Psyllid ID: psy17089

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42

MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE

cccEEEEEccccccHHHHHHHHHccccEEEcccccccccccccEEEEccEEEEEEEccccccccccHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHccccccEEccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccccccccccEEEccEEEEEEEccccccccccccccHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHHccEEEEEEEcccccccccHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccEEEEEEcccccccEEEEEEccccccccccccccc

cccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHccccccccccEEEEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHccHHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHcHcccccEEEEEccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccccEEEEEEccHHHcccHHHHHcc

MKPVLVLvgrpnvgkstlfnrltnsrdalvanypgltrdrhygegyigkkSFIIidtggfepevkKGIMHEMTKQTKQAIIESDIIIFIVDgrqglveqDKLITNFLRKSGQPIVLVINKseninssisldfyelgignpHIISALYGNGIKNFLENILTIElpykkffkkkeftnihSIEYIKVAIvgkpnvgkSTLINSllgenrvitydtpgttrDSIKSLFEynnkkyilidtagirrrnKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIknhppcrkklirpklryahqggknppiiviHGNRLKYIGNDYKRYLE

mkpvlvlvgrpnvgkstlfnrltnsrdaLVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINsllgenrvitydtpgttrdsikslfeynnkkyilidtagirrrnKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISaiknhppcrkKLIRPKLRyahqggknppiivihgnrlkyiGNDYKRYLE

MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAiiesdiiifiVDGRQGLVEQDKLITNFLRKSGQPIVLVinkseninssisLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSiihnqrkiiknnikkklnFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE

***VLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKR***

MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPY***************EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE

MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELP************IHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		419	2.2.26 [Sep-21-2011]
A6SZW6		447	GTPase Der OS=Janthinobac	yes	N/A	0.992	0.930	0.607	1e-153
A4G4K6		447	GTPase Der OS=Herminiimon	yes	N/A	0.992	0.930	0.604	1e-151
A0K7T2		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.576	1e-145
B1JT88		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.576	1e-145
Q1BGX0		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.576	1e-145
B4EAW5		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.576	1e-145
Q39FR3		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.571	1e-145
B1YR40		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.569	1e-145
Q63US9		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.573	1e-145
A3NA49		445	GTPase Der OS=Burkholderi	yes	N/A	0.990	0.932	0.573	1e-145

>sp\|A6SZW6\|DER_JANMA GTPase Der OS=Janthinobacterium sp. (strain Marseille) GN=der PE=3 SV=1	Back alignment and function desciption

 Score =  542 bits (1396), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/420 (60%), Positives = 334/420 (79%), Gaps = 4/420 (0%)

Query: 1   MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF 60
           MKPV+ L+GRPNVGKSTLFNRLT SRDALVA+ PGLTRDRHYGEG +G++ F++IDTGGF
Sbjct: 1   MKPVIALIGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF 60

Query: 61  EPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINK 120
           EP  K+GIMHEM KQTKQA+ E+D++IFIVDGRQGL   DK IT+FLRKSG+ ++LV+NK
Sbjct: 61  EPVAKEGIMHEMAKQTKQAVAEADVVIFIVDGRQGLTPHDKTITDFLRKSGRSVMLVVNK 120

Query: 121 SENIN-SSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHS 179
           +E +  ++++ DFYELG+G+P++ISA +G+G+ + +E  L I    +   ++   +N  S
Sbjct: 121 AEGMKYTTVTADFYELGMGDPYVISAAHGDGVNDLVEEALNIAFAQRPPEEEAPASNDRS 180

Query: 180 IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG 239
           I   K+AIVG+PNVGKSTL+N+LLGE RVI +D PGTTRDSI+  FE + K Y LIDTAG
Sbjct: 181 I---KLAIVGRPNVGKSTLVNTLLGEERVIAFDLPGTTRDSIEIPFERDGKHYTLIDTAG 237

Query: 240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVC 299
           IRRR K FE IEKFSV+KTL+SI EANVV+LLLDAQQ+IS QD +IA FI ESGR+L+V 
Sbjct: 238 IRRRGKVFEAIEKFSVVKTLQSISEANVVLLLLDAQQDISEQDAHIAGFILESGRALVVG 297

Query: 300 VNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHL 359
           VNKWD +  ++R  IK ++++KL+FLSFA  +F+SA+K + I   M+S++  Y +++ +L
Sbjct: 298 VNKWDGLTSDRRDEIKMDLERKLSFLSFAKTHFVSALKSSGIGPMMKSVDGAYAAAMSNL 357

Query: 360 STSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           ST ++TRALI A+++  P RK  IRPKLRYAHQGG NPPI+VIHGN L+ I  +YKR+LE
Sbjct: 358 STPKLTRALIEAVEHQQPRRKGSIRPKLRYAHQGGMNPPIVVIHGNALEAIDANYKRFLE 417

GTPase that plays an essential role in the late steps of ribosome biogenesis.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)

>sp\|A4G4K6\|DER_HERAR GTPase Der OS=Herminiimonas arsenicoxydans GN=der PE=3 SV=1	Back alignment and function description

>sp\|A0K7T2\|DER_BURCH GTPase Der OS=Burkholderia cenocepacia (strain HI2424) GN=der PE=3 SV=1	Back alignment and function description

>sp\|B1JT88\|DER_BURCC GTPase Der OS=Burkholderia cenocepacia (strain MC0-3) GN=der PE=3 SV=1	Back alignment and function description

>sp\|Q1BGX0\|DER_BURCA GTPase Der OS=Burkholderia cenocepacia (strain AU 1054) GN=der PE=3 SV=1	Back alignment and function description

>sp\|B4EAW5\|DER_BURCJ GTPase Der OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=der PE=3 SV=1	Back alignment and function description

>sp\|Q39FR3\|DER_BURS3 GTPase Der OS=Burkholderia sp. (strain 383) GN=der PE=3 SV=1	Back alignment and function description

>sp\|B1YR40\|DER_BURA4 GTPase Der OS=Burkholderia ambifaria (strain MC40-6) GN=der PE=3 SV=1	Back alignment and function description

>sp\|Q63US9\|DER_BURPS GTPase Der OS=Burkholderia pseudomallei (strain K96243) GN=der PE=3 SV=1	Back alignment and function description

>sp\|A3NA49\|DER_BURP6 GTPase Der OS=Burkholderia pseudomallei (strain 668) GN=der PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		419
398836196		446	ribosome-associated GTPase EngA [Herbasp	0.992	0.932	0.616	1e-154
300312253		447	GTP-binding protein [Herbaspirillum sero	0.992	0.930	0.609	1e-153
340787109		447	GTP-binding protein [Collimonas fungivor	0.992	0.930	0.616	1e-152
409406674		447	GTP-binding protein [Herbaspirillum sp.	0.990	0.928	0.610	1e-151
152981185		447	GTP-binding protein EngA [Janthinobacter	0.992	0.930	0.607	1e-151
399018047		447	ribosome-associated GTPase EngA [Herbasp	0.990	0.928	0.597	1e-151
445498326		448	GTP-binding protein EngA [Janthinobacter	0.990	0.926	0.591	1e-150
395763286		448	GTP-binding protein Der [Janthinobacteri	0.990	0.926	0.600	1e-150
134094495		447	GTP-binding protein EngA [Herminiimonas	0.992	0.930	0.604	1e-149
427401453		445	GTPase Der [Massilia timonae CCUG 45783]	0.990	0.932	0.591	1e-148

>gi\|398836196\|ref\|ZP_10593542.1\| ribosome-associated GTPase EngA [Herbaspirillum sp. YR522] gi\|398213200\|gb\|EJM99794.1\| ribosome-associated GTPase EngA [Herbaspirillum sp. YR522]	Back alignment and taxonomy information

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/420 (61%), Positives = 333/420 (79%), Gaps = 4/420 (0%)

Query: 1   MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF 60
           MKPV+ LVGRPNVGKSTLFNRLT SRDALVA+ PGLTRDRHYGEG +G++ F++IDTGGF
Sbjct: 1   MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF 60

Query: 61  EPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINK 120
           EP  K+GIMHEM KQTKQA++E+D+++FIVDGRQGL   DK IT+FLRK G+P++LV+NK
Sbjct: 61  EPVAKEGIMHEMAKQTKQAVVEADVVVFIVDGRQGLTPHDKTITDFLRKCGRPVLLVVNK 120

Query: 121 SENIN-SSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHS 179
           SE +  +S++ DFYELG+G+P++ISA +G+G+ + +E  L +    +    + E      
Sbjct: 121 SEGMKYTSVTADFYELGMGDPYVISAAHGDGVADLVEEALNV---VEANRPEAEPEPEGQ 177

