
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.88
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.88
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.88
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.88
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.88
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.88
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.88
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.88
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.88
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.88
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.88
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.88
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.88
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.88
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.88
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.88
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.88
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.88
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.88
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.88
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.88
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.88
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.87
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.87
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.87
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.87
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.87
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.87
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.87
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.87
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.87
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.87
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.87
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.87
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.87
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.87
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.87
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.87
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.87
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.87
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.87
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.87
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.87
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.87
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.87
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.87
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.87
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.87
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.87
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.87
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.87
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.86
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.86
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.86
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.86
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.86
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.86
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.86
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.86
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.86
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.86
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.86
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.86
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.86
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.86
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.86
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.86
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.86
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.86
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.86
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.86
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.85
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.85
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.85
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.85
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.85
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.85
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.85
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.85
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.85
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.85
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.85
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.85
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.85
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.85
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.85
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.85
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.85
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.85
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.85
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.85
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.85
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.85
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.85
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.85
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.85
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.85
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.85
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.85
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.85
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.85
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.85
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.85
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.85
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.85
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.85
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.85
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.85
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.85
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.75
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.84
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.84
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.84
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.84
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.84
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.84
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.84
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.84
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.84
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.84
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.84
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.84
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.84
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.84
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.84
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.84
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.84
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.84
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.84
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.84
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.84
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.84
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.84
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.84
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.84
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.84
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.84
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.84
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.83
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.83
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.83
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.83
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.83
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.83
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.83
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.83
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.83
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.83
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.83
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.83
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.83
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.83
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.83
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.83
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.83
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.83
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.82
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.82
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.82
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.82
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.82
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.82
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.82
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.82
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.82
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.82
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.82
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.82
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.82
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.82
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.82
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.82
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.82
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.82
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.82
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.82
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.81
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.81
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.81
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.81
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.81
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.81
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.81
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.81
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.81
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.81
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.81
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.8
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.8
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.8
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.8
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.8
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.8
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.79
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.79
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.79
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.79
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.79
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.66
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.79
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.79
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.79
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.78
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.78
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.78
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.78
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.78
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.78
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.78
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.78
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.77
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.77
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.77
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.77
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.77
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.77
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.76
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.76
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.76
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.76
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.76
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.75
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.75
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.75
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.75
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.75
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.75
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.74
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.74
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.74
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.74
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.74
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.74
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.74
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.73
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.73
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.73
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.72
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.72
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.72
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.72
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.71
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.71
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.71
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.71
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.71
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.71
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.7
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.7
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.7
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.7
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.7
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.7
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.7
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.69
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.69
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.69
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.68
2ged_A193 SR-beta, signal recognition particle receptor beta 99.68
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.68
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.68
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.68
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.67
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.67
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.67
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.67
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.66
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.66
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.66
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.65
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.65
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.65
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.63
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.63
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.63
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.62
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 99.62
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.61
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.61
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.61
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.61
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.6
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.6
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.59
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.58
2ged_A193 SR-beta, signal recognition particle receptor beta 99.58
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.57
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.57
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.55
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.5
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.5
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.49
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.49
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.48
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.48
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.47
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.45
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.45
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.43
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.43
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.41
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.41
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.39
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.38
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.37
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.33
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.32
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.26
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.26
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.25
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 99.24
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.24
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.21
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.19
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.19
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.18
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.17
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.13
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.12
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.12
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.11
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.1
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 99.1
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.09
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 99.09
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.04
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 99.02
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.98
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.96
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.94
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.89
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.88
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.86
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.75
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.71
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.69
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.69
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.64
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.63
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.55
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.47
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.46
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 98.42
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.41
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.37
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.27
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.24
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.18
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.17
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.16
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.13
2xxa_A433 Signal recognition particle protein; protein trans 98.05
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.96
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.95
2xxa_A433 Signal recognition particle protein; protein trans 97.91
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.89
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.81
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.72
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.69
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.66
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.59
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.56
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.56
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.51
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.4
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.31
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.3
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.3
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.28
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.19
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.19
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.14
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.09
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.08
2og2_A359 Putative signal recognition particle receptor; nuc 97.07
2og2_A359 Putative signal recognition particle receptor; nuc 97.05
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.04
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.01
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.96
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.93
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 96.89
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.86
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.77
3cwq_A209 Para family chromosome partitioning protein; alpha 96.66
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.66
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.66
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.6
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.59
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.59
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 96.52
3cwq_A209 Para family chromosome partitioning protein; alpha 96.47
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.35
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.32
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.3
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.3
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 96.29
3end_A307 Light-independent protochlorophyllide reductase ir 96.29
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.28
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.27
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.27
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.21
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 96.19
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=2e-75  Score=575.01  Aligned_cols=410  Identities=35%  Similarity=0.640  Sum_probs=337.0

