Psyllid ID: psy17095
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| 156543977 | 389 | PREDICTED: protein Wnt-5b-like [Nasonia | 0.730 | 0.516 | 0.434 | 5e-42 | |
| 405952368 | 321 | Protein Wnt-5a [Crassostrea gigas] | 0.530 | 0.454 | 0.506 | 1e-41 | |
| 14249180 | 359 | protein Wnt-5b precursor [Homo sapiens] | 0.567 | 0.434 | 0.488 | 6e-41 | |
| 62088036 | 284 | wingless-type MMTV integration site fami | 0.567 | 0.549 | 0.488 | 9e-41 | |
| 119609332 | 411 | wingless-type MMTV integration site fami | 0.567 | 0.379 | 0.488 | 1e-40 | |
| 91085809 | 373 | PREDICTED: similar to wnt5 protein [Trib | 0.607 | 0.447 | 0.448 | 1e-40 | |
| 432091430 | 234 | Protein Wnt-5b [Myotis davidii] | 0.567 | 0.666 | 0.482 | 2e-40 | |
| 197100357 | 359 | protein Wnt-5b precursor [Pongo abelii] | 0.567 | 0.434 | 0.482 | 2e-40 | |
| 355563881 | 330 | Protein Wnt-5b, partial [Macaca mulatta] | 0.567 | 0.472 | 0.476 | 2e-40 | |
| 332838277 | 359 | PREDICTED: protein Wnt-5b isoform 2 [Pan | 0.567 | 0.434 | 0.482 | 2e-40 |
| >gi|156543977|ref|XP_001605266.1| PREDICTED: protein Wnt-5b-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 177 bits (449), Expect = 5e-42, Method: Compositional matrix adjust.
Identities = 97/223 (43%), Positives = 123/223 (55%), Gaps = 22/223 (9%)
Query: 1 MSSDLSSQPISEP-SSPPINAGVGFAPPISLEDSARVCSRVPGLSFGQVRQCSLFADHMA 59
+ S L + EP +S N+ + + +++ +CS + GLS GQ + C L DHM
Sbjct: 41 IYSGLRGISLLEPATSSSGNSDLPGIVDVRTMEASSLCSSLKGLSQGQEKLCQLSHDHMP 100
Query: 60 SVGRGAAESIAECQHQFRHHRWNCSSGGPGAGGGGGGKSESTTAPSVLPPTLHIGSREAA 119
V RGA I ECQHQFRH RWNCS+ + SV P L +GSRE A
Sbjct: 101 CVARGAKAGIHECQHQFRHRRWNCST---------------SNDESVFGPVLDLGSRETA 145
Query: 120 FTHAIATAGVVYAVARSCKDGSLPSCGCSRTARPKDLKREWLWGGCGDNLEYGYKGGK-- 177
F HAI AGVVY++ R+C+DG L SCGCSR+ RPKDL REW+WGGCGDNLEYGYK +
Sbjct: 146 FVHAITAAGVVYSLGRACRDGQLSSCGCSRSGRPKDLNREWIWGGCGDNLEYGYKFAQSF 205
Query: 178 ---KER-RKQRRRKRKRKRKKEEEEKEEEKKEEKKKEKKKEKK 216
+ER R +RR R+ R E + K K K
Sbjct: 206 VDVRERERSYKRRSRQHGRSLMNLHNNEAGRRAVIKSSKVTCK 248
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|405952368|gb|EKC20188.1| Protein Wnt-5a [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|14249180|ref|NP_116031.1| protein Wnt-5b precursor [Homo sapiens] gi|17402919|ref|NP_110402.2| protein Wnt-5b precursor [Homo sapiens] gi|20532427|sp|Q9H1J7.2|WNT5B_HUMAN RecName: Full=Protein Wnt-5b; Flags: Precursor gi|12804649|gb|AAH01749.1| Wingless-type MMTV integration site family, member 5B [Homo sapiens] gi|14715478|dbj|BAB62039.1| WNT5B [Homo sapiens] gi|119609331|gb|EAW88925.1| wingless-type MMTV integration site family, member 5B, isoform CRA_a [Homo sapiens] gi|119609333|gb|EAW88927.1| wingless-type MMTV integration site family, member 5B, isoform CRA_a [Homo sapiens] gi|123981906|gb|ABM82782.1| wingless-type MMTV integration site family, member 5B [synthetic construct] gi|123996739|gb|ABM85971.1| wingless-type MMTV integration site family, member 5B [synthetic construct] gi|158261883|dbj|BAF83119.1| unnamed protein product [Homo sapiens] gi|307684504|dbj|BAJ20292.1| wingless-type MMTV integration site family, member 5B [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|62088036|dbj|BAD92465.1| wingless-type MMTV integration site family, member 5B precursor variant [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|119609332|gb|EAW88926.1| wingless-type MMTV integration site family, member 5B, isoform CRA_b [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|91085809|ref|XP_974684.1| PREDICTED: similar to wnt5 protein [Tribolium castaneum] gi|270011028|gb|EFA07476.1| hypothetical protein TcasGA2_TC009318 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|432091430|gb|ELK24512.1| Protein Wnt-5b [Myotis davidii] | Back alignment and taxonomy information |
|---|
| >gi|197100357|ref|NP_001127098.1| protein Wnt-5b precursor [Pongo abelii] gi|75061496|sp|Q5NVK2.1|WNT5B_PONAB RecName: Full=Protein Wnt-5b; Flags: Precursor gi|56403742|emb|CAI29661.1| hypothetical protein [Pongo abelii] | Back alignment and taxonomy information |
|---|
| >gi|355563881|gb|EHH20381.1| Protein Wnt-5b, partial [Macaca mulatta] | Back alignment and taxonomy information |
|---|
| >gi|332838277|ref|XP_522589.3| PREDICTED: protein Wnt-5b isoform 2 [Pan troglodytes] gi|332838279|ref|XP_003339271.1| PREDICTED: protein Wnt-5b [Pan troglodytes] gi|397499352|ref|XP_003820418.1| PREDICTED: protein Wnt-5b isoform 1 [Pan paniscus] gi|397499354|ref|XP_003820419.1| PREDICTED: protein Wnt-5b isoform 2 [Pan paniscus] gi|397499356|ref|XP_003820420.1| PREDICTED: protein Wnt-5b isoform 3 [Pan paniscus] gi|410046120|ref|XP_003952129.1| PREDICTED: protein Wnt-5b [Pan troglodytes] gi|410046122|ref|XP_003952130.1| PREDICTED: protein Wnt-5b [Pan troglodytes] gi|410332041|gb|JAA34967.1| wingless-type MMTV integration site family, member 5B [Pan troglodytes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| ZFIN|ZDB-GENE-060328-3 | 374 | wnt5a "wingless-type MMTV inte | 0.487 | 0.358 | 0.523 | 2.3e-39 | |
| UNIPROTKB|F5H7Q6 | 254 | WNT5B "Protein Wnt" [Homo sapi | 0.487 | 0.527 | 0.523 | 2.9e-39 | |
| UNIPROTKB|Q9H1J7 | 359 | WNT5B "Protein Wnt-5b" [Homo s | 0.487 | 0.373 | 0.523 | 2.9e-39 | |
| UNIPROTKB|Q5NVK2 | 359 | WNT5B "Protein Wnt-5b" [Pongo | 0.487 | 0.373 | 0.516 | 1.6e-38 | |
| UNIPROTKB|F1Q0S4 | 358 | WNT5B "Protein Wnt" [Canis lup | 0.487 | 0.374 | 0.516 | 2.6e-38 | |
| UNIPROTKB|F1NMK4 | 332 | WNT5B "Protein Wnt" [Gallus ga | 0.487 | 0.403 | 0.516 | 3.4e-38 | |
| UNIPROTKB|F1NMK6 | 358 | WNT5B "Protein Wnt" [Gallus ga | 0.487 | 0.374 | 0.516 | 3.4e-38 | |
| UNIPROTKB|F1MP15 | 363 | WNT5B "Protein Wnt" [Bos tauru | 0.487 | 0.369 | 0.510 | 4.3e-38 | |
| MGI|MGI:98959 | 359 | Wnt5b "wingless-related MMTV i | 0.487 | 0.373 | 0.510 | 5.5e-38 | |
| UNIPROTKB|Q6DII0 | 360 | wnt5b "Protein Wnt" [Xenopus ( | 0.487 | 0.372 | 0.510 | 8.9e-38 |
| ZFIN|ZDB-GENE-060328-3 wnt5a "wingless-type MMTV integration site family, member 5a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 420 (152.9 bits), Expect = 2.3e-39, P = 2.3e-39
Identities = 78/149 (52%), Positives = 103/149 (69%)