Query: 180 IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG 239
           +  IK+AIVG+PNVGKSTL+N+LLGE RVI +D PGTTRDSI+  FE + ++Y LIDTAG
Sbjct: 178 VRGIKIAIVGRPNVGKSTLVNTLLGEERVIAFDMPGTTRDSIEIPFERDGQQYTLIDTAG 237

Query: 240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVC 299
           IRRR K FE IEKFSV+KTL+SI +ANVV+LLLDAQQ+IS QD +IA FI ESGR+L+V 
Sbjct: 238 IRRRGKVFEAIEKFSVVKTLQSISDANVVLLLLDAQQDISEQDAHIAGFILESGRALVVG 297

Query: 300 VNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHL 359
           VNKWD +  +QR  IKN+I +KLNFLSFA  +F+SA+K + I   M+SIN  Y ++  +L
Sbjct: 298 VNKWDGLQSDQRDAIKNDIDRKLNFLSFANTHFVSALKNSGIGPVMKSINSAYAAATANL 357

Query: 360 STSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           ST R+TRAL  A+++  P RK  IRPKLRYAHQGG+NPP++VIHGN L  I ++YKRYLE
Sbjct: 358 STPRLTRALEQAVEHQQPPRKGSIRPKLRYAHQGGQNPPVVVIHGNALDAINDNYKRYLE 417

Source: Herbaspirillum sp. YR522

Species: Herbaspirillum sp. YR522

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi\|300312253\|ref\|YP_003776345.1\| GTP-binding protein [Herbaspirillum seropedicae SmR1] gi\|300075038\|gb\|ADJ64437.1\| GTP-binding protein [Herbaspirillum seropedicae SmR1]	Back alignment and taxonomy information

>gi\|340787109\|ref\|YP_004752574.1\| GTP-binding protein [Collimonas fungivorans Ter331] gi\|340552376\|gb\|AEK61751.1\| GTP-binding protein [Collimonas fungivorans Ter331]	Back alignment and taxonomy information

>gi\|409406674\|ref\|ZP_11255136.1\| GTP-binding protein [Herbaspirillum sp. GW103] gi\|386435223\|gb\|EIJ48048.1\| GTP-binding protein [Herbaspirillum sp. GW103]	Back alignment and taxonomy information

>gi\|152981185\|ref\|YP_001353813.1\| GTP-binding protein EngA [Janthinobacterium sp. Marseille] gi\|166198722\|sp\|A6SZW6.1\|DER_JANMA RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA gi\|151281262\|gb\|ABR89672.1\| GTP-binding protein EngA [Janthinobacterium sp. Marseille]	Back alignment and taxonomy information

>gi\|399018047\|ref\|ZP_10720233.1\| ribosome-associated GTPase EngA [Herbaspirillum sp. CF444] gi\|398102012\|gb\|EJL92204.1\| ribosome-associated GTPase EngA [Herbaspirillum sp. CF444]	Back alignment and taxonomy information

>gi\|445498326\|ref\|ZP_21465181.1\| GTP-binding protein EngA [Janthinobacterium sp. HH01] gi\|444788321\|gb\|ELX09869.1\| GTP-binding protein EngA [Janthinobacterium sp. HH01]	Back alignment and taxonomy information

>gi\|395763286\|ref\|ZP_10443955.1\| GTP-binding protein Der [Janthinobacterium lividum PAMC 25724]	Back alignment and taxonomy information

>gi\|134094495\|ref\|YP_001099570.1\| GTP-binding protein EngA [Herminiimonas arsenicoxydans] gi\|166198721\|sp\|A4G4K6.1\|DER_HERAR RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA gi\|133738398\|emb\|CAL61443.1\| GTP-binding protein EngA [Herminiimonas arsenicoxydans]	Back alignment and taxonomy information

>gi\|427401453\|ref\|ZP_18892525.1\| GTPase Der [Massilia timonae CCUG 45783] gi\|425719562\|gb\|EKU82494.1\| GTPase Der [Massilia timonae CCUG 45783]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		419
UNIPROTKB\|P0A6P5		490	der "50S ribosomal subunit sta	0.563	0.481	0.495	1.1e-91
UNIPROTKB\|Q9KTW7		494	der "GTPase Der" [Vibrio chole	0.610	0.518	0.447	1.9e-89
TIGR_CMR\|VC_0763		494	VC_0763 "GTP-binding protein"	0.610	0.518	0.447	1.9e-89
UNIPROTKB\|Q47WC5		498	der "GTPase Der" [Colwellia ps	0.613	0.516	0.461	2.4e-89
TIGR_CMR\|CPS_4247		498	CPS_4247 "GTP-binding protein	0.613	0.516	0.461	2.4e-89
UNIPROTKB\|Q8EC36		487	der "GTPase Der" [Shewanella o	0.988	0.850	0.417	8e-85
TIGR_CMR\|SO_3308		487	SO_3308 "GTP-binding protein E	0.988	0.850	0.417	8e-85
UNIPROTKB\|Q83C83		443	der "GTPase Der" [Coxiella bur	0.978	0.925	0.443	2.4e-83
TIGR_CMR\|CBU_1245		443	CBU_1245 "GTP-binding protein"	0.978	0.925	0.443	2.4e-83
UNIPROTKB\|Q74AX4		438	der "GTPase Der" [Geobacter su	0.973	0.931	0.374	2.4e-69

UNIPROTKB\|P0A6P5 der "50S ribosomal subunit stability factor" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

 Score = 606 (218.4 bits), Expect = 1.1e-91, Sum P(2) = 1.1e-91
 Identities = 117/236 (49%), Positives = 162/236 (68%)

Query:   183 IKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRR 242
             IK+AIVG+PNVGKSTL N +LGE RV+ YD PGTTRDSI    E + ++Y+LIDTAG+R+
Sbjct:   203 IKLAIVGRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDGREYVLIDTAGVRK 262

Query:   243 RNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNK 302
             R K  + +EKFSVIKTL++I +ANVV+L++DA++ IS QD+++  FI  SGRSL++ VNK
Sbjct:   263 RGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLSLLGFILNSGRSLVIVVNK 322

Query:   303 WDSXXXXXXXXXXXXXXXXXXFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTS 362
             WD                   F+ FA  +FISA+  + + +  ES+   YDSS   + TS
Sbjct:   323 WDGLSQEVKEQVKETLDFRLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVGTS 382

Query:   363 RITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYL 418
              +TR +  A+++H P   +  R KL+YAH GG NPPI+VIHGN++K + + YKRYL
Sbjct:   383 MLTRIMTMAVEDHQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYL 438

GO:0005829 "cytosol" evidence=IDA

GO:0006184 "GTP catabolic process" evidence=IDA

GO:0042254 "ribosome biogenesis" evidence=IEA

GO:0032794 "GTPase activating protein binding" evidence=IPI

GO:0043022 "ribosome binding" evidence=IDA

GO:0003924 "GTPase activity" evidence=IDA

GO:0005525 "GTP binding" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

GO:0000027 "ribosomal large subunit assembly" evidence=IMP

UNIPROTKB\|Q9KTW7 der "GTPase Der" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_0763 VC_0763 "GTP-binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|Q47WC5 der "GTPase Der" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_4247 CPS_4247 "GTP-binding protein EngA" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8EC36 der "GTPase Der" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3308 SO_3308 "GTP-binding protein EngA" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|Q83C83 der "GTPase Der" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_1245 CBU_1245 "GTP-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