Q ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCCCCceecCCCCCCccceEEEEEECCeEEEEEEcCCCCCcchhhHHHHHHHHHHHHH
Q psy17089          1 MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAI   80 (419)
Q Consensus         1 ~~~~i~ivG~~~vGKSsl~n~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~~   80 (419)
                      ++++|+|+|++|||||||+|+|++...+.+.+.+++|+|..+..+.+++..+.+|||||++... +.+.+.+..++..++
T Consensus         2 ~~~~V~ivG~~nvGKStL~n~l~~~~~~~v~~~~g~T~d~~~~~~~~~~~~~~l~DT~G~~~~~-~~~~~~~~~~~~~~~   80 (436)
T 2hjg_A            2 GKPVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGGIDIGD-EPFLAQIRQQAEIAM   80 (436)
T ss_dssp             -CCEEEEECSTTSSHHHHHHHHEEEECC-----------CEEEECTTCSSCCEEEC----------CHHHHHHHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCceeecCCCCCccceEEEEEEECCceEEEEECCCCCCcc-hhHHHHHHHHHHHHH
Confidence            1589999999999999999999998777788999999999999999999999999999997443 236667888889999


Q ss_pred             HhCCEEEEEEeCCCCCCHhHHHHHHHHHhcCCCEEEEEeccCCCCCCcc-hhHHhcCCCCeEEEeeccCCCHHHHHHHHH
Q psy17089         81 IESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSIS-LDFYELGIGNPHIISALYGNGIKNFLENIL  159 (419)
Q Consensus        81 ~~~d~il~v~d~~~~~~~~~~~~~~~l~~~~~p~ilv~NK~Dl~~~~~~-~~~~~~~~~~~~~vSa~~~~~v~~l~~~i~  159 (419)
                      .+||+++||+|++++.+..+.++.+++++.++|+++|+||+|+...... .+++.+++.+++++||++|.|+++|++.+.
T Consensus        81 ~~ad~il~vvD~~~~~~~~d~~~~~~l~~~~~pvilv~NK~D~~~~~~~~~~~~~lg~~~~~~iSA~~g~gv~~L~~~i~  160 (436)
T 2hjg_A           81 DEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNTEMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVA  160 (436)
T ss_dssp             HHCSEEEEEEETTTCSCHHHHHHHHHHTTCCSCEEEEEECCCC-----CCCSSGGGSSCCCEECBTTTTBTHHHHHHHHH
T ss_pred             HhCCEEEEEEeCCCCCCHHHHHHHHHHHHcCCCEEEEEECccCccchhhHHHHHHcCCCCeEEEeCcCCCChHHHHHHHH
Confidence            9999999999999999999999999999899999999999999865443 566777887899999999999999999999