Query: 26 PPISLEDSARVCSRVPGLSFGQVRQCSLFADHMASVGRGAAESIAECQHQFRHHRWNCSS 85
P + + +CS++ GLS GQ + C L+ DHM +G GA I ECQHQFRHHRWNCS+
Sbjct: 52 PEVYVIGGQPLCSQLSGLSKGQKKLCQLYQDHMQYIGEGAKTGIRECQHQFRHHRWNCST 111
Query: 86 XXXXXXXXXXXKSESTTAPSVLPPTLHIGSREAAFTHAIATAGVVYAVARSCKDGSLPSC 145
+++T VL +HIGSRE+AF AI+ AGV++AV+R+C++G+L SC
Sbjct: 112 V------------DNST---VLGRVMHIGSRESAFAFAISAAGVLHAVSRACREGALSSC 156
Query: 146 GCSRTARPKDLKREWLWGGCGDNLEYGYK 174
GCSR +RPKDL R+WLWGGCGDNL YGY+
Sbjct: 157 GCSRASRPKDLPRDWLWGGCGDNLNYGYR 185
|
|
| UNIPROTKB|F5H7Q6 WNT5B "Protein Wnt" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H1J7 WNT5B "Protein Wnt-5b" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5NVK2 WNT5B "Protein Wnt-5b" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q0S4 WNT5B "Protein Wnt" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NMK4 WNT5B "Protein Wnt" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NMK6 WNT5B "Protein Wnt" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MP15 WNT5B "Protein Wnt" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98959 Wnt5b "wingless-related MMTV integration site 5B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DII0 wnt5b "Protein Wnt" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 275 | |||
| pfam00110 | 308 | pfam00110, wnt, wnt family | 4e-50 | |
| smart00097 | 305 | smart00097, WNT1, found in Wnt-1 | 4e-49 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-12 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-12 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-11 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-11 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-11 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-11 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-10 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 4e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-10 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-10 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 8e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-10 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 9e-10 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-09 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-09 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-09 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-09 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-08 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 1e-08 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 1e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-08 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 4e-08 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 4e-08 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 4e-08 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-08 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 7e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 8e-08 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 9e-08 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 1e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-07 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 1e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-07 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 2e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-07 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-07 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-07 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-07 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-07 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-07 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 3e-07 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-07 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-07 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 3e-07 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 3e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-07 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-07 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 4e-07 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 4e-07 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 4e-07 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 4e-07 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 4e-07 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 5e-07 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 5e-07 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-07 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 6e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-07 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-07 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 7e-07 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 9e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 9e-07 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 9e-07 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 9e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-06 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 1e-06 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 1e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-06 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 1e-06 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 1e-06 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 1e-06 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 1e-06 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 1e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 2e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-06 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-06 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 2e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-06 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 3e-06 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 3e-06 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 3e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 3e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 3e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 