Psyllid ID: psy17231


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRSRLELQTMGAGGIGTDSFKLGGRGSEEVF
cccccccEEEEEEEccccccHHHHHHHHcccccccccccccEEcEEEEEEEEEEccEEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEccccccccHHHHHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccc
cccHHHHHEEEEEEccccccccEEHEEEccccccccccEEccccEEEEEEEEEEccEEEEEEEEEEcccHHHHHHHHcccccccEEEEEEEcccHHHHHcHHHHHHHHHHHcHHHHEEEEcccccHHHccEEEEEcccHccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
masikvpeqkvilcgeygvgksslfrryaydtfissssrkstlgldnfnkeykvddrsiQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFlcgnneqchNLISSTYktscktgegVEEMFADIGRQLILSNRSrlelqtmgaggigtdsfklggrgseevf
masikvpeqkvilcgeygvgksslFRRYAYDTfissssrkstlgldnfnkeykvddrsIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRSRLELQtmgaggigtdsfklggrgseevf
MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRSRLELQTMGAGGIGTDSFKLGGRGSEEVF
********QKVILCGEYGVGKSSLFRRYAYDTFISS*****TLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRSRLELQ***********************
****KVP*QKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGR************************************
MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRSRLELQTMGAGGIGTDSFKLGGRGSEEVF
*ASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNR*****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRSRLELQTMGAGGIGTDSFKLGGRGSEEVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9C2L8205 Probable Ras-related prot N/A N/A 0.841 0.775 0.333 4e-18
Q54NU2204 Ras-related protein Rab-1 yes N/A 0.777 0.720 0.355 1e-17
O97572207 Ras-related protein Rab-7 yes N/A 0.809 0.739 0.335 1e-17
P35284243 Ras-related protein Rab-1 yes N/A 0.619 0.481 0.4 2e-17
Q52NJ2205 Ras-related protein Rab-1 yes N/A 0.587 0.541 0.429 2e-17
Q6IQ22244 Ras-related protein Rab-1 yes N/A 0.613 0.475 0.403 2e-17
P35283243 Ras-related protein Rab-1 yes N/A 0.613 0.477 0.403 2e-17
Q6NYB7205 Ras-related protein Rab-1 no N/A 0.587 0.541 0.429 2e-17
P62821205 Ras-related protein Rab-1 no N/A 0.587 0.541 0.429 2e-17
P62820205 Ras-related protein Rab-1 no N/A 0.587 0.541 0.429 2e-17
>sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 Back     alignment and function desciption
 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 92/183 (50%), Gaps = 24/183 (13%)

Query: 1   MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQ 60
           M+S K    KVI+ G+ GVGK+SL  +Y    F  S+S K+T+G D   +E  VDDR + 
Sbjct: 1   MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKF--SASYKATIGADFLTREVLVDDRQVT 58

Query: 61  MQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYA-----ENA 115
           MQLWDT G ER  S+  ++Y+ A+  +LV+ ++N+ SF  L     E +  A     +N 
Sbjct: 59  MQLWDTAGQERFQSLGVAFYRGADCCVLVYDVNNSKSFDALDSWRDEFLIQASPRDPDNF 118

Query: 116 KIFLCGNN---EQCHNLISST--------------YKTSCKTGEGVEEMFADIGRQLILS 158
              + GN    E+   +IS+               ++TS K    VE+ F  I R  ++ 
Sbjct: 119 PFVVLGNKIDMEESKRVISTKRAMTFCQSKGNIPYFETSAKEAINVEQAFEVIARNALMQ 178