Q ss_pred             HhcCCcchhccccccccccccceeEEEEEeCCCCchhHHHHHHhCCceeeecCCCCccceeeeEeeEEeCeeEEEEeCCC
Q psy17089        160 TIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG  239 (419)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~i~l~G~~~~GKSslin~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG  239 (419)
                      +.+++.+.        ....+..++|+++|++|||||||+|+|++.+...+++++|+|.+.....+.+++..+.+|||||
T Consensus       161 ~~l~~~~~--------~~~~~~~~ki~lvG~~nvGKSSLin~l~~~~~~~~~~~~gtT~d~~~~~~~~~~~~~~l~DT~G  232 (436)
T 2hjg_A          161 EHFKNIPE--------TKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNVAGTTRDAVDTSFTYNQQEFVIVDTAG  232 (436)
T ss_dssp             HTGGGCCS--------SCCCTTCEEEEEECSTTSSHHHHHHHHHTSTTEEEC---------CCEEEEETTEEEEETTHHH
T ss_pred             HhcCcccc--------ccccccCcEEEEEcCCCCCHHHHHHHHhCCCceeecCCCCceeeeeEEEEEECCeEEEEEECCC
Confidence            88864321        0112466899999999999999999999998777899999999999889999999999999999


Q ss_pred             CCCCCcchHHHHHHHHHHHHHHHhhcCEEEEEecCCCCCCHHHHHHHHHHHHcCCcEEEEEEcccCCChhh--HHHHHHH
Q psy17089        240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQ--RKIIKNN  317 (419)
Q Consensus       240 ~~~~~~~~~~~e~~~~~~~~~~~~~ad~~i~v~d~~~~~~~~~~~~~~~~~~~~~~~iiv~NK~Dl~~~~~--~~~~~~~  317 (419)
                      +.+.....+.+|+|+..++..+++.||++++|+|++++.++++.+++..+.+.++|+++|+||||+.+...  ..+..+.
T Consensus       233 ~~~~~~~~~~~e~~~~~~~~~~~~~ad~~llv~D~~~~~s~~~~~~~~~~~~~~~~iiiv~NK~Dl~~~~~~~~~~~~~~  312 (436)
T 2hjg_A          233 MRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEEN  312 (436)
T ss_dssp             HTCBTTBCCCCSHHHHHHHHHHHHHCSEEEEEEETTTCCCHHHHHHHHHHHHTTCEEEEEEECGGGSCCCTTHHHHHHHH
T ss_pred             cCcCccccchHHHHHHHHHHHHHHhCCEEEEEEcCCcCCcHHHHHHHHHHHHcCCcEEEEEECccCCCcchHHHHHHHHH
Confidence            98776555566888877788899999999999999999999999999999889999999999999986433  3445666


Q ss_pred             HHHHcCCCCCCcEEEEeccCCCCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHcCCCCCCCCCceeEEEEecCCCCC
Q psy17089        318 IKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNP  397 (419)
Q Consensus       318 ~~~~~~~~~~~~~~~~SA~~g~gv~~l~~~i~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~q~~~~~  397 (419)
                      +.+.+....+++++++||++|.|++++|+.+.+.+..+..+++++.+++++++++..+++|...+++++++|++|...+|
T Consensus       313 ~~~~l~~~~~~~~~~~SA~tg~~v~~l~~~i~~~~~~~~~~~~t~~ln~~l~~~~~~~~pp~~~~~~~~i~y~~q~~~~p  392 (436)
T 2hjg_A          313 IRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKP  392 (436)
T ss_dssp             HHHHCGGGTTSCEEECCTTTCTTGGGHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHSCCCEETTEECCEEEEEEEETTT
T ss_pred             HHHhcccCCCCCEEEEecccCCCHHHHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHhCCCCccCCcceeEEeEecCCCCC
Confidence            77777777778999999999999999999999999999999999999999999999999999899999999999999999


Q ss_pred             CEEEEEecCCCCCChhhhcccC
Q psy17089        398 PIIVIHGNRLKYIGNDYKRYLE  419 (419)
Q Consensus       398 p~~~~~~~~~~~~~~~y~~~~~  419 (419)
                      |+|++|+|+|+.++++|+|||+
T Consensus       393 p~~~~~~n~~~~~~~~y~r~l~  414 (436)
T 2hjg_A          393 PSFVVFVNDPELMHFSYERFLE  414 (436)
T ss_dssp             TEEEEEESCGGGCCHHHHHHHH
T ss_pred             CEEEEEeCCcccCCHHHHHHHH
Confidence            9999999999999999999985