3e-06 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 3e-06 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 3e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 3e-06 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 3e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-06 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 4e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 4e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 4e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 4e-06 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 5e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 5e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 5e-06 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 5e-06 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 5e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 6e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 6e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 7e-06 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 7e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-06 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 7e-06 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 7e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 8e-06 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 8e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 8e-06 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 8e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 9e-06 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 9e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 9e-06 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 9e-06 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 9e-06 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 9e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 1e-05 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-05 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-05 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 1e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-05 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 1e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 1e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-05 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 1e-05 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 1e-05 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 2e-05 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-05 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 2e-05 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 2e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-05 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 2e-05 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 2e-05 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 2e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 2e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 2e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 2e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 2e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 2e-05 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 2e-05 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 2e-05 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 2e-05 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 2e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 2e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 2e-05 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 2e-05 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 2e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-05 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 2e-05 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 3e-05 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 3e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 3e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 3e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 3e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 3e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 3e-05 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 3e-05 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 3e-05 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 3e-05 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 3e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 3e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 3e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 4e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 4e-05 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 4e-05 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 4e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 4e-05 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 4e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 4e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 4e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 4e-05 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 4e-05 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 5e-05 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 5e-05 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 5e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 5e-05 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 5e-05 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 5e-05 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 5e-05 | |
| pfam12720 | 169 | pfam12720, DUF3807, Protein of unknown function (D | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 6e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 6e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 6e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 6e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 6e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 6e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-05 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 7e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 7e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 7e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 7e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 7e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 8e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 8e-05 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 8e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 8e-05 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 8e-05 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 8e-05 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 8e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 9e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 9e-05 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 9e-05 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 9e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-04 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 1e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-04 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 1e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 1e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-04 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 1e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 1e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 1e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 2e-04 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 2e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 2e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 2e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 2e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 2e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 2e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 2e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 2e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 2e-04 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 2e-04 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 2e-04 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 2e-04 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 2e-04 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-04 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 2e-04 | |
| COG3611 | 417 | COG3611, DnaB, Replication initiation/membrane att | 2e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 2e-04 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 2e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-04 | |
| COG5019 | 373 | COG5019, CDC3, Septin family protein [Cell divisio | 2e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-04 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 3e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 3e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 3e-04 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 3e-04 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 3e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| COG2604 | 594 | COG2604, COG2604, Uncharacterized protein conserve | 3e-04 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 3e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 3e-04 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 4e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 4e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 4e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 4e-04 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 4e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 4e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 4e-04 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 4e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 4e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 4e-04 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 4e-04 | |
| pfam10310 | 436 | pfam10310, DUF2413, Protein of unknown function (D | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 5e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-04 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 5e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 5e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 5e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-04 | |
| pfam05424 | 276 | pfam05424, Duffy_binding, Duffy binding domain | 5e-04 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| COG1193 | 753 | COG1193, COG1193, Mismatch repair ATPase (MutS fam | 5e-04 | |
| pfam13148 | 379 | pfam13148, DUF3987, Protein of unknown function (D | 5e-04 | |
| COG0525 | 877 | COG0525, ValS, Valyl-tRNA synthetase [Translation, | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 6e-04 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 6e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 6e-04 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 6e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 6e-04 | |
| COG5019 | 373 | COG5019, CDC3, Septin family protein [Cell divisio | 6e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 6e-04 | |
| COG0610 | 962 | COG0610, COG0610, Type I site-specific restriction | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-04 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 7e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 7e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 7e-04 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 7e-04 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 7e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 7e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-04 | |
| pfam10211 | 189 | pfam10211, Ax_dynein_light, Axonemal dynein light | 7e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 8e-04 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 8e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 8e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 8e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 8e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 8e-04 | |
| COG0711 | 161 | COG0711, AtpF, F0F1-type ATP synthase, subunit b [ | 8e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 8e-04 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 9e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 9e-04 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 9e-04 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 9e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 9e-04 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 9e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 9e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.001 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.001 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.001 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.001 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 0.001 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 0.001 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 0.001 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.001 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.001 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 0.001 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 0.001 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.001 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 0.001 | |
| COG5019 | 373 | COG5019, CDC3, Septin family protein [Cell divisio | 0.001 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| pfam13148 | 379 | pfam13148, DUF3987, Protein of unknown function (D | 0.001 | |
| pfam10211 | 189 | pfam10211, Ax_dynein_light, Axonemal dynein light | 0.001 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 0.001 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 0.001 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 0.001 | |
| smart00786 | 196 | smart00786, SHR3_chaperone, ER membrane protein SH | 0.001 | |
| COG0016 | 335 | COG0016, PheS, Phenylalanyl-tRNA synthetase alpha | 0.001 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.001 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.002 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.002 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.002 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.002 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 0.002 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.002 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.002 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.002 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.002 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.002 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.002 | |
| pfam12720 | 169 | pfam12720, DUF3807, Protein of unknown function (D | 0.002 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.002 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.002 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.002 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.002 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.002 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.002 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.002 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 0.002 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 0.002 | |
| COG0610 | 962 | COG0610, COG0610, Type I site-specific restriction | 0.002 | |
| smart00786 | 196 | smart00786, SHR3_chaperone, ER membrane protein SH | 0.002 | |
| smart00786 | 196 | smart00786, SHR3_chaperone, ER membrane protein SH | 0.002 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.002 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 0.002 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.002 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 0.002 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 0.002 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 0.002 | |
| PRK14953 | 486 | PRK14953, PRK14953, DNA polymerase III subunits ga | 0.002 | |
| PRK13735 | 942 | PRK13735, PRK13735, conjugal transfer mating pair | 0.002 | |
| COG5421 | 480 | COG5421, COG5421, Transposase [DNA replication, re | 0.002 | |
| pfam11262 | 296 | pfam11262, Tho2, Transcription factor/nuclear expo | 0.002 | |
| PRK09535 | 366 | PRK09535, btuC, corrinoid ABC transporter permease | 0.002 | |
| PTZ00342 | 746 | PTZ00342, PTZ00342, acyl-CoA synthetase; Provision | 0.002 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 0.002 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 0.002 | |
| pfam05917 | 417 | pfam05917, DUF874, Helicobacter pylori protein of | 0.002 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 0.003 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.003 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.003 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.003 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.003 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 0.003 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.003 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 0.003 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.003 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.003 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 0.003 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 0.003 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.003 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 0.003 | |
| pfam11262 | 296 | pfam11262, Tho2, Transcription factor/nuclear expo | 0.003 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.003 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 0.003 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 0.003 | |
| PTZ00069 | 300 | PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov | 0.003 | |
| PRK04098 | 158 | PRK04098, PRK04098, sec-independent translocase; P | 0.003 | |
| pfam06098 | 288 | pfam06098, Radial_spoke_3, Radial spoke protein 3 | 0.003 | |
| pfam03998 | 239 | pfam03998, Utp11, Utp11 protein | 0.003 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.004 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.004 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.004 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.004 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.004 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 0.004 | |
| pfam12720 | 169 | pfam12720, DUF3807, Protein of unknown function (D | 0.004 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.004 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.004 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 0.004 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.004 | |
| COG5019 | 373 | COG5019, CDC3, Septin family protein [Cell divisio | 0.004 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.004 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.004 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 0.004 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 0.004 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 0.004 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 0.004 | |
| pfam06644 | 250 | pfam06644, ATP11, ATP11 protein | 0.004 | |
| pfam11719 | 397 | pfam11719, Drc1-Sld2, DNA replication and checkpoi | 0.004 | |
| PHA00727 | 278 | PHA00727, PHA00727, hypothetical protein | 0.004 |
| >gnl|CDD|215724 pfam00110, wnt, wnt family | Back alignment and domain information |
|---|
Score = 166 bits (423), Expect = 4e-50
Identities = 67/157 (42%), Positives = 90/157 (57%), Gaps = 20/157 (12%)
Query: 36 VCSRVPGLSFGQVRQCSLFADHMASVGRGAAESIAECQHQFRHHRWNCSSGGPGAGGGGG 95
+CS++PGLS Q R C D MASVG GA I ECQHQFR+ RWNCS+
Sbjct: 1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCST---------- 50
Query: 96 GKSESTTAPSVLPPTLHIGSREAAFTHAIATAGVVYAVARSCKDGSLPSCGCSRTARPKD 155
+ SV L G+RE AF +AI++AGVV+AV R+C +G+L SCGC R+ R +
Sbjct: 51 -----LDSSSVFGKILKRGTRETAFVYAISSAGVVHAVTRACSEGNLESCGCDRSRRGRS 105
Query: 156 LKREWLWGGCGDNLEYGYKGGKK-----ERRKQRRRK 187
W WGGC DN+++G + ++ ER + R
Sbjct: 106 GPGGWEWGGCSDNIKFGIRFSREFLDARERGRDARAL 142
|
Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. Length = 308 |
| >gnl|CDD|128408 smart00097, WNT1, found in Wnt-1 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221733 pfam12720, DUF3807, Protein of unknown function (DUF3807) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|226138 COG3611, DnaB, Replication initiation/membrane attachment protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225324 COG2604, COG2604, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218585 pfam05424, Duffy_binding, Duffy binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221937 pfam13148, DUF3987, Protein of unknown function (DUF3987) | Back alignment and domain information |
|---|
| >gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223683 COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221937 pfam13148, DUF3987, Protein of unknown function (DUF3987) | Back alignment and domain information |
|---|
| >gnl|CDD|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129022 smart00786, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|223095 COG0016, PheS, Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|221733 pfam12720, DUF3807, Protein of unknown function (DUF3807) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|223683 COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|129022 smart00786, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|129022 smart00786, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
| >gnl|CDD|237867 PRK14953, PRK14953, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227708 COG5421, COG5421, Transposase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221049 pfam11262, Tho2, Transcription factor/nuclear export subunit protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|236553 PRK09535, btuC, corrinoid ABC transporter permease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|114629 pfam05917, DUF874, Helicobacter pylori protein of unknown function (DUF874) | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|221049 pfam11262, Tho2, Transcription factor/nuclear export subunit protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235219 PRK04098, PRK04098, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218896 pfam06098, Radial_spoke_3, Radial spoke protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|217834 pfam03998, Utp11, Utp11 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221733 pfam12720, DUF3807, Protein of unknown function (DUF3807) | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|203489 pfam06644, ATP11, ATP11 protein | Back alignment and domain information |
|---|
| >gnl|CDD|221185 pfam11719, Drc1-Sld2, DNA replication and checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|222812 PHA00727, PHA00727, hypothetical protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| KOG3913|consensus | 356 | 100.0 | ||
| smart00097 | 305 | WNT1 found in Wnt-1. | 100.0 | |
| PF00110 | 310 | wnt: wnt family; InterPro: IPR005817 Wnt proteins | 100.0 | |
| KOG4364|consensus | 811 | 92.63 | ||
| KOG2572|consensus | 498 | 81.93 |
| >KOG3913|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-52 Score=396.03 Aligned_cols=145 Identities=43% Similarity=0.786 Sum_probs=134.6
Q ss_pred hhhhccCCCCCCHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHhhccCcccCCCCCCCCCCCCCCCCCCCCCCCCCCcccc
Q psy17095 33 SARVCSRVPGLSFGQVRQCSLFADHMASVGRGAAESIAECQHQFRHHRWNCSSGGPGAGGGGGGKSESTTAPSVLPPTLH 112 (275)
Q Consensus 33 ~~~iC~~l~GLs~rQ~~LCr~~p~lm~sV~~GaklAI~ECQ~QFr~~RWNCSs~~~~~~~~~~~k~~~~~~~~~fg~iL~ 112 (275)
...+|..++||+++|+++|++||++|++|++|+++||+|||||||++|||||+. +..++|+++|.
T Consensus 44 ~~~~C~~l~gL~~~Q~~~Cr~~p~~~~sv~~G~~~~i~ECq~QFr~~RWNCs~~---------------~~~~~~g~~l~ 108 (356)
T KOG3913|consen 44 AKPLCDNLPGLSPRQRRLCRRNPDVMPSVAEGAREGIQECQFQFRFRRWNCSTL---------------DQLPVFGPLLS 108 (356)
T ss_pred cccchhhccccCHHHHHHHHhCcchHHHHHHHHHHHHHHHHHHHHhhccCCCCC---------------ccccccchhhc
Confidence 345899999999999999999999999999999999999999999999999988 56789999999
Q ss_pred cCCchhHHHHHHHHHHHHHHHHhhhcCCCCCCccCcCCCCCCCCCCCcccCCCCcchhhhhhhhhhhhhhhHHhHHHHhh
Q psy17095 113 IGSREAAFTHAIATAGVVYAVARSCKDGSLPSCGCSRTARPKDLKREWLWGGCGDNLEYGYKGGKKERRKQRRRKRKRKR 192 (275)
Q Consensus 113 ~GTREtAFV~AItSAGVv~aVTRACS~G~L~~CgCd~~~~~~~~~~~w~WGGCSDNI~fG~~fSr~FlDa~er~~~~r~~ 192 (275)
.|+||+||||||+||||+|+|||||+.|.|..||||....+...+++|+||||||||.||+.||+.|||+++++++=|..
T Consensus 109 ~g~REsAFv~AIssAgV~havtraCs~G~l~~CgCd~~~~~~~~~~~w~WGGCsDnv~fG~~fsr~FlD~re~~~d~r~l 188 (356)
T KOG3913|consen 109 RGTRETAFVYAISSAGVAHAVTRACSQGNLESCGCDPSPNGKSGPEGWEWGGCSDNVDFGIRFSRKFLDAREKRKDARAL 188 (356)
T ss_pred ccchHHHHHHHHHHhHHHHHHHHHhcCCCCCCcCCCCCCCCCCCCCCccccCCCCchHHHHHHHHHhccccccccCHHHH
Confidence 99999999999999999999999999999999999987766556677999999999999999999999999887655543
|
|
| >smart00097 WNT1 found in Wnt-1 | Back alignment and domain information |
|---|
| >PF00110 wnt: wnt family; InterPro: IPR005817 Wnt proteins constitute a large family of secreted molecules that are involved in intercellular signalling during development | Back alignment and domain information |
|---|
| >KOG4364|consensus | Back alignment and domain information |
|---|
| >KOG2572|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 275 | ||||
| 4f0a_B | 316 | Crystal Structure Of Xwnt8 In Complex With The Cyst | 2e-16 |
| >pdb|4F0A|B Chain B, Crystal Structure Of Xwnt8 In Complex With The Cysteine-Rich Domain Of Frizzled 8 Length = 316 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 275 | |||
| 4f0a_B | 316 | Protein WNT-8, XWNT-8; WNT signaling, ligand-recep | 3e-31 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 1e-13 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 4e-13 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 9e-13 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 5e-12 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 8e-12 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 4e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-12 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-09 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-07 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 6e-07 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-04 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 7e-09 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 3e-08 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 4e-08 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 2e-07 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 5e-07 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 2e-06 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 1e-05 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 1e-05 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 2e-04 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 8e-08 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 1e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 2e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 2e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 3e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 2e-04 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-06 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 3e-04 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 1e-06 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 9e-06 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 2e-05 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 2e-05 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 3e-05 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 3e-05 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 5e-04 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 5e-06 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 5e-06 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 7e-06 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 9e-06 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 1e-05 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 2e-05 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 5e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 9e-06 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 2e-05 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 9e-05 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 2e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 7e-04 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 1e-05 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 3e-04 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 1e-05 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 3e-05 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 8e-05 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 3e-04 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 4e-04 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 2e-05 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 2e-05 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 3e-05 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 3e-05 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 6e-05 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 8e-05 | |
| 2zjr_S | 237 | 50S ribosomal protein L25; ribosome, large ribosom | 3e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-05 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-05 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 5e-05 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 1e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 4e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 4e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 5e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 6e-04 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 3e-05 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 5e-05 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 1e-04 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 2e-04 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 3e-04 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 4e-04 | |