Query: 159 NRS 161
             S
Sbjct: 179 EES 181




Protein transport. Probably involved in vesicular traffic.
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (taxid: 367110)
>sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 Back     alignment and function description
>sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 Back     alignment and function description
>sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 Back     alignment and function description
>sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 Back     alignment and function description
>sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 Back     alignment and function description
>sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 Back     alignment and function description
>sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 Back     alignment and function description
>sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 Back     alignment and function description
>sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
91083305207 PREDICTED: similar to rab [Tribolium cas 0.910 0.830 0.696 8e-74
242018215207 GTP-binding protein YPT31/YPT8, putative 0.925 0.845 0.663 2e-72
383857745207 PREDICTED: GTP-binding protein ypt7-like 0.925 0.845 0.663 4e-71
340723419207 PREDICTED: GTP-binding protein ypt7-like 0.925 0.845 0.663 4e-71
307175180207 GTP-binding protein ypt7 [Camponotus flo 0.925 0.845 0.663 5e-71
323434871207 Rab7 [Helicoverpa zea] 0.962 0.879 0.635 7e-71
380017524207 PREDICTED: GTP-binding protein ypt7-like 0.925 0.845 0.663 8e-71
19923014213 RabX6, isoform A [Drosophila melanogaste 0.989 0.877 0.616 3e-70
194864654213 GG14733 [Drosophila erecta] gi|195490177 0.989 0.877 0.611 3e-70
442629247222 RabX6, isoform B [Drosophila melanogaste 0.989 0.842 0.616 4e-70
>gi|91083305|ref|XP_974665.1| PREDICTED: similar to rab [Tribolium castaneum] gi|270007739|gb|EFA04187.1| hypothetical protein TcasGA2_TC014436 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 133/191 (69%), Positives = 156/191 (81%), Gaps = 19/191 (9%)

Query: 1   MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQ 60
           MA+IK+PEQKVILCGEYGVGKSS+FRR+  +TF++++ RKSTLGLD+++K Y+V DR ++
Sbjct: 1   MATIKIPEQKVILCGEYGVGKSSIFRRFTNNTFVTATDRKSTLGLDHYSKTYRVCDRDLK 60

Query: 61  MQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLC 120
           +QLWDTGGMERVASITSSYYKFAEAA+LVF+LDN ASFHVLSQHLL+IVTYAENAKIFLC
Sbjct: 61  LQLWDTGGMERVASITSSYYKFAEAAVLVFALDNPASFHVLSQHLLDIVTYAENAKIFLC 120

Query: 121 GNN-------------------EQCHNLISSTYKTSCKTGEGVEEMFADIGRQLILSNRS 161
           GN                    EQCHNLI+ TYKTSCKTGEG+EEMF DI  QL+ SNRS
Sbjct: 121 GNKADLLSDVPQITDSEIEAFCEQCHNLITGTYKTSCKTGEGIEEMFTDIAYQLVQSNRS 180

Query: 162 RLELQTMGAGG 172
           RLELQ+M   G
Sbjct: 181 RLELQSMEQHG 191




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242018215|ref|XP_002429575.1| GTP-binding protein YPT31/YPT8, putative [Pediculus humanus corporis] gi|212514533|gb|EEB16837.1| GTP-binding protein YPT31/YPT8, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383857745|ref|XP_003704364.1| PREDICTED: GTP-binding protein ypt7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340723419|ref|XP_003400087.1| PREDICTED: GTP-binding protein ypt7-like [Bombus terrestris] gi|350427736|ref|XP_003494860.1| PREDICTED: GTP-binding protein ypt7-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307175180|gb|EFN65273.1| GTP-binding protein ypt7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|323434871|gb|ADX66426.1| Rab7 [Helicoverpa zea] Back     alignment and taxonomy information
>gi|380017524|ref|XP_003692704.1| PREDICTED: GTP-binding protein ypt7-like [Apis florea] Back     alignment and taxonomy information
>gi|19923014|ref|NP_612052.1| RabX6, isoform A [Drosophila melanogaster] gi|7291991|gb|AAF47406.1| RabX6, isoform A [Drosophila melanogaster] gi|17946473|gb|AAL49269.1| RE70650p [Drosophila melanogaster] gi|220958190|gb|ACL91638.1| RabX6-PA [synthetic construct] Back     alignment and taxonomy information
>gi|194864654|ref|XP_001971045.1| GG14733 [Drosophila erecta] gi|195490177|ref|XP_002093033.1| GE21097 [Drosophila yakuba] gi|190652828|gb|EDV50071.1| GG14733 [Drosophila erecta] gi|194179134|gb|EDW92745.1| GE21097 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|442629247|ref|NP_001261219.1| RabX6, isoform B [Drosophila melanogaster] gi|440215083|gb|AGB93914.1| RabX6, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
FB|FBgn0035155213 RabX6 "RabX6" [Drosophila mela 0.645 0.572 0.754 9.8e-66
MGI|MGI:103292217 Rab19 "RAB19, member RAS oncog 0.693 0.603 0.328 2.8e-20
ASPGD|ASPL0000062908205 avaA [Emericella nidulans (tax 0.730 0.673 0.369 5.8e-20
SGD|S000004252215 YPT6 "Rab family GTPase" [Sacc 0.671 0.590 0.333 7.3e-20
UNIPROTKB|O97572207 RAB7A "Ras-related protein Rab 0.666 0.608 0.375 9.3e-20
POMBASE|SPBC1703.10203 ypt1 "GTPase Ypt1" [Schizosacc 0.587 0.546 0.403 1.2e-19
RGD|1565263217 Rab19 "RAB19, member RAS oncog 0.693 0.603 0.328 1.5e-19
UNIPROTKB|Q969Q5203 RAB24 "Ras-related protein Rab 0.587 0.546 0.348 3.1e-19
UNIPROTKB|E2R4M1203 RAB24 "Uncharacterized protein 0.587 0.546 0.348 3.9e-19
UNIPROTKB|F1S3C2203 RAB24 "Uncharacterized protein 0.587 0.546 0.348 3.9e-19
FB|FBgn0035155 RabX6 "RabX6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 504 (182.5 bits), Expect = 9.8e-66, Sum P(2) = 9.8e-66
 Identities = 92/122 (75%), Positives = 114/122 (93%)