>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 419
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 2e-27
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 0.004
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 7e-24
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 7e-18
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 5e-23
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 6e-23
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 5e-22
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.001
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 6e-21
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 8e-18
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 1e-20
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 2e-15
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 5e-20
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 8e-13
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 1e-18
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 4e-15
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 2e-17
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 1e-15
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 1e-16
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 1e-16
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 1e-15
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 2e-10
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 2e-14
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 7e-12
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 6e-14
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 7e-14
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 1e-13
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-09
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 2e-13
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 5e-13
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 2e-12
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 4e-10
d1mkya381 d.52.5.1 (A:359-439) Probable GTPase Der, C-termin 4e-12
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 8e-11
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 5e-07
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 2e-10
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 6e-05
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 5e-10
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 5e-06
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 3e-09
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 6e-05
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 2e-08
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 4e-07
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 4e-08
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 9e-06
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 5e-08
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 3e-06
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 8e-08
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 2e-04
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-07
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-05
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-07
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 5e-05
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 3e-07
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 0.004
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 4e-07
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 7e-05
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-07
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-06
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 1e-06
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-06
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 0.001
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-06
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 7e-06
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 1e-05
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 0.003
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 1e-05
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 2e-04
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-05
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-04
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 2e-05
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 0.001
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 2e-05
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 0.003
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 2e-05
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 3e-05
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 7e-05
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 5e-05
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 6e-05
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 0.002
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 8e-05
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 1e-04
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 2e-04
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 1e-04
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 0.001
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 1e-04
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 2e-04
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 3e-04
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 3e-04
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 0.001
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 3e-04
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 3e-04
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 3e-04
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 4e-04
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 0.003
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-04
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 5e-04
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 5e-04
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 6e-04
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 7e-04
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 7e-04
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 0.001
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 0.002
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 0.002
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 0.002
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 0.003
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 0.003
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 0.003
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
 Score =  107 bits (269), Expect = 2e-27
 Identities = 43/179 (24%), Positives = 81/179 (45%), Gaps = 12/179 (6%)

Query: 69  MHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSI 128
           M +  ++  + +   DI+  +VD R  +  ++ +I + L+   +P ++++NK++  ++++
Sbjct: 2   MAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKN--KPRIMLLNKADKADAAV 59

Query: 129 ---SLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKV 185
                + +E        I+++ G G+   +     I        + K          I+ 
Sbjct: 60  TQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRA----IRA 115

Query: 186 AIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRN 244
            I+G PNVGKSTLIN L  +N   T D PG T       +    K+  L+DT GI    
Sbjct: 116 LIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQ---WVKVGKELELLDTPGILWPK 171