| 2p4f_A | 299 | Similar to SP|P32453 saccharomyces cerevisiae YNL | 1e-04 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 2e-04 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 6e-04 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 2e-04 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 3e-04 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 3e-04 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 3e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 4e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 4e-04 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 5e-04 | |
| 4a17_C | 410 | RPL4, ribosomal protein L3; eukaryotic ribosome, r | 5e-04 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 5e-04 | |
| 3izc_e | 244 | 60S ribosomal protein RPL7 (L30P); eukaryotic ribo | 6e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 8e-04 |
| >4f0a_B Protein WNT-8, XWNT-8; WNT signaling, ligand-receptor complex, frizzled, fatty acylation, glycosylation, signaling protein; HET: NAG BMA MAN FUC PAM; 3.25A {Xenopus laevis} Length = 316 | Back alignment and structure |
|---|
Score = 117 bits (293), Expect = 3e-31
Identities = 44/151 (29%), Positives = 66/151 (43%), Gaps = 15/151 (9%)
Query: 43 LSFGQVRQCSLFADHMASVGRGAAESIAECQHQFRHHRWNCSSGGPGAGGGGGGKSESTT 102
++ + + + ASV GA I EC++QF RWNC +T
Sbjct: 4 VNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPE---------------ST 48
Query: 103 APSVLPPTLHIGSREAAFTHAIATAGVVYAVARSCKDGSLPSCGCSRTARPKDLKREWLW 162
L +RE +F HAI++AGV+Y + R+C G +CGC + + R W+W
Sbjct: 49 LQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVW 108
Query: 163 GGCGDNLEYGYKGGKKERRKQRRRKRKRKRK 193
GGC DN E+G + K + R
Sbjct: 109 GGCSDNAEFGERISKLFVDGLETGQDARALM 139
|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >2p4f_A Similar to SP|P32453 saccharomyces cerevisiae YNL ATP11; half barrel, chaperone; HET: P6G; 1.40A {Candida glabrata cbs 138} Length = 299 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Length = 374 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Length = 374 | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Length = 301 | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Length = 301 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Length = 305 | Back alignment and structure |
|---|
| >4a17_C RPL4, ribosomal protein L3; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_C 4a1c_C 4a1e_C Length = 410 | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Length = 276 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| 4f0a_B | 316 | Protein WNT-8, XWNT-8; WNT signaling, ligand-recep | 100.0 |
| >4f0a_B Protein WNT-8, XWNT-8; WNT signaling, ligand-receptor complex, frizzled, fatty acylation, glycosylation, signaling protein; HET: NAG BMA MAN FUC PAM; 3.25A {Xenopus laevis} | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-44 Score=336.69 Aligned_cols=121 Identities=35% Similarity=0.697 Sum_probs=107.8
Q ss_pred hhhhHHHHHHHHHHHHHHHHHHhhccCcccCCCCCCCCCCCCCCCCCCCCCCCCCCc-ccccCCchhHHHHHHHHHHHHH
Q psy17095 53 LFADHMASVGRGAAESIAECQHQFRHHRWNCSSGGPGAGGGGGGKSESTTAPSVLPP-TLHIGSREAAFTHAIATAGVVY 131 (275)
Q Consensus 53 ~~p~lm~sV~~GaklAI~ECQ~QFr~~RWNCSs~~~~~~~~~~~k~~~~~~~~~fg~-iL~~GTREtAFV~AItSAGVv~ 131 (275)
+||++|++|++|+++||+|||+||+++|||||+. ..++|++ +|..||||+||||||+||||+|
T Consensus 14 ~~~~~~~~v~~Ga~~~i~ECq~QFr~~RWNCs~~----------------~~~~~~~~~l~~g~REtAFv~AissAgv~~ 77 (316)
T 4f0a_B 14 AYLTYSASVAVGAQNGIEECKYQFAWERWNCPES----------------TLQLATHNGLRSATRETSFVHAISSAGVMY 77 (316)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHTTTSSSCCCCC----------------TTHHHHCTTCCSCCHHHHHHHHHHHHHHHH
T ss_pred cChHHHHHHHHHHHHHHHHHHHHhcCCCcCCCCC----------------ccccCCcccccCCCHHHHHHHHHHHHHHHH
Confidence 5789999999999999999999999999999965 2345666 6889999999999999999999
Q ss_pred HHHhhhcCCCCCCccCcCCCCCCCCCCCcccCCCCcchhhhhhhhhhhhhhhHHhHHH
Q psy17095 132 AVARSCKDGSLPSCGCSRTARPKDLKREWLWGGCGDNLEYGYKGGKKERRKQRRRKRK 189 (275)
Q Consensus 132 aVTRACS~G~L~~CgCd~~~~~~~~~~~w~WGGCSDNI~fG~~fSr~FlDa~er~~~~ 189 (275)
+||+|||.|.|..||||...++.+..++|+||||||||.||+.||+.|||+++++++-
T Consensus 78 avtraCs~G~l~~C~Cd~~~~~~~~~~~w~WgGCsdnv~~G~~fsr~F~D~~e~~~d~ 135 (316)
T 4f0a_B 78 TLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDA 135 (316)
T ss_dssp HHHHHHHTTTCSSCCCCCTTTTSEEETTEEECSCCCCHHHHHHHHHHHHHHHCCSSSH
T ss_pred HHHHHHhCCCCCCCCCCCCCCCCCcccCceeCCccchhHHHHHHHHHHhccccccccH
Confidence 9999999999999999987765433578999999999999999999999998866443
|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 275 | ||||
| d1zroa1 | 275 | a.264.1.1 (A:8-282) Erythrocyte binding antigen re | 3e-04 | |
| d1zroa1 | 275 | a.264.1.1 (A:8-282) Erythrocyte binding antigen re | 0.001 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-04 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-04 | |
| d1zroa2 | 314 | a.264.1.1 (A:283-596) Erythrocyte binding antigen | 6e-04 | |
| d1zroa2 | 314 | a.264.1.1 (A:283-596) Erythrocyte binding antigen | 8e-04 | |
| d1zroa2 | 314 | a.264.1.1 (A:283-596) Erythrocyte binding antigen | 0.001 | |
| d2c6ja1 | 294 | a.264.1.1 (A:15-308) Duffy receptor, alpha form {P | 9e-04 | |
| d2efla1 | 288 | a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP | 0.002 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 0.003 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 0.004 | |
| d2efka1 | 279 | a.238.1.4 (A:10-288) CDC42-interacting protein 4, | 0.003 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 279 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00