Query:     1 MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQ 60
             MA++++P+QKVILCG+YGVGKSSLFRR+A +TFI+ + RKSTLGLD+ ++EY V+++ I+
Sbjct:     1 MATMRIPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIK 60

Query:    61 MQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYAENAKIFLC 120
             +QLWDTGGMERVAS+TSSYYKFAE AILVF+LDNAASFH LSQHLL+IVTYAENAKIF+C
Sbjct:    61 LQLWDTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKIFIC 120

Query:   121 GN 122
             GN
Sbjct:   121 GN 122


GO:0003924 "GTPase activity" evidence=ISS
GO:0005525 "GTP binding" evidence=ISS
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0031982 "vesicle" evidence=ISS
MGI|MGI:103292 Rab19 "RAB19, member RAS oncogene family" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062908 avaA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000004252 YPT6 "Rab family GTPase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|O97572 RAB7A "Ras-related protein Rab-7a" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
POMBASE|SPBC1703.10 ypt1 "GTPase Ypt1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1565263 Rab19 "RAB19, member RAS oncogene family" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q969Q5 RAB24 "Ras-related protein Rab-24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4M1 RAB24 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3C2 RAB24 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9TVU5RAB1_THEPANo assigned EC number0.36520.74070.6363yesN/A
O97572RAB7A_RABITNo assigned EC number0.33520.80950.7391yesN/A
P11620YPT1_SCHPONo assigned EC number0.34560.76190.7093yesN/A
Q4UB16RAB1_THEANNo assigned EC number0.36520.74070.6363yesN/A
Q54NU2RAB1D_DICDINo assigned EC number0.35500.77770.7205yesN/A
Q99260YPT6_YEASTNo assigned EC number0.31090.76190.6697yesN/A
Q9FPJ4RAD2B_ARATHNo assigned EC number0.32100.87830.8217yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 7e-44
pfam00071162 pfam00071, Ras, Ras family 3e-35
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 2e-33
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 5e-28
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 1e-27
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 6e-27
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 9e-26
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 2e-25
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 7e-25
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 8e-25
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 2e-24
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 7e-23
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 1e-22
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 1e-22
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 3e-22
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 6e-22
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 2e-20
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 2e-20
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 2e-20
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 1e-19
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 2e-19
cd04118193 cd04118, Rab24, Rab GTPase family 24 (Rab24) 1e-18
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 2e-18
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 3e-18
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 6e-18
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 7e-18
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 8e-18
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 5e-17
cd04124161 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like 2e-16
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 3e-16
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 7e-16
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 8e-16
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 4e-15
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 8e-15
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 1e-14
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 4e-14
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 5e-14
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 6e-14
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 7e-14
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 1e-13
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 7e-13
pfam08477116 pfam08477, Miro, Miro-like protein 2e-12
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 2e-12
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 3e-12
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 6e-12
PTZ00132215 PTZ00132, PTZ00132, GTP-binding nuclear protein Ra 6e-12
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 1e-11
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 6e-11
cd04130173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 2e-10
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 2e-10
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 1e-09
cd04126220 cd04126, Rab20, Rab GTPase family 20 (Rab20) 1e-09
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 2e-09
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 5e-09
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 7e-09
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 1e-08
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 1e-08
smart00176200 smart00176, RAN, Ran (Ras-related nuclear proteins 2e-08
cd04133173 cd04133, Rop_like, Rho-related protein from plants 2e-08
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 5e-08
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 5e-08
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 9e-08
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 1e-07
cd04172182 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases 2e-07
PLN03071219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 3e-07
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 7e-07
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 1e-06
cd04131176 cd04131, Rnd, Rho family GTPase subfamily Rnd incl 2e-06
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 2e-06
cd01871174 cd01871, Rac1_like, Ras-related C3 botulinum toxin 3e-06
cd04173221 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases 4e-06
cd01875191 cd01875, RhoG, Ras homolog family, member G (RhoG) 6e-06
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 3e-05
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 4e-05
cd01870175 cd01870, RhoA_like, Ras homology family A (RhoA)-l 4e-05
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 6e-05
cd04174232 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases 6e-05
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 9e-05
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 2e-04
cd04103158 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) 2e-04
cd04135174 cd04135, Tc10, Rho GTPase TC10 (Tc10) 2e-04
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 4e-04
cd04102204 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like 5e-04
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 0.001
pfam04670230 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserve 0.002
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 0.002
cd04105202 cd04105, SR_beta, Signal recognition particle rece 0.003
cd04128182 cd04128, Spg1, Septum-promoting GTPase (Spg1) 0.003
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 0.004
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 0.004
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
 Score =  142 bits (362), Expect = 7e-44
 Identities = 61/155 (39%), Positives = 86/155 (55%), Gaps = 18/155 (11%)