>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1mkya3 d.52.5.1 (A:359-439) Probable GTPase Der, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 81 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.95
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.95
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.94
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.94
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.93
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.93
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.93
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.93
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.91
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.91
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.91
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.91
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.91
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.91
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.91
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.9
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.9
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.9
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.9
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.9
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.89
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.89
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.89
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.89
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.89
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.89
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.89
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.89
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.88
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.88
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.88
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.88
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.88
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.88
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.88
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.88
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.88
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.87
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.87
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.87
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.87
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.86
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.86
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.86
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.86
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.86
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.86
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.86
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.86
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.85
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.85
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.85
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.85
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.84
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.84
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.84
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.83
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.83
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.83
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.83
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.83
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.82
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.82
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.82
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.82
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.82
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.82
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.82
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.81
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.8
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.8
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.8
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.8
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.8
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.8
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.79
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.79
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.77
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.77
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.76
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.76
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.75
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.74
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.73
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.73
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.72
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.72
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.72
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.71
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.71
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.7
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.7
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.69
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.69
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.68
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.68
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.66
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.65
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.65
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.64
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.63
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.62
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.6
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.58
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.56
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.55
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.55
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.54
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.54
d1mkya381 Probable GTPase Der, C-terminal domain {Thermotoga 99.53
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.53
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.52
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.49
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.47
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.43
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.39
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.31
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.29
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.28
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.27
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.26
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.25
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.23
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.22
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.19
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.15
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.12
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.11
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.95
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.94
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.73
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.46
d2qy9a2211 GTPase domain of the signal recognition particle r 98.18
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.12
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.12
d1vmaa2213 GTPase domain of the signal recognition particle r 98.1
d1vmaa2213 GTPase domain of the signal recognition particle r 98.09
d2qy9a2211 GTPase domain of the signal recognition particle r 98.07
d1okkd2207 GTPase domain of the signal recognition particle r 98.02
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.0
d1okkd2207 GTPase domain of the signal recognition particle r 97.96
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.86
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.82
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.77
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.68
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.61
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.6
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.48
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.27
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.2
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.16
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.13
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.1
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.06
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.01
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.9
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.86
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.66
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.59
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.57
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.56
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.53
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.5
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.47
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.43
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.43
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.41
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.4
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.31
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.31
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.26
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.25
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.25
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.21
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.19
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.17
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.16
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.13
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.07
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.02
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.01
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.0
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.99
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.92
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.92
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.91
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.9
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.9
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.89
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.88
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.88
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.88
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.86
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.84
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.84
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.83
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.82
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.8
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.8
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.79
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.79
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.77
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.73
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.71
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.68
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.68
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.68
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.66
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.64
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.64
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.63
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.61
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.57
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.57
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.55
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.51
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.51
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.49
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.47
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.46
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.45
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.44
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.44
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.43
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.43
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.42
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.42
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.4
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.4
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.39
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.38
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.38
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.37
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.37
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.37
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.36
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.36
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.33
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.32
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.31
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.29
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.27
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.27
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.25
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.21
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.2
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.18
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.17
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 95.17
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.14
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.11
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.1
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.02
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.99
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.99
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.98
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.95
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.94
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.93
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.92
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.9
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.89
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.87
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.84
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.74
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.73
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.7
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.7
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.66
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.61
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.6
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.52
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.49
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.48
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.4
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.38
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.34
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.3
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.27
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.23
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.21
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.18
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.09
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.93
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.92
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.9
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.87
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.81
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.8
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.77
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.71
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.56
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.25
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.11
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.09
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.09
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.02
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.02
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.94
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.91
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.89
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.83
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.79
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.76
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.62
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 92.6
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.51
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.39
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.36
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.16
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.15
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.11
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.01
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.98
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.92
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.89
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.81
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.78
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.72
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.54
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.5
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.46
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 91.29
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.22
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.14
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.11
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.08
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.04
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.95
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 90.91
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 90.91
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.85
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.84
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.83
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.58
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.38
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.3
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.24
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.15
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 89.86
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.83
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.78
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.73
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.68
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.63
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.59
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 89.51
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 89.49
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.47
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.44
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.37
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.3
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.23
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.21
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.14
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.14
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.07
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.06
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.98
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.92
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 88.63
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 88.6
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.44
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.31
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.11
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.99
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 87.97
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.88
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.88
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.78
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 87.78
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 87.61
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 87.53
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.25
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.03
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 86.96
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.87
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 86.83
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 86.82
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 86.77
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.6
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 86.46
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 86.44
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.23
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 86.11
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 85.66
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 85.52
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 85.42
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 85.41
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 84.83
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.82
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.76
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 84.76
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.54
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.48
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 84.36
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 84.3
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 83.62
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 83.55
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.49
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 83.43
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 83.3
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 83.26
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 83.11
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 82.94
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 82.86
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 82.73
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 82.55
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 82.43
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.38
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 82.28
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 82.22
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 82.21
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 82.02
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 81.74
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 81.6
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 81.51
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 81.44
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 81.14
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 80.27
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Thermus thermophilus [TaxId: 274]
Probab=99.95  E-value=1.5e-27  Score=203.60  Aligned_cols=164  Identities=26%  Similarity=0.403  Sum_probs=138.4