UNIPROTKB\|Q74AX4 der "GTPase Der" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q46ZI7	DER_CUPPJ	No assigned EC number	0.5690	0.9928	0.9306	yes	N/A
Q5P7B7	DER_AROAE	No assigned EC number	0.5261	0.9832	0.9321	yes	N/A
Q0BEX1	DER_BURCM	No assigned EC number	0.5690	0.9904	0.9325	yes	N/A
Q13X32	DER_BURXL	No assigned EC number	0.5809	0.9904	0.9325	yes	N/A
B4RKD2	DER_NEIG2	No assigned EC number	0.5202	0.9785	0.8453	yes	N/A
Q12AC2	DER_POLSJ	No assigned EC number	0.5	0.9904	0.9284	yes	N/A
Q47BS0	DER_DECAR	No assigned EC number	0.55	0.9809	0.9277	yes	N/A
B4EAW5	DER_BURCJ	No assigned EC number	0.5761	0.9904	0.9325	yes	N/A
Q82XU6	DER_NITEU	No assigned EC number	0.55	0.9880	0.8865	yes	N/A
B2SXS6	DER_BURPP	No assigned EC number	0.5785	0.9904	0.9325	yes	N/A
B3R1J8	DER_CUPTR	No assigned EC number	0.5805	0.9880	0.9261	yes	N/A
B1JT88	DER_BURCC	No assigned EC number	0.5761	0.9904	0.9325	yes	N/A
A4G4K6	DER_HERAR	No assigned EC number	0.6047	0.9928	0.9306	yes	N/A
B2JIU7	DER_BURP8	No assigned EC number	0.5663	0.9880	0.9282	yes	N/A
A4SYD7	DER_POLSQ	No assigned EC number	0.5484	0.9856	0.9096	yes	N/A
Q9JV01	DER_NEIMA	No assigned EC number	0.5226	0.9785	0.8453	yes	N/A
A0K7T2	DER_BURCH	No assigned EC number	0.5761	0.9904	0.9325	yes	N/A
A4JEN6	DER_BURVG	No assigned EC number	0.5714	0.9904	0.9325	yes	N/A
Q2Y6F9	DER_NITMU	No assigned EC number	0.5368	0.9809	0.8819	yes	N/A
A1KT93	DER_NEIMF	No assigned EC number	0.5261	0.9761	0.8432	yes	N/A
Q7WHN4	DER_BORBR	No assigned EC number	0.5308	0.9904	0.9201	yes	N/A
A9IK66	DER_BORPD	No assigned EC number	0.5309	0.9952	0.9246	yes	N/A
A1TM31	DER_ACIAC	No assigned EC number	0.5083	0.9880	0.9261	yes	N/A
Q3SL66	DER_THIDA	No assigned EC number	0.5309	0.9809	0.8763	yes	N/A
Q1LLJ5	DER_RALME	No assigned EC number	0.5595	0.9928	0.9306	yes	N/A
Q39FR3	DER_BURS3	No assigned EC number	0.5714	0.9904	0.9325	yes	N/A
A9AH00	DER_BURM1	No assigned EC number	0.5738	0.9904	0.9325	yes	N/A
B1XU78	DER_POLNS	No assigned EC number	0.5342	0.9856	0.9096	yes	N/A
A3NA49	DER_BURP6	No assigned EC number	0.5738	0.9904	0.9325	yes	N/A
Q21W32	DER_RHOFD	No assigned EC number	0.5083	0.9880	0.9261	yes	N/A
A1K3Z3	DER_AZOSB	No assigned EC number	0.5261	0.9832	0.9321	yes	N/A
Q0AE46	DER_NITEC	No assigned EC number	0.5261	0.9880	0.8846	yes	N/A
Q7W6Q0	DER_BORPA	No assigned EC number	0.5308	0.9904	0.9201	yes	N/A
Q1BGX0	DER_BURCA	No assigned EC number	0.5761	0.9904	0.9325	yes	N/A
Q8Y026	DER_RALSO	No assigned EC number	0.5523	0.9928	0.9306	yes	N/A
A3MK70	DER_BURM7	No assigned EC number	0.5738	0.9904	0.9325	yes	N/A
B1YR40	DER_BURA4	No assigned EC number	0.5690	0.9904	0.9325	yes	N/A
B2U9V3	DER_RALPJ	No assigned EC number	0.5571	0.9928	0.9306	yes	N/A
Q7NS92	DER_CHRVO	No assigned EC number	0.5214	0.9785	0.8742	yes	N/A
Q7VWL4	DER_BORPE	No assigned EC number	0.5308	0.9904	0.9201	yes	N/A
C5CXH0	DER_VARPS	No assigned EC number	0.5190	0.9928	0.9306	yes	N/A
A3NVW6	DER_BURP0	No assigned EC number	0.5738	0.9904	0.9325	yes	N/A
B9MFY0	DER_ACIET	No assigned EC number	0.5154	0.9880	0.9261	yes	N/A
O87407	DER_NEIG1	No assigned EC number	0.5202	0.9785	0.8453	yes	N/A
Q63US9	DER_BURPS	No assigned EC number	0.5738	0.9904	0.9325	yes	N/A
A2S2A6	DER_BURM9	No assigned EC number	0.5738	0.9904	0.9325	yes	N/A
Q9JZY1	DER_NEIMB	No assigned EC number	0.5274	0.9785	0.8453	yes	N/A
A6SZW6	DER_JANMA	No assigned EC number	0.6071	0.9928	0.9306	yes	N/A
A2SHB1	DER_METPP	No assigned EC number	0.5119	0.9904	0.9304	yes	N/A
A1VNF8	DER_POLNA	No assigned EC number	0.5106	0.9880	0.9303	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		419
PRK00093		435	PRK00093, PRK00093, GTP-binding protein Der; Revie	0.0
TIGR03594		429	TIGR03594, GTPase_EngA, ribosome-associated GTPase	0.0
COG1160		444	COG1160, COG1160, Predicted GTPases [General funct	1e-167
PRK09518		712	PRK09518, PRK09518, bifunctional cytidylate kinase	4e-92
PRK03003		472	PRK03003, PRK03003, GTP-binding protein Der; Revie	2e-90
cd01895		174	cd01895, EngA2, EngA2 GTPase contains the second d	2e-77
cd01894		157	cd01894, EngA1, EngA1 GTPase contains the first do	8e-71
cd01894		157	cd01894, EngA1, EngA1 GTPase contains the first do	1e-35
pfam01926		117	pfam01926, MMR_HSR1, 50S ribosome-binding GTPase	5e-33
cd04164		159	cd04164, trmE, trmE is a tRNA modification GTPase	6e-33
pfam01926		117	pfam01926, MMR_HSR1, 50S ribosome-binding GTPase	7e-31
COG0486		454	COG0486, ThdF, Predicted GTPase [General function	2e-30
PRK05291		449	PRK05291, trmE, tRNA modification GTPase TrmE; Rev	5e-29
cd00880		161	cd00880, Era_like, E	2e-27
cd04164		159	cd04164, trmE, trmE is a tRNA modification GTPase	1e-25
cd01895		174	cd01895, EngA2, EngA2 GTPase contains the second d	2e-25
cd00880		161	cd00880, Era_like, E	3e-25
PRK05291		449	PRK05291, trmE, tRNA modification GTPase TrmE; Rev	9e-25
PRK00089		292	PRK00089, era, GTPase Era; Reviewed	5e-24
COG0486		454	COG0486, ThdF, Predicted GTPase [General function	9e-24
TIGR00450		442	TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas	9e-24
cd04163		168	cd04163, Era, E	2e-23
cd04163		168	cd04163, Era, E	2e-23
COG1159		298	COG1159, Era, GTPase [General function prediction	4e-23
TIGR00231		162	TIGR00231, small_GTP, small GTP-binding protein do	8e-23
COG1159		298	COG1159, Era, GTPase [General function prediction	1e-22
PRK00089		292	PRK00089, era, GTPase Era; Reviewed	2e-21
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	7e-20
TIGR00436		270	TIGR00436, era, GTP-binding protein Era	7e-20
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	1e-19
TIGR03918		391	TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster	2e-18
cd01879		159	cd01879, FeoB, Ferrous iron transport protein B (F	2e-16
TIGR00436		270	TIGR00436, era, GTP-binding protein Era	5e-16
TIGR00231		162	TIGR00231, small_GTP, small GTP-binding protein do	1e-15
TIGR03918		391	TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster	1e-15
TIGR00450		442	TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas	2e-15
cd01876		170	cd01876, YihA_EngB, YihA (EngB) GTPase family	3e-15
pfam02421		190	pfam02421, FeoB_N, Ferrous iron transport protein	2e-14
COG0370		653	COG0370, FeoB, Fe2+ transport system protein B [In	7e-14
cd01856		171	cd01856, YlqF, Circularly permuted YlqF GTPase	8e-14
COG2262		411	COG2262, HflX, GTPases [General function predictio	3e-13
COG1161		322	COG1161, COG1161, Predicted GTPases [General funct	1e-12
TIGR03596		276	TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi	2e-12
TIGR00437		591	TIGR00437, feoB, ferrous iron transporter FeoB	3e-12
cd01849		146	cd01849, YlqF_related_GTPase, Circularly permuted	4e-12
cd01855		191	cd01855, YqeH, Circularly permuted YqeH GTPase	4e-12
PRK09563		287	PRK09563, rbgA, GTPase YlqF; Reviewed	6e-12
cd01876		170	cd01876, YihA_EngB, YihA (EngB) GTPase family	2e-11
COG0218		200	COG0218, COG0218, Predicted GTPase [General functi	2e-11
COG0218		200	COG0218, COG0218, Predicted GTPase [General functi	3e-11
TIGR03598		178	TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi	4e-11
TIGR03597		360	TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase	5e-11
PRK00454		196	PRK00454, engB, GTP-binding protein YsxC; Reviewed	1e-10
cd01878		204	cd01878, HflX, HflX GTPase family	5e-10
cd01857		140	cd01857, HSR1_MMR1, A circularly permuted subfamil	9e-10
COG0370		653	COG0370, FeoB, Fe2+ transport system protein B [In	2e-09
TIGR03156		351	TIGR03156, GTP_HflX, GTP-binding protein HflX	4e-09
cd00881		183	cd00881, GTP_translation_factor, GTP translation f	1e-08
cd01881		167	cd01881, Obg_like, Obg-like family of GTPases cons	1e-08
cd09912		180	cd09912, DLP_2, Dynamin-like protein including dyn	1e-08
pfam02421		190	pfam02421, FeoB_N, Ferrous iron transport protein	2e-08
cd01897		167	cd01897, NOG, Nucleolar GTP-binding protein (NOG)	2e-08
cd01879		159	cd01879, FeoB, Ferrous iron transport protein B (F	3e-08
PRK15494		339	PRK15494, era, GTPase Era; Provisional	3e-08
COG1084		346	COG1084, COG1084, Predicted GTPase [General functi	4e-08
cd01859		157	cd01859, MJ1464, An uncharacterized, circularly pe	4e-08
PRK12299		335	PRK12299, obgE, GTPase CgtA; Reviewed	9e-08
TIGR00437		591	TIGR00437, feoB, ferrous iron transporter FeoB	2e-07
PRK00454		196	PRK00454, engB, GTP-binding protein YsxC; Reviewed	2e-07
TIGR03598		178	TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi	4e-07
cd01898		170	cd01898, Obg, Obg GTPase	4e-07
cd11383		140	cd11383, YfjP, YfjP GTPase	5e-07
COG1163		365	COG1163, DRG, Predicted GTPase [General function p	5e-07
cd01896		233	cd01896, DRG, Developmentally Regulated GTP-bindin	5e-07
COG0012		372	COG0012, COG0012, Predicted GTPase, probable trans	6e-07
cd01856		171	cd01856, YlqF, Circularly permuted YlqF GTPase	7e-07
PRK09601		364	PRK09601, PRK09601, GTP-binding protein YchF; Revi	7e-07
cd01899		318	cd01899, Ygr210, Ygr210 GTPase	9e-07
COG1161		322	COG1161, COG1161, Predicted GTPases [General funct	1e-06
cd01900		274	cd01900, YchF, YchF GTPase	1e-06
PRK13796		365	PRK13796, PRK13796, GTPase YqeH; Provisional	1e-06
cd04178		171	cd04178, Nucleostemin_like, A circularly permuted	2e-06
PRK09602		396	PRK09602, PRK09602, translation-associated GTPase;	4e-06
TIGR02729		329	TIGR02729, Obg_CgtA, Obg family GTPase CgtA	5e-06
cd00881		183	cd00881, GTP_translation_factor, GTP translation f	6e-06
cd01878		204	cd01878, HflX, HflX GTPase family	7e-06
TIGR03596		276	TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi	9e-06
PRK09563		287	PRK09563, rbgA, GTPase YlqF; Reviewed	1e-05
PRK04213		201	PRK04213, PRK04213, GTP-binding protein; Provision	1e-05
cd01881		167	cd01881, Obg_like, Obg-like family of GTPases cons	2e-05
cd11383		140	cd11383, YfjP, YfjP GTPase	2e-05
COG0536		369	COG0536, Obg, Predicted GTPase [General function p	2e-05
COG1100		219	COG1100, COG1100, GTPase SAR1 and related small G	2e-05
PRK01889		356	PRK01889, PRK01889, GTPase RsgA; Reviewed	3e-05
PRK09554		772	PRK09554, feoB, ferrous iron transport protein B;	3e-05
pfam00009		184	pfam00009, GTP_EFTU, Elongation factor Tu GTP bind	3e-05
cd01854		211	cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y	4e-05
COG3596		296	COG3596, COG3596, Predicted GTPase [General functi	4e-05
cd04166		209	cd04166, CysN_ATPS, CysN, together with protein Cy	5e-05
pfam00009		184	pfam00009, GTP_EFTU, Elongation factor Tu GTP bind	7e-05
COG2262		411	COG2262, HflX, GTPases [General function predictio	2e-04
cd01897		167	cd01897, NOG, Nucleolar GTP-binding protein (NOG)	2e-04
PRK15494		339	PRK15494, era, GTPase Era; Provisional	2e-04
pfam08477		116	pfam08477, Miro, Miro-like protein	2e-04
cd04178		171	cd04178, Nucleostemin_like, A circularly permuted	3e-04
COG1100		219	COG1100, COG1100, GTPase SAR1 and related small G	3e-04
COG3596		296	COG3596, COG3596, Predicted GTPase [General functi	4e-04
TIGR02034		406	TIGR02034, CysN, sulfate adenylyltransferase, larg	4e-04
PRK12298		390	PRK12298, obgE, GTPase CgtA; Reviewed	5e-04
PRK12297		424	PRK12297, obgE, GTPase CgtA; Reviewed	5e-04
PTZ00258		390	PTZ00258, PTZ00258, GTP-binding protein; Provision	5e-04
COG0012		372	COG0012, COG0012, Predicted GTPase, probable trans	6e-04
PRK04213		201	PRK04213, PRK04213, GTP-binding protein; Provision	6e-04
cd09912		180	cd09912, DLP_2, Dynamin-like protein including dyn	0.001
COG1163		365	COG1163, DRG, Predicted GTPase [General function p	0.001
COG1162		301	COG1162, COG1162, Predicted GTPases [General funct	0.001
pfam03193		161	pfam03193, DUF258, Protein of unknown function, DU	0.001
cd01858		157	cd01858, NGP_1, A novel nucleolar GTP-binding prot	0.001
TIGR03156		351	TIGR03156, GTP_HflX, GTP-binding protein HflX	0.002
COG1084		346	COG1084, COG1084, Predicted GTPase [General functi	0.002
COG5256		428	COG5256, TEF1, Translation elongation factor EF-1a	0.002
smart00962		197	smart00962, SRP54, SRP54-type protein, GTPase doma	0.003
cd04105		202	cd04105, SR_beta, Signal recognition particle rece	0.003
cd01896		233	cd01896, DRG, Developmentally Regulated GTP-bindin	0.004
PRK11058		426	PRK11058, PRK11058, GTPase HflX; Provisional	0.004
COG2895		431	COG2895, CysN, GTPases - Sulfate adenylate transfe	0.004

>gnl\|CDD\|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed	Back alignment and domain information

 Score =  555 bits (1432), Expect = 0.0
 Identities = 198/419 (47%), Positives = 281/419 (67%), Gaps = 10/419 (2%)

Query: 2   KPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFE 61
           KPV+ +VGRPNVGKSTLFNRLT  RDA+VA+ PG+TRDR YGE     + FI+IDTGG E
Sbjct: 1   KPVVAIVGRPNVGKSTLFNRLTGKRDAIVADTPGVTRDRIYGEAEWLGREFILIDTGGIE 60

Query: 62  PEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKS 121
           P+   G   ++ +Q + AI E+D+I+F+VDGR GL   D+ I   LRKS +P++LV+NK 
Sbjct: 61  PD-DDGFEKQIREQAELAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKV 119

Query: 122 ENINSSISL-DFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSI 180
           +  +      +FY LG+G P+ ISA +G GI + L+ IL  ELP ++   +++       
Sbjct: 120 DGPDEEADAYEFYSLGLGEPYPISAEHGRGIGDLLDAILE-ELPEEEEEDEED------- 171

Query: 181 EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGI 240
           E IK+AI+G+PNVGKS+LIN+LLGE RVI  D  GTTRDSI + FE + +KY LIDTAGI
Sbjct: 172 EPIKIAIIGRPNVGKSSLINALLGEERVIVSDIAGTTRDSIDTPFERDGQKYTLIDTAGI 231

Query: 241 RRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCV 300
           RR+ K  E +EK+SVI+TLK+I  A+VV+L++DA + I+ QD+ IA    E+GR+L++ V
Sbjct: 232 RRKGKVTEGVEKYSVIRTLKAIERADVVLLVIDATEGITEQDLRIAGLALEAGRALVIVV 291

Query: 301 NKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLS 360
           NKWD +     +  K  ++++L FL +A   FISA+    ++  +E+I+  Y+++   +S
Sbjct: 292 NKWDLVDEKTMEEFKKELRRRLPFLDYAPIVFISALTGQGVDKLLEAIDEAYENANRRIS 351

Query: 361 TSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           TS + R L  A++ HPP   K  R K++YA Q G NPP  V+  N  + +   YKRYLE
Sbjct: 352 TSVLNRVLEEAVERHPPPLVKGRRLKIKYATQVGTNPPTFVLFVNDPELLPFSYKRYLE 410

Length = 435

>gnl\|CDD\|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA	Back alignment and domain information

>gnl\|CDD\|224082 COG1160, COG1160, Predicted GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>gnl\|CDD\|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed	Back alignment and domain information

>gnl\|CDD\|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA	Back alignment and domain information

>gnl\|CDD\|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA	Back alignment and domain information

>gnl\|CDD\|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA	Back alignment and domain information

>gnl\|CDD\|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase	Back alignment and domain information

>gnl\|CDD\|206727 cd04164, trmE, trmE is a tRNA modification GTPase	Back alignment and domain information

>gnl\|CDD\|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase	Back alignment and domain information

>gnl\|CDD\|223561 COG0486, ThdF, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>gnl\|CDD\|206646 cd00880, Era_like, E	Back alignment and domain information

>gnl\|CDD\|206727 cd04164, trmE, trmE is a tRNA modification GTPase	Back alignment and domain information

>gnl\|CDD\|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA	Back alignment and domain information

>gnl\|CDD\|206646 cd00880, Era_like, E	Back alignment and domain information

>gnl\|CDD\|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>gnl\|CDD\|234624 PRK00089, era, GTPase Era; Reviewed	Back alignment and domain information

>gnl\|CDD\|223561 COG0486, ThdF, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE	Back alignment and domain information

>gnl\|CDD\|206726 cd04163, Era, E	Back alignment and domain information

>gnl\|CDD\|206726 cd04163, Era, E	Back alignment and domain information

>gnl\|CDD\|224081 COG1159, Era, GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|232886 TIGR00231, small_GTP, small GTP-binding protein domain	Back alignment and domain information

>gnl\|CDD\|224081 COG1159, Era, GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234624 PRK00089, era, GTPase Era; Reviewed	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|129528 TIGR00436, era, GTP-binding protein Era	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF	Back alignment and domain information

>gnl\|CDD\|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family	Back alignment and domain information

>gnl\|CDD\|129528 TIGR00436, era, GTP-binding protein Era	Back alignment and domain information

>gnl\|CDD\|232886 TIGR00231, small_GTP, small GTP-binding protein domain	Back alignment and domain information

>gnl\|CDD\|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF	Back alignment and domain information

>gnl\|CDD\|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE	Back alignment and domain information

>gnl\|CDD\|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family	Back alignment and domain information

>gnl\|CDD\|217025 pfam02421, FeoB_N, Ferrous iron transport protein B	Back alignment and domain information

>gnl\|CDD\|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|206749 cd01856, YlqF, Circularly permuted YlqF GTPase	Back alignment and domain information

>gnl\|CDD\|225171 COG2262, HflX, GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224083 COG1161, COG1161, Predicted GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>gnl\|CDD\|232975 TIGR00437, feoB, ferrous iron transporter FeoB	Back alignment and domain information

>gnl\|CDD\|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases	Back alignment and domain information

>gnl\|CDD\|206748 cd01855, YqeH, Circularly permuted YqeH GTPase	Back alignment and domain information

>gnl\|CDD\|236570 PRK09563, rbgA, GTPase YlqF; Reviewed	Back alignment and domain information

>gnl\|CDD\|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family	Back alignment and domain information

>gnl\|CDD\|223296 COG0218, COG0218, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223296 COG0218, COG0218, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>gnl\|CDD\|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH	Back alignment and domain information

>gnl\|CDD\|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>gnl\|CDD\|206666 cd01878, HflX, HflX GTPase family	Back alignment and domain information

>gnl\|CDD\|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases	Back alignment and domain information

>gnl\|CDD\|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX	Back alignment and domain information

>gnl\|CDD\|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors	Back alignment and domain information

>gnl\|CDD\|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>gnl\|CDD\|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|217025 pfam02421, FeoB_N, Ferrous iron transport protein B	Back alignment and domain information

>gnl\|CDD\|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG)	Back alignment and domain information

>gnl\|CDD\|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family	Back alignment and domain information

>gnl\|CDD\|185391 PRK15494, era, GTPase Era; Provisional	Back alignment and domain information

>gnl\|CDD\|224009 COG1084, COG1084, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases	Back alignment and domain information

>gnl\|CDD\|237048 PRK12299, obgE, GTPase CgtA; Reviewed	Back alignment and domain information

>gnl\|CDD\|232975 TIGR00437, feoB, ferrous iron transporter FeoB	Back alignment and domain information

>gnl\|CDD\|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>gnl\|CDD\|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>gnl\|CDD\|206685 cd01898, Obg, Obg GTPase	Back alignment and domain information

>gnl\|CDD\|206743 cd11383, YfjP, YfjP GTPase	Back alignment and domain information

>gnl\|CDD\|224085 COG1163, DRG, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG)	Back alignment and domain information

>gnl\|CDD\|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|206749 cd01856, YlqF, Circularly permuted YlqF GTPase	Back alignment and domain information

>gnl\|CDD\|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed	Back alignment and domain information

>gnl\|CDD\|206686 cd01899, Ygr210, Ygr210 GTPase	Back alignment and domain information

>gnl\|CDD\|224083 COG1161, COG1161, Predicted GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206687 cd01900, YchF, YchF GTPase	Back alignment and domain information

>gnl\|CDD\|237511 PRK13796, PRK13796, GTPase YqeH; Provisional	Back alignment and domain information

>gnl\|CDD\|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases	Back alignment and domain information

>gnl\|CDD\|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed	Back alignment and domain information

>gnl\|CDD\|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA	Back alignment and domain information

>gnl\|CDD\|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors	Back alignment and domain information

>gnl\|CDD\|206666 cd01878, HflX, HflX GTPase family	Back alignment and domain information

>gnl\|CDD\|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>gnl\|CDD\|236570 PRK09563, rbgA, GTPase YlqF; Reviewed	Back alignment and domain information

>gnl\|CDD\|179790 PRK04213, PRK04213, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>gnl\|CDD\|206743 cd11383, YfjP, YfjP GTPase	Back alignment and domain information

>gnl\|CDD\|223610 COG0536, Obg, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed	Back alignment and domain information

>gnl\|CDD\|236563 PRK09554, feoB, ferrous iron transport protein B; Reviewed	Back alignment and domain information

>gnl\|CDD\|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain	Back alignment and domain information

>gnl\|CDD\|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases	Back alignment and domain information

>gnl\|CDD\|226124 COG3596, COG3596, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex	Back alignment and domain information

>gnl\|CDD\|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain	Back alignment and domain information

>gnl\|CDD\|225171 COG2262, HflX, GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG)	Back alignment and domain information

>gnl\|CDD\|185391 PRK15494, era, GTPase Era; Provisional	Back alignment and domain information

>gnl\|CDD\|219856 pfam08477, Miro, Miro-like protein	Back alignment and domain information

>gnl\|CDD\|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases	Back alignment and domain information

>gnl\|CDD\|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226124 COG3596, COG3596, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit	Back alignment and domain information

>gnl\|CDD\|237047 PRK12298, obgE, GTPase CgtA; Reviewed	Back alignment and domain information

>gnl\|CDD\|237046 PRK12297, obgE, GTPase CgtA; Reviewed	Back alignment and domain information

>gnl\|CDD\|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|179790 PRK04213, PRK04213, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|224085 COG1163, DRG, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224084 COG1162, COG1162, Predicted GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|217416 pfam03193, DUF258, Protein of unknown function, DUF258	Back alignment and domain information

>gnl\|CDD\|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases	Back alignment and domain information

>gnl\|CDD\|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX	Back alignment and domain information

>gnl\|CDD\|224009 COG1084, COG1084, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|214940 smart00962, SRP54, SRP54-type protein, GTPase domain	Back alignment and domain information

>gnl\|CDD\|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP)	Back alignment and domain information

>gnl\|CDD\|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG)	Back alignment and domain information

>gnl\|CDD\|182934 PRK11058, PRK11058, GTPase HflX; Provisional	Back alignment and domain information