Query: 10  KVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGM 69
           K++L G+ GVGK+SL  R+  + F  S + KST+G+D  +K  +VD + +++Q+WDT G 
Sbjct: 2   KIVLIGDSGVGKTSLLLRFVDNKF--SENYKSTIGVDFKSKTIEVDGKKVKLQIWDTAGQ 59

Query: 70  ERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYA-ENAKIFLCGN------ 122
           ER  SITSSYY+ A  AILV+ + N  SF  L + L E+  YA  N  I L GN      
Sbjct: 60  ERFRSITSSYYRGAHGAILVYDVTNRESFENLDKWLNELKEYAPPNIPIILVGNKSDLED 119

Query: 123 ---------NEQCHNLISSTYKTSCKTGEGVEEMF 148
                     +         ++TS KTGE V+E F
Sbjct: 120 ERQVSTEEAQQFAKENGLLFFETSAKTGENVDEAF 154


Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which mask C-terminal lipid binding and promote cytosolic localization. While most unicellular organisms possess 5-20 Rab members, several have been found to possess 60 or more Rabs; for many of these Rab isoforms, homologous proteins are not found in other organisms. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Since crystal structures often lack C-terminal residues, the lipid modification site is not available for annotation in many of the CDs in the hierarchy, but is included where possible. Length = 159

>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 Back     alignment and domain information
>gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases Back     alignment and domain information
>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|133303 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) GTPase Back     alignment and domain information
>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206689 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like3) Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|218203 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP) Back     alignment and domain information
>gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) Back     alignment and domain information
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
KOG0084|consensus205 100.0
KOG0092|consensus200 100.0
KOG0078|consensus207 100.0
KOG0394|consensus210 100.0
KOG0094|consensus221 100.0
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 100.0
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 100.0
KOG0098|consensus216 100.0
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 100.0
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 100.0
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 100.0
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 100.0
KOG0087|consensus222 100.0
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 100.0
KOG0080|consensus209 100.0
PLN03071219 GTP-binding nuclear protein Ran; Provisional 100.0
KOG0093|consensus193 100.0
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 100.0
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 100.0
KOG0079|consensus198 100.0
KOG0086|consensus214 100.0
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 100.0
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 100.0
PTZ00369189 Ras-like protein; Provisional 100.0
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 100.0
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 100.0
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 100.0
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 100.0
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 100.0
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 100.0
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 100.0
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 100.0
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 100.0
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 100.0
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 100.0
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 100.0
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 100.0
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 100.0
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 100.0
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 100.0
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 100.0
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 100.0
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 100.0
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 100.0
PLN03110216 Rab GTPase; Provisional 100.0
PLN03108210 Rab family protein; Provisional 99.98
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.98
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.98
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.98
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.98
KOG0095|consensus213 99.98
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.98
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.98
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.98
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.98
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.98
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.98
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.98
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.98
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.98
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.98
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.97
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.97
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.97
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.97
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.97
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.97
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.97
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.97
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.97
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.97
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.97
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.97
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.97
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.97
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.97
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.97
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.97
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.97
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.97
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.97
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.97
PLN03118211 Rab family protein; Provisional 99.97
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.97
PLN00223181 ADP-ribosylation factor; Provisional 99.97
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.97
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.97
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.97
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.97
KOG0088|consensus218 99.97
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.97
KOG0081|consensus219 99.97
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.97
PTZ00133182 ADP-ribosylation factor; Provisional 99.97
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.97
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.96
KOG0091|consensus213 99.96
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.96
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.96
KOG0097|consensus215 99.96
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.96
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.96
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.96
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.96
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.96
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.96
KOG0083|consensus192 99.96
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.96
KOG0395|consensus196 99.96
KOG0393|consensus198 99.96
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.96
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.95
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.95
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.95
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.95
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.95
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.95
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.95
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.95
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.95
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.95
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.94
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.94
KOG4252|consensus246 99.94
KOG0073|consensus185 99.94
PLN00023 334 GTP-binding protein; Provisional 99.94
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.93
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.93
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.93
KOG0070|consensus181 99.92
COG1100219 GTPase SAR1 and related small G proteins [General 99.92
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.92
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.92
PTZ00099176 rab6; Provisional 99.92
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.92
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.91
KOG0075|consensus186 99.91
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.91
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.9
KOG0096|consensus216 99.9
PRK12299335 obgE GTPase CgtA; Reviewed 99.9
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.9
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.89
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.89
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.88
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.88
KOG0071|consensus180 99.88
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.88
PRK11058426 GTPase HflX; Provisional 99.88
PRK04213201 GTP-binding protein; Provisional 99.88
PRK03003 472 GTP-binding protein Der; Reviewed 99.88
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.87
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.87
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.87
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.87
PRK03003472 GTP-binding protein Der; Reviewed 99.87
PRK15494339 era GTPase Era; Provisional 99.87
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.87
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.86
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.86
cd00881189 GTP_translation_factor GTP translation factor fami 99.86
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.86
KOG1673|consensus205 99.86
KOG0076|consensus197 99.86
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.86
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.86
CHL00189 742 infB translation initiation factor 2; Provisional 99.86
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.85
cd04105203 SR_beta Signal recognition particle receptor, beta 99.85
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.85
PRK12297424 obgE GTPase CgtA; Reviewed 99.85
KOG3883|consensus198 99.85
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.85
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.84
PRK00093 435 GTP-binding protein Der; Reviewed 99.84
PRK05306 787 infB translation initiation factor IF-2; Validated 99.83
PRK12296 500 obgE GTPase CgtA; Reviewed 99.83
PRK00089292 era GTPase Era; Reviewed 99.83
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.82
PRK12298390 obgE GTPase CgtA; Reviewed 99.82
KOG0072|consensus182 99.82
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.82
PRK05433 600 GTP-binding protein LepA; Provisional 99.82
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.82
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.82
cd01896233 DRG The developmentally regulated GTP-binding prot 99.81
KOG4423|consensus229 99.81
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.81
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.81
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.8
PRK00093435 GTP-binding protein Der; Reviewed 99.8
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.8
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.8
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.8
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.8
KOG1707|consensus 625 99.8
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.79
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.79
COG2229187 Predicted GTPase [General function prediction only 99.78
PRK12317 425 elongation factor 1-alpha; Reviewed 99.78
PRK04004 586 translation initiation factor IF-2; Validated 99.78
PRK10218 607 GTP-binding protein; Provisional 99.77
KOG0074|consensus185 99.77
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.77
COG1160 444 Predicted GTPases [General function prediction onl 99.77
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.77
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.76
COG0486454 ThdF Predicted GTPase [General function prediction 99.75
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.75
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.75
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.74
COG1159298 Era GTPase [General function prediction only] 99.74
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.74
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.72
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.72
KOG1423|consensus379 99.72
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.72
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.71
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.7
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.7
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.69
COG1160444 Predicted GTPases [General function prediction onl 99.68
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.67
COG2262411 HflX GTPases [General function prediction only] 99.67
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.67
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.66
PRK13351 687 elongation factor G; Reviewed 99.66
PRK12736 394 elongation factor Tu; Reviewed 99.66
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.66
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.65
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.65
PRK12735 396 elongation factor Tu; Reviewed 99.65
PLN00043 447 elongation factor 1-alpha; Provisional 99.64
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.64
KOG0077|consensus193 99.64
CHL00071 409 tufA elongation factor Tu 99.63
KOG1489|consensus366 99.63
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.63
COG0218200 Predicted GTPase [General function prediction only 99.63
COG3596296 Predicted GTPase [General function prediction only 99.62
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.61
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.61
COG1084346 Predicted GTPase [General function prediction only 99.6
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.6
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.6
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.59
PLN03126 478 Elongation factor Tu; Provisional 99.59
PTZ00141 446 elongation factor 1- alpha; Provisional 99.59
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.59
PRK00049 396 elongation factor Tu; Reviewed 99.58
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.56
PLN03127 447 Elongation factor Tu; Provisional 99.56
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.55
COG0536369 Obg Predicted GTPase [General function prediction 99.54
KOG0462|consensus 650 99.54
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.54
KOG1191|consensus531 99.52
COG1163365 DRG Predicted GTPase [General function prediction 99.52
KOG1145|consensus 683 99.52
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.51
PRK09602 396 translation-associated GTPase; Reviewed 99.5
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.5
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.5
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.49
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 99.48
KOG3905|consensus 473 99.48
KOG1532|consensus366 99.48
KOG0090|consensus238 99.47
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.47
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.43
KOG1490|consensus 620 99.43
PRK12739 691 elongation factor G; Reviewed 99.42
PRK14845 1049 translation initiation factor IF-2; Provisional 99.41
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.4
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 99.39
PRK00007 693 elongation factor G; Reviewed 99.39
PRK09866 741 hypothetical protein; Provisional 99.36
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.33
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.32
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.32
PRK13768253 GTPase; Provisional 99.31
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 99.3
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.29
KOG0705|consensus 749 99.27
PTZ00416 836 elongation factor 2; Provisional 99.27
PRK12740 668 elongation factor G; Reviewed 99.27
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.26
PRK07560 731 elongation factor EF-2; Reviewed 99.25
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 99.24
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.24
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.18
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.17
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 99.17
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.17
PRK09435332 membrane ATPase/protein kinase; Provisional 99.16
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.15
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 99.13
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.1
KOG0461|consensus 522 99.08
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.07
KOG1144|consensus 1064 99.06
KOG0410|consensus410 99.05
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.05
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.05
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 99.01
KOG0468|consensus 971 99.01
KOG1707|consensus625 99.01
PTZ00258 390 GTP-binding protein; Provisional 98.98
KOG0458|consensus 603 98.96
PRK09601 364 GTP-binding protein YchF; Reviewed 98.95
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.93
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.92
KOG3887|consensus 347 98.9
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.88
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.87
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.86
KOG3886|consensus 295 98.84
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.82
KOG2486|consensus320 98.79
KOG0082|consensus354 98.77
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.75
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.74
KOG1954|consensus 532 98.73
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.73
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.72
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.7
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.7
COG0050 394 TufB GTPases - translation elongation factors [Tra 98.69
KOG2655|consensus 366 98.65
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 98.64
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.63
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.62
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.61
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.61
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.6
PRK09563287 rbgA GTPase YlqF; Reviewed 98.6
KOG1547|consensus 336 98.6
KOG1486|consensus 364 98.56
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 98.55
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.55
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.54
COG0012 372 Predicted GTPase, probable translation factor [Tra 98.52
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.51
COG1161322 Predicted GTPases [General function prediction onl 98.5
PRK12289 352 GTPase RsgA; Reviewed 98.49
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.48
PRK00098298 GTPase RsgA; Reviewed 98.48
PRK12288347 GTPase RsgA; Reviewed 98.47
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.47
KOG1491|consensus 391 98.46
PRK12288 347 GTPase RsgA; Reviewed 98.41
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.41
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.4
KOG0465|consensus 721 98.39
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.38
PRK12289352 GTPase RsgA; Reviewed 98.38
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 98.37
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.34
KOG0464|consensus 753 98.31
COG1162301 Predicted GTPases [General function prediction onl 98.28
KOG0467|consensus 887 98.27
KOG0099|consensus379 98.25
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.19
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.17
KOG0448|consensus 749 98.15
PRK13796365 GTPase YqeH; Provisional 98.14
KOG1487|consensus358 98.11
PRK00098298 GTPase RsgA; Reviewed 98.1
KOG1143|consensus 591 98.09
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.09
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.06
KOG0085|consensus359 98.04
PRK10416318 signal recognition particle-docking protein FtsY; 98.03
TIGR00064272 ftsY signal recognition particle-docking protein F 98.02
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.01
cd03112158 CobW_like The function of this protein family is u 98.0
KOG1424|consensus562 97.93
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 97.92
PRK14974336 cell division protein FtsY; Provisional 97.92
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.91
cd03115173 SRP The signal recognition particle (SRP) mediates 97.87
KOG0460|consensus 449 97.85
PRK13695174 putative NTPase; Provisional 97.85
PRK13796 365 GTPase YqeH; Provisional 97.78
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.76
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.74
KOG4273|consensus 418 97.72
PRK08118167 topology modulation protein; Reviewed 97.7
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.69
PRK07261171 topology modulation protein; Provisional 97.69
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.68
PRK01889 356 GTPase RsgA; Reviewed 97.67
KOG0469|consensus 842 97.64
COG3523 1188 IcmF Type VI protein secretion system component Va 97.64
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.62
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.61
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.58
KOG3859|consensus 406 97.57
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.56
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.56
PRK09563 287 rbgA GTPase YlqF; Reviewed 97.55
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.55
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.54
KOG2484|consensus435 97.54
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.53
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.53
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 97.52
KOG1533|consensus290 97.52
PRK05480209 uridine/cytidine kinase; Provisional 97.52
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.51
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.51
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 97.5
PRK14530215 adenylate kinase; Provisional 97.5
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.49
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.49
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.49
PF00004132 AAA: ATPase family associated with various cellula 97.46
PRK06217183 hypothetical protein; Validated 97.45
KOG0463|consensus 641 97.44
PF1355562 AAA_29: P-loop containing region of AAA domain 97.43
PRK14738206 gmk guanylate kinase; Provisional 97.43
PRK03839180 putative kinase; Provisional 97.42
PRK07429 327 phosphoribulokinase; Provisional 97.42
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.41
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.41
PRK08233182 hypothetical protein; Provisional 97.41
smart00382148 AAA ATPases associated with a variety of cellular 97.41
KOG2485|consensus335 97.38
PRK00300205 gmk guanylate kinase; Provisional 97.37
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.37
PRK14737186 gmk guanylate kinase; Provisional 97.36
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.36
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.36
PTZ00088229 adenylate kinase 1; Provisional 97.35
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.35
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.35
KOG3347|consensus176 97.34
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.34
cd03111106 CpaE_like This protein family consists of proteins 97.34
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.33
PRK14532188 adenylate kinase; Provisional 97.32
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.31
KOG3354|consensus191 97.3
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.29
PRK14531183 adenylate kinase; Provisional 97.28
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.27
KOG2423|consensus572 97.27
COG4525259 TauB ABC-type taurine transport system, ATPase com 97.27
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.27
PLN02674244 adenylate kinase 97.25
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.24
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.23
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.23
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.23
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.22
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.21
PRK13949169 shikimate kinase; Provisional 97.21
PRK02496184 adk adenylate kinase; Provisional 97.21
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 97.19
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.18
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.17
PRK00625173 shikimate kinase; Provisional 97.17
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.17
PRK05541176 adenylylsulfate kinase; Provisional 97.16
PRK06547172 hypothetical protein; Provisional 97.16
PRK05057172 aroK shikimate kinase I; Reviewed 97.15
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.15
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.13
PRK01889356 GTPase RsgA; Reviewed 97.