Q ss_pred             CEEEEEcCCCCCHHHHHHHHhCCCCceecCCCCCCccceEEEEEECCeEEEEEEcCCCCCcchhhHHHHHHHHHHHHHHh
Q psy17089          3 PVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIE   82 (419)
Q Consensus         3 ~~i~ivG~~~vGKSsl~n~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~~~~   82 (419)
                      ++|+|+|.+|||||||+|+|++.+.+.+++.+++|.+.........+..+.+|||||+.... ......+...+..++.+
T Consensus         6 ~~I~lvG~~~~GKSSLin~l~~~~~~~~~~~~~tt~~~~~~~~~~~~~~~~~~DtpG~~~~~-~~~~~~~~~~~~~~~~~   84 (178)
T d1wf3a1           6 GFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTPGLHKPM-DALGEFMDQEVYEALAD   84 (178)
T ss_dssp             EEEEEECSTTSSHHHHHHHHHTSCCSCCCSSSCCCCSCEEEEEEETTEEEEEEECCCCCCCC-SHHHHHHHHHHHHHTSS
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCCceeecccCCcccccccceeeeeeeeeeecccccccccc-cccchhccccccccccc
Confidence            47999999999999999999998877788899999999999999999999999999997543 22333455667778899


Q ss_pred             CCEEEEEEeCCCCCCHhHHHHHHHHHh--cCCCEEEEEeccCCCCCCcc-hhHH--hcCCCCeEEEeeccCCCHHHHHHH
Q psy17089         83 SDIIIFIVDGRQGLVEQDKLITNFLRK--SGQPIVLVINKSENINSSIS-LDFY--ELGIGNPHIISALYGNGIKNFLEN  157 (419)
Q Consensus        83 ~d~il~v~d~~~~~~~~~~~~~~~l~~--~~~p~ilv~NK~Dl~~~~~~-~~~~--~~~~~~~~~vSa~~~~~v~~l~~~  157 (419)
                      ||++++|+|++++....+.++.+++++  .++|+++|+||+|+.+..+. .+.+  ..+...++++||++|.|+++|++.
T Consensus        85 ad~il~v~D~~~~~~~~~~~i~~~l~~~~~~~piilv~NK~Dl~~~~~~~~~~~~~~~~~~~~~~iSA~~~~gi~~L~~~  164 (178)
T d1wf3a1          85 VNAVVWVVDLRHPPTPEDELVARALKPLVGKVPILLVGNKLDAAKYPEEAMKAYHELLPEAEPRMLSALDERQVAELKAD  164 (178)
T ss_dssp             CSEEEEEEETTSCCCHHHHHHHHHHGGGTTTSCEEEEEECGGGCSSHHHHHHHHHHTSTTSEEEECCTTCHHHHHHHHHH
T ss_pred             ccceeeeechhhhhcccccchhhheeccccchhhhhhhcccccccCHHHHHHHHHhhcccCceEEEecCCCCCHHHHHHH
Confidence            999999999999999988889999876  36799999999999776554 3333  345567899999999999999999


Q ss_pred             HHHhcCCcch
Q psy17089        158 ILTIELPYKK  167 (419)
Q Consensus       158 i~~~~~~~~~  167 (419)
                      |.+.+|+.+.
T Consensus       165 i~~~lpe~p~  174 (178)
T d1wf3a1         165 LLALMPEGPF  174 (178)
T ss_dssp             HHTTCCBCCC
T ss_pred             HHHhCCCCCC
Confidence            9999987643



>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya3 d.52.5.1 (A:359-439) Probable GTPase Der, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure