Psyllid ID: psy17181
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| 156550987 | 588 | PREDICTED: transmembrane 9 superfamily m | 0.666 | 0.085 | 0.86 | 2e-17 | |
| 357616006 | 543 | putative endomembrane protein emp70 [Dan | 0.666 | 0.092 | 0.86 | 7e-17 | |
| 340722781 | 584 | PREDICTED: transmembrane 9 superfamily m | 0.666 | 0.085 | 0.84 | 1e-16 | |
| 383857283 | 586 | PREDICTED: transmembrane 9 superfamily m | 0.666 | 0.085 | 0.84 | 1e-16 | |
| 66536937 | 586 | PREDICTED: transmembrane 9 superfamily m | 0.666 | 0.085 | 0.84 | 2e-16 | |
| 380029413 | 586 | PREDICTED: LOW QUALITY PROTEIN: transmem | 0.666 | 0.085 | 0.84 | 2e-16 | |
| 321474789 | 580 | hypothetical protein DAPPUDRAFT_313523 [ | 0.666 | 0.086 | 0.8 | 2e-16 | |
| 307176971 | 588 | Transmembrane 9 superfamily member 3 [Ca | 0.666 | 0.085 | 0.82 | 2e-16 | |
| 307211509 | 584 | Transmembrane 9 superfamily member 3 [Ha | 0.666 | 0.085 | 0.82 | 2e-16 | |
| 332023698 | 588 | Transmembrane 9 superfamily member 3 [Ac | 0.666 | 0.085 | 0.82 | 2e-16 |
| >gi|156550987|ref|XP_001604363.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 92.8 bits (229), Expect = 2e-17, Method: Compositional matrix adjust.
Identities = 43/50 (86%), Positives = 47/50 (94%)
Query: 26 QLQMYGLFQTTFYFGYMALFSLGLGIMCGTVGYVGTSLFVRKIYATVKID 75
+ +MYGLFQT FYFGYMALFSL LGIMCGTVGY+GTSLFVRKIY+TVKID
Sbjct: 539 KTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYIGTSLFVRKIYSTVKID 588
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357616006|gb|EHJ69950.1| putative endomembrane protein emp70 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|340722781|ref|XP_003399780.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus terrestris] gi|350424164|ref|XP_003493708.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383857283|ref|XP_003704134.1| PREDICTED: transmembrane 9 superfamily member 3 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|66536937|ref|XP_623945.1| PREDICTED: transmembrane 9 superfamily member 3 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380029413|ref|XP_003698368.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 3-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|321474789|gb|EFX85753.1| hypothetical protein DAPPUDRAFT_313523 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|307176971|gb|EFN66277.1| Transmembrane 9 superfamily member 3 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307211509|gb|EFN87604.1| Transmembrane 9 superfamily member 3 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332023698|gb|EGI63922.1| Transmembrane 9 superfamily member 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| FB|FBgn0035622 | 592 | CG10590 [Drosophila melanogast | 0.64 | 0.081 | 0.812 | 4.9e-16 | |
| ZFIN|ZDB-GENE-040426-2714 | 586 | tm9sf3 "transmembrane 9 superf | 0.64 | 0.081 | 0.791 | 7.8e-16 | |
| UNIPROTKB|F1NRG5 | 556 | TM9SF3 "Uncharacterized protei | 0.64 | 0.086 | 0.770 | 9e-16 | |
| UNIPROTKB|E1BMF1 | 587 | TM9SF3 "Uncharacterized protei | 0.64 | 0.081 | 0.770 | 1e-15 | |
| UNIPROTKB|E2RSD0 | 587 | TM9SF3 "Uncharacterized protei | 0.64 | 0.081 | 0.770 | 1e-15 | |
| MGI|MGI:1914262 | 587 | Tm9sf3 "transmembrane 9 superf | 0.64 | 0.081 | 0.770 | 1e-15 | |
| RGD|1564625 | 587 | Tm9sf3 "transmembrane 9 superf | 0.64 | 0.081 | 0.770 | 1e-15 | |
| UNIPROTKB|Q9HD45 | 589 | TM9SF3 "Transmembrane 9 superf | 0.64 | 0.081 | 0.770 | 1e-15 | |
| UNIPROTKB|F1SBF9 | 634 | TM9SF3 "Uncharacterized protei | 0.64 | 0.075 | 0.770 | 1.2e-15 | |
| WB|WBGene00021506 | 580 | Y41D4A.4 [Caenorhabditis elega | 0.64 | 0.082 | 0.729 | 1.5e-14 |
| FB|FBgn0035622 CG10590 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 209 (78.6 bits), Expect = 4.9e-16, P = 4.9e-16
Identities = 39/48 (81%), Positives = 44/48 (91%)
Query: 28 QMYGLFQTTFYFGYMALFSLGLGIMCGTVGYVGTSLFVRKIYATVKID 75
+M+GLFQT FYFGYMALFS LGI+CGTVGYVGT+LFVRKIY+ VKID
Sbjct: 545 KMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID 592
|
|
| ZFIN|ZDB-GENE-040426-2714 tm9sf3 "transmembrane 9 superfamily member 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRG5 TM9SF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BMF1 TM9SF3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RSD0 TM9SF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914262 Tm9sf3 "transmembrane 9 superfamily member 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1564625 Tm9sf3 "transmembrane 9 superfamily member 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9HD45 TM9SF3 "Transmembrane 9 superfamily member 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBF9 TM9SF3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00021506 Y41D4A.4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| KOG1278|consensus | 628 | 99.87 | ||
| KOG1277|consensus | 593 | 99.8 | ||
| PF02990 | 521 | EMP70: Endomembrane protein 70; InterPro: IPR00424 | 95.73 |
| >KOG1278|consensus | Back alignment and domain information |
|---|
Probab=99.87 E-value=1.8e-22 Score=159.63 Aligned_cols=68 Identities=38% Similarity=0.696 Sum_probs=66.5
Q ss_pred ecccchhhhhhhhHHhhhcccceeeeccchhhhHHHHHHHHHHHHHHHhhchhHHHHHHHHHHHHhhcccCC
Q psy17181 4 VDSNHSLLGLPSVFNFVTVRPQQLQMYGLFQTTFYFGYMALFSLGLGIMCGTVGYVGTSLFVRKIYATVKID 75 (75)
Q Consensus 4 ~~~~~~~~flYSi~y~~~~~~~kl~~~g~~s~vlYfgY~~l~sl~~~l~~GtiGflas~~FVr~IY~~iK~D 75 (75)
=|+.|+|+|+||++|+++ |++++|+++++||||||++++++++++||+|||++|+|||||||+++|+|
T Consensus 561 sG~~avY~fiYsi~Y~~~----kL~i~g~~s~~LYfgYsli~~~~~~l~tGtIGF~a~~~Fv~kIYssvKiD 628 (628)
T KOG1278|consen 561 SGSSAVYVFIYSIFYFFT----KLEISGFVSAVLYFGYSLIISLLFFLLTGTIGFLAAFWFVRKIYSSVKID 628 (628)
T ss_pred cCcchhhHHHHHHhhhhe----eeeecccchhHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHhhheecC
Confidence 378999999999999999 99999999999999999999999999999999999999999999999998
|
|
| >KOG1277|consensus | Back alignment and domain information |
|---|
| >PF02990 EMP70: Endomembrane protein 70; InterPro: IPR004240 The transmembrane 9 superfamily protein (TM9SF) may function as a channel or small molecule transporter | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00