>gnl\|CDD\|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		419
COG1160		444	Predicted GTPases [General function prediction onl	100.0
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	100.0
PRK03003		472	GTP-binding protein Der; Reviewed	100.0
PRK00093		435	GTP-binding protein Der; Reviewed	100.0
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	100.0
COG1159		298	Era GTPase [General function prediction only]	99.96
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.95
COG1159		298	Era GTPase [General function prediction only]	99.95
COG0486		454	ThdF Predicted GTPase [General function prediction	99.95
COG1160		444	Predicted GTPases [General function prediction onl	99.95
KOG1191\|consensus		531		99.95
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.94
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.94
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.94
PRK15494		339	era GTPase Era; Provisional	99.93
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.93
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.93
KOG0084\|consensus		205		99.93
COG0486		454	ThdF Predicted GTPase [General function prediction	99.93
PRK15494		339	era GTPase Era; Provisional	99.92
KOG0092\|consensus		200		99.92
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.92
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.92
PRK00089		292	era GTPase Era; Reviewed	99.92
KOG0094\|consensus		221		99.91
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.91
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.91
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.91
KOG0078\|consensus		207		99.91
KOG0084\|consensus		205		99.91
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.91
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.91
KOG0394\|consensus		210		99.91
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.91
PRK03003		472	GTP-binding protein Der; Reviewed	99.9
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.9
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.9
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.9
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.9
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.9
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.9
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.9
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.9
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.9
PRK12299		335	obgE GTPase CgtA; Reviewed	99.9
KOG0094\|consensus		221		99.9
PRK00089		292	era GTPase Era; Reviewed	99.89
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	99.89
KOG0092\|consensus		200		99.89
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.89
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.89
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.89
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.89
PRK12298		390	obgE GTPase CgtA; Reviewed	99.89
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.89
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.89
COG0218		200	Predicted GTPase [General function prediction only	99.89
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.89
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.89
KOG0098\|consensus		216		99.89
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.89
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.89
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.89
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.89
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.89
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.89
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.89
PRK00093		435	GTP-binding protein Der; Reviewed	99.89
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.89
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.88
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.88
KOG0087\|consensus		222		99.88
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.88
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.88
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.88
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.88
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.88
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.88
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.88
PRK11058		426	GTPase HflX; Provisional	99.88
cd00881		189	GTP_translation_factor GTP translation factor fami	99.88
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.88
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.88
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.88
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.88
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.88
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.88
KOG0080\|consensus		209		99.88
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.88
PRK12296		500	obgE GTPase CgtA; Reviewed	99.88
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.88
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.88
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.88
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.88
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.88
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.88
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.88
PLN00223		181	ADP-ribosylation factor; Provisional	99.88
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.88
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.88
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.88
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.88
PLN03118		211	Rab family protein; Provisional	99.88
PTZ00133		182	ADP-ribosylation factor; Provisional	99.88
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.88
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.87
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.87
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.87
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.87
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.87
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.87
KOG0078\|consensus		207		99.87
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.87
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.87
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.87
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.87
KOG0095\|consensus		213		99.87
PRK11058		426	GTPase HflX; Provisional	99.87
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.87
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.87
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.87
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.87
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.87
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.87
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.87
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.87
PTZ00369		189	Ras-like protein; Provisional	99.87
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	99.87
PRK12299		335	obgE GTPase CgtA; Reviewed	99.87
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.87
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.87
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.87
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.87
PLN03110		216	Rab GTPase; Provisional	99.87
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.87
PRK04213		201	GTP-binding protein; Provisional	99.87
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.87
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.87
PRK12297		424	obgE GTPase CgtA; Reviewed	99.87
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.87
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.87
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.87
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.87
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.87
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.87
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	99.86
KOG0079\|consensus		198		99.86
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.86
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.86
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.86
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.86
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.86
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.86
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.86
KOG0098\|consensus		216		99.86
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.86
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	99.86
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.86
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.86
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.86
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.86
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.86
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.86
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.86
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.86
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.86
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.86
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.86
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.86
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.86
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.86
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.86
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.86
KOG1423\|consensus		379		99.86
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.86
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.86
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.86
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.86
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.86
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	99.86
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.86
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	99.86
KOG0093\|consensus		193		99.86
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.86
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.86
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.86
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.86
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	99.86
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.85
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.85
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.85
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.85
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.85
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.85
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.85
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.85
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.85
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.85
PRK12298		390	obgE GTPase CgtA; Reviewed	99.85
KOG0087\|consensus		222		99.85
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.85
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.85
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.85
COG0218		200	Predicted GTPase [General function prediction only	99.85
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.85
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.85
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	99.85
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.85
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.85
KOG0095\|consensus		213		99.85
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.85
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	99.85
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.85
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.85
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.85
cd00881		189	GTP_translation_factor GTP translation factor fami	99.85
PRK12296		500	obgE GTPase CgtA; Reviewed	99.85
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.85
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.85
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.85
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.85
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.84
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.84
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.84
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.84
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.84
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.84
PRK04213		201	GTP-binding protein; Provisional	99.84
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.84
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.84
PRK12297		424	obgE GTPase CgtA; Reviewed	99.84
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.84
PRK09563		287	rbgA GTPase YlqF; Reviewed	99.84
PLN00223		181	ADP-ribosylation factor; Provisional	99.84
PRK12317		425	elongation factor 1-alpha; Reviewed	99.84
KOG0394\|consensus		210		99.84
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.84
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.84
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	99.84
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.84
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.84
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.84
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.84
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.84
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.84
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.84
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.84
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.84
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.84
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.84
PLN03108		210	Rab family protein; Provisional	99.84
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.84
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.84
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.84
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.84
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.84
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.84
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.83
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.83
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.83
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.83
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.83
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.83
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.83
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.83
PTZ00369		189	Ras-like protein; Provisional	99.83
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.83
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.83
KOG0080\|consensus		209		99.83
PTZ00133		182	ADP-ribosylation factor; Provisional	99.83
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.83
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	99.83
KOG1191\|consensus		531		99.83
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.83
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	99.83
KOG0091\|consensus		213		99.83
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	99.83
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	99.83
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.83
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	99.83
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.83
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.83
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.83
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.83
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.83
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.83
KOG0079\|consensus		198		99.83
KOG1423\|consensus		379		99.83
KOG0086\|consensus		214		99.83
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.82
PLN03110		216	Rab GTPase; Provisional	99.82
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	99.82
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.82
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	99.82
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.82
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.82
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.82
KOG0088\|consensus		218		99.82
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.82
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.82
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.82
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.82
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.82
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.82
PRK05306		787	infB translation initiation factor IF-2; Validated	99.82
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.82
PLN03118		211	Rab family protein; Provisional	99.82
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.82
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.82
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.82
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.82
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	99.82
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	99.82
COG1084		346	Predicted GTPase [General function prediction only	99.82
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.82
CHL00071		409	tufA elongation factor Tu	99.82
cd01896		233	DRG The developmentally regulated GTP-binding prot	99.82
PRK12736		394	elongation factor Tu; Reviewed	99.82
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.82
CHL00189		742	infB translation initiation factor 2; Provisional	99.82
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	99.82
COG2262		411	HflX GTPases [General function prediction only]	99.82
KOG0093\|consensus		193		99.82
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.82
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.81
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.81
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.81
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	99.81
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.81
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.81
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.81
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	99.81
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.81
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	99.81
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.81
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.81
KOG1489\|consensus		366		99.81
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.81
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.8
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.8
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	99.8
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	99.8
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.8
PLN03108		210	Rab family protein; Provisional	99.8
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.8
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	99.8
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.8
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.8
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.8
KOG0083\|consensus		192		99.8
PRK12735		396	elongation factor Tu; Reviewed	99.8
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.8
PRK05306		787	infB translation initiation factor IF-2; Validated	99.8
cd01896		233	DRG The developmentally regulated GTP-binding prot	99.8
KOG0086\|consensus		214		99.8
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	99.8
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.79
PRK12289		352	GTPase RsgA; Reviewed	99.79
PLN03127		447	Elongation factor Tu; Provisional	99.79
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.79
TIGR00485		394	EF-Tu translation elongation factor TU. This align	99.79
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	99.79
KOG0395\|consensus		196		99.79
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.79
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	99.79
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.79
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.79
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.79
KOG0081\|consensus		219		99.79
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	99.79
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.79
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.79
PRK00049		396	elongation factor Tu; Reviewed	99.79
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	99.79
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.78
COG1084		346	Predicted GTPase [General function prediction only	99.78
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.78
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	99.78
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.78
CHL00189		742	infB translation initiation factor 2; Provisional	99.78
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.78
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	99.78
PRK10218		607	GTP-binding protein; Provisional	99.78
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	99.78
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.78
PRK04000		411	translation initiation factor IF-2 subunit gamma;	99.78
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	99.78
PRK05433		600	GTP-binding protein LepA; Provisional	99.78
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.78
PRK09866		741	hypothetical protein; Provisional	99.77
COG1163		365	DRG Predicted GTPase [General function prediction	99.77
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.77
PLN03126		478	Elongation factor Tu; Provisional	99.77
PRK12317		425	elongation factor 1-alpha; Reviewed	99.77
COG2262		411	HflX GTPases [General function prediction only]	99.77
PRK05433		600	GTP-binding protein LepA; Provisional	99.76
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	99.76
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	99.76
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	99.76
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.76
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	99.76
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	99.76
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.76
PRK04004		586	translation initiation factor IF-2; Validated	99.75
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.75
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	99.75
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.75
PRK10218		607	GTP-binding protein; Provisional	99.75
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	99.75
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	99.74
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	99.74
PTZ00141		446	elongation factor 1- alpha; Provisional	99.74
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	99.74
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	99.74
PRK12288		347	GTPase RsgA; Reviewed	99.74
KOG1707\|consensus		625		99.74
COG0536		369	Obg Predicted GTPase [General function prediction	99.74
COG1163		365	DRG Predicted GTPase [General function prediction	99.74
KOG0073\|consensus		185		99.74
KOG0462\|consensus		650		99.73
KOG1489\|consensus		366		99.73
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	99.73
PRK13796		365	GTPase YqeH; Provisional	99.73
PRK12736		394	elongation factor Tu; Reviewed	99.73
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	99.73
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.73
KOG0088\|consensus		218		99.73
COG3596		296	Predicted GTPase [General function prediction only	99.73
COG3596		296	Predicted GTPase [General function prediction only	99.73
COG1161		322	Predicted GTPases [General function prediction onl	99.73
KOG0091\|consensus		213		99.73
CHL00071		409	tufA elongation factor Tu	99.73
KOG0097\|consensus		215		99.72
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	99.72
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	99.72
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	99.72
PRK00098		298	GTPase RsgA; Reviewed	99.72
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	99.72
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	99.72
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.71
PRK00007		693	elongation factor G; Reviewed	99.71
PRK00741		526	prfC peptide chain release factor 3; Provisional	99.71
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	99.7
PRK12735		396	elongation factor Tu; Reviewed	99.7
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	99.7
PLN03127		447	Elongation factor Tu; Provisional	99.7
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	99.7
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	99.7
PRK12739		691	elongation factor G; Reviewed	99.7
KOG0395\|consensus		196		99.7
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.69
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	99.69
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	99.69
KOG0097\|consensus		215		99.69
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	99.69
KOG1145\|consensus		683		99.69
KOG1490\|consensus		620		99.69
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	99.69
PLN00043		447	elongation factor 1-alpha; Provisional	99.69
TIGR00485		394	EF-Tu translation elongation factor TU. This align	99.69
COG2229		187	Predicted GTPase [General function prediction only	99.68
PRK00049		396	elongation factor Tu; Reviewed	99.68
PRK04000		411	translation initiation factor IF-2 subunit gamma;	99.68
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	99.68
PRK09602		396	translation-associated GTPase; Reviewed	99.68
PRK13351		687	elongation factor G; Reviewed	99.68
PRK04004		586	translation initiation factor IF-2; Validated	99.67
PLN00023		334	GTP-binding protein; Provisional	99.67
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	99.67
PRK09602		396	translation-associated GTPase; Reviewed	99.67
COG1100		219	GTPase SAR1 and related small G proteins [General	99.67
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	99.67
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	99.66
PRK12739		691	elongation factor G; Reviewed	99.66
cd04105		203	SR_beta Signal recognition particle receptor, beta	99.66
KOG4252\|consensus		246		99.66
TIGR00503		527	prfC peptide chain release factor 3. This translat	99.66
KOG0393\|consensus		198		99.66
KOG0075\|consensus		186		99.66
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	99.66
PLN03126		478	Elongation factor Tu; Provisional	99.66
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	99.66
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	99.66
PRK00007		693	elongation factor G; Reviewed	99.66
KOG0462\|consensus		650		99.65
KOG0081\|consensus		219		99.65
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.65
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	99.65
KOG0073\|consensus		185		99.65
COG0536		369	Obg Predicted GTPase [General function prediction	99.64
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	99.64
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	99.64
KOG0083\|consensus		192		99.63
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	99.63
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	99.63
PRK00741		526	prfC peptide chain release factor 3; Provisional	99.63
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	99.62
COG2229		187	Predicted GTPase [General function prediction only	99.62
KOG0075\|consensus		186		99.62
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	99.62

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=5.4e-89  Score=635.44  Aligned_cols=413  Identities=46%  Similarity=0.741  Sum_probs=388.3

Q ss_pred             CC-CEEEEEcCCCCCHHHHHHHHhCCCCceecCCCCCCccceEEEEEECCeEEEEEEcCCCCCcchhhHHHHHHHHHHHH
Q psy17089          1 MK-PVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQA   79 (419)
Q Consensus         1 ~~-~~i~ivG~~~vGKSsl~n~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~   79 (419)
                      |. |.|+|+|+||||||||+|+|++++.++++++||+|+|..++.+.|.++.+.+|||+|+++..++.+.+.+..++..+
T Consensus         1 m~~~~VAIVGRPNVGKSTLFNRL~g~r~AIV~D~pGvTRDr~y~~~~~~~~~f~lIDTgGl~~~~~~~l~~~i~~Qa~~A   80 (444)
T COG1160           1 MSTPVVAIVGRPNVGKSTLFNRLTGRRIAIVSDTPGVTRDRIYGDAEWLGREFILIDTGGLDDGDEDELQELIREQALIA   80 (444)
T ss_pred             CCCCEEEEECCCCCcHHHHHHHHhCCeeeEeecCCCCccCCccceeEEcCceEEEEECCCCCcCCchHHHHHHHHHHHHH
Confidence            66 89999999999999999999999999999999999999999999999999999999999777678999999999999


Q ss_pred             HHhCCEEEEEEeCCCCCCHhHHHHHHHHHhcCCCEEEEEeccCCCCCCcc-hhHHhcCCCCeEEEeeccCCCHHHHHHHH
Q psy17089         80 IIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSIS-LDFYELGIGNPHIISALYGNGIKNFLENI  158 (419)
Q Consensus        80 ~~~~d~il~v~d~~~~~~~~~~~~~~~l~~~~~p~ilv~NK~Dl~~~~~~-~~~~~~~~~~~~~vSa~~~~~v~~l~~~i  158 (419)
                      +..||+++||+|+..+.++.|..++++|++.++|+++|+||+|....+.. .+|+.+|+++++++||.||.|+.+|++.+
T Consensus        81 i~eADvilfvVD~~~Git~~D~~ia~~Lr~~~kpviLvvNK~D~~~~e~~~~efyslG~g~~~~ISA~Hg~Gi~dLld~v  160 (444)
T COG1160          81 IEEADVILFVVDGREGITPADEEIAKILRRSKKPVILVVNKIDNLKAEELAYEFYSLGFGEPVPISAEHGRGIGDLLDAV  160 (444)
T ss_pred             HHhCCEEEEEEeCCCCCCHHHHHHHHHHHhcCCCEEEEEEcccCchhhhhHHHHHhcCCCCceEeehhhccCHHHHHHHH
Confidence            99999999999999999999999999999888999999999999865555 89999999999999999999999999999


Q ss_pred             HHhcCCcchhccccccccccccceeEEEEEeCCCCchhHHHHHHhCCceeeecCCCCccceeeeEeeEEeCeeEEEEeCC
Q psy17089        159 LTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTA  238 (419)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~G~~~~GKSslin~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtp  238 (419)
                      .+.++ .+..     ...+....+++||++|+||||||||+|+|+++++..+++.+|||+|.+...++++++.+.++||+
T Consensus       161 ~~~l~-~~e~-----~~~~~~~~~ikiaiiGrPNvGKSsLiN~ilgeeR~Iv~~~aGTTRD~I~~~~e~~~~~~~liDTA  234 (444)
T COG1160         161 LELLP-PDEE-----EEEEEETDPIKIAIIGRPNVGKSSLINAILGEERVIVSDIAGTTRDSIDIEFERDGRKYVLIDTA  234 (444)
T ss_pred             HhhcC-Cccc-----ccccccCCceEEEEEeCCCCCchHHHHHhccCceEEecCCCCccccceeeeEEECCeEEEEEECC
Confidence            99986 3210     01111136799999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcchHHHHHHHHHHHHHHHhhcCEEEEEecCCCCCCHHHHHHHHHHHHcCCcEEEEEEcccCCCh--hhHHHHHH
Q psy17089        239 GIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIH--NQRKIIKN  316 (419)
Q Consensus       239 G~~~~~~~~~~~e~~~~~~~~~~~~~ad~~i~v~d~~~~~~~~~~~~~~~~~~~~~~~iiv~NK~Dl~~~--~~~~~~~~  316 (419)
                      |+++.....+.+|.|++.+++.++..||++++|+|++.+.+.+|.++..++.+.++++++|+||||+++.  ...+....
T Consensus       235 GiRrk~ki~e~~E~~Sv~rt~~aI~~a~vvllviDa~~~~~~qD~~ia~~i~~~g~~~vIvvNKWDl~~~~~~~~~~~k~  314 (444)
T COG1160         235 GIRRKGKITESVEKYSVARTLKAIERADVVLLVIDATEGISEQDLRIAGLIEEAGRGIVIVVNKWDLVEEDEATMEEFKK  314 (444)
T ss_pred             CCCcccccccceEEEeehhhHhHHhhcCEEEEEEECCCCchHHHHHHHHHHHHcCCCeEEEEEccccCCchhhHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999876  55677888


Q ss_pred             HHHHHcCCCCCCcEEEEeccCCCCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHcCCCCCCCCCceeEEEEecCCCC
Q psy17089        317 NIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKN  396 (419)
Q Consensus       317 ~~~~~~~~~~~~~~~~~SA~~g~gv~~l~~~i~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~q~~~~  396 (419)
                      .+...+.+..+.|++++||++|.|+.++|+.+.+.+..+..+++++.||++|+.++..+|||...|++++++|++|..++
T Consensus       315 ~i~~~l~~l~~a~i~~iSA~~~~~i~~l~~~i~~~~~~~~~ri~Ts~LN~~l~~a~~~~pP~~~~G~r~ki~Ya~q~~~~  394 (444)
T COG1160         315 KLRRKLPFLDFAPIVFISALTGQGLDKLFEAIKEIYECATRRISTSLLNRVLEDAVAKHPPPVRYGRRLKIKYATQVSTN  394 (444)
T ss_pred             HHHHHhccccCCeEEEEEecCCCChHHHHHHHHHHHHHhccccCHHHHHHHHHHHHHhCCCCccCCceEEEEEEecCCCC
Confidence            89999999999999999999999999999999999999999999999999999999999877787999999999999999


Q ss_pred             CCEEEEEecCCCCCChhhhcccC
Q psy17089        397 PPIIVIHGNRLKYIGNDYKRYLE  419 (419)
Q Consensus       397 ~p~~~~~~~~~~~~~~~y~~~~~  419 (419)
                      ||+|++|||+|+.++.+|+|||+
T Consensus       395 PP~fvlf~N~~~~~~~sY~RyL~  417 (444)
T COG1160         395 PPTFVLFGNRPKALHFSYKRYLE  417 (444)
T ss_pred             CCEEEEEecchhhCchHHHHHHH
Confidence            99999999999999999999985

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG1191\|consensus	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>KOG0084\|consensus	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>KOG0092\|consensus	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>KOG0094\|consensus	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>KOG0078\|consensus	Back alignment and domain information

>KOG0084\|consensus	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>KOG0394\|consensus	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG0094\|consensus	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>KOG0092\|consensus	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>KOG0098\|consensus	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>KOG0087\|consensus	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>KOG0080\|consensus	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>KOG0078\|consensus	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>KOG0095\|consensus	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>KOG0079\|consensus	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>KOG0098\|consensus	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>KOG1423\|consensus	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>KOG0093\|consensus	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG0087\|consensus	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>KOG0095\|consensus	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>KOG0394\|consensus	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>KOG0080\|consensus	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>KOG1191\|consensus	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>KOG0091\|consensus	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>KOG0079\|consensus	Back alignment and domain information

>KOG1423\|consensus	Back alignment and domain information

>KOG0086\|consensus	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>KOG0088\|consensus	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>KOG0093\|consensus	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>KOG1489\|consensus	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>KOG0083\|consensus	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>KOG0086\|consensus	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>KOG0395\|consensus	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>KOG0081\|consensus	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG1707\|consensus	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0073\|consensus	Back alignment and domain information

>KOG0462\|consensus	Back alignment and domain information

>KOG1489\|consensus	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>KOG0088\|consensus	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG0091\|consensus	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>KOG0097\|consensus	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>KOG0395\|consensus	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>KOG0097\|consensus	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>KOG1145\|consensus	Back alignment and domain information

>KOG1490\|consensus	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>KOG4252\|consensus	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>KOG0393\|consensus	Back alignment and domain information

>KOG0075\|consensus	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>KOG0462\|consensus	Back alignment and domain information

>KOG0081\|consensus	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>KOG0073\|consensus	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>KOG0083\|consensus	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0075\|consensus	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		419
4dcs_A		456	Crystal Structure Of B. Subtilis Enga In Complex Wi		4e-66
2hjg_A		436	The Crystal Structure Of The B. Subtilis Yphc Gtpas		1e-63
1mky_A		439	Structural Analysis Of The Domain Interactions In D		1e-46
2dyk_A		161	Crystal Structure Of N-Terminal Gtp-Binding Domain		7e-20
2dyk_A		161	Crystal Structure Of N-Terminal Gtp-Binding Domain		4e-15
1xzp_A		482	Structure Of The Gtp-Binding Protein Trme From Ther		7e-18
3geh_A		462	Crystal Structure Of Mnme From Nostoc In Complex Wi		5e-15
3gee_A		476	Crystal Structure Of Mnme From Chlorobium Tepidum I		2e-14
3iev_A		308	Crystal Structure Of Era In Complex With Mggnp And		5e-12
3r9w_A		307	Crystal Structure Of Era In Complex With Mggdpnp An		5e-12
1rfl_A		172	Nmr Data Driven Structural Model Of G-Domain Of Mnm		4e-11
2gj9_A		172	Structure Of The Mnme G-Domain In Complex With GdpA		1e-10
2gj8_A		172	Structure Of The Mnme G-domain In Complex With Gdp*		3e-10
1wf3_A		301	Crystal Structure Of Gtp-Binding Protein Tt1341 Fro		7e-10
2wjg_A		188	Structure And Function Of The Feob G-Domain From Me		3e-08
1x18_X		292	Contact Sites Of Era Gtpase On The Thermus Thermoph		4e-08
2wjh_A		166	Structure And Function Of The Feob G-Domain From Me		5e-08
1ega_A		301	Crystal Structure Of A Widely Conserved Gtpase Era		5e-08
2wji_A		165	Structure And Function Of The Feob G-Domain From Me		5e-08
2wjj_A		168	Structure And Function Of The Feob G-Domain From Me		9e-08
3iby_A		256	Structure Of Cytosolic Domain Of L. Pneumophila Feo		3e-06
3k53_A		271	Crystal Structure Of Nfeob From P. Furiosus Length		4e-06
3k53_A		271	Crystal Structure Of Nfeob From P. Furiosus Length		2e-05
3qq5_A		423	Crystal Structure Of The [fefe]-Hydrogenase Maturat		7e-06
2e87_A		357	Crystal Structure Of Hypothetical Gtp-Binding Prote		1e-04
2dwq_A		368	Thermus Thermophilus Ychf Gtp-Binding Protein Lengt		1e-04
2dby_A		368	Crystal Structure Of The Gtp-Binding Protein Ychf I		1e-04
3a1w_A		168	Crystal Structue Of The G Domain Of T. Maritima Feo		2e-04
3pqc_A		195	Crystal Structure Of Thermotoga Maritima Ribosome B		2e-04
3hyt_A		270	Structural Basis Of Gdp Release And Gating In G Pro		2e-04
3i8s_A		274	Structure Of The Cytosolic Domain Of E. Coli Feob,		2e-04
3a1t_A		258	Crystal Structue Of The Cytosolic Domain Of T. Mari		2e-04
3a1s_A		258	Crystal Structue Of The Cytosolic Domain Of T. Mari		2e-04
3hyr_A		270	Structural Insight Into G Protein Coupling And Regu		2e-04
4dhe_A		223	Crystal Structure Of A Probable Gtp-Binding Protein		7e-04
2qtf_A		364	Crystal Structure Of A Gtp-Binding Protein From The		8e-04

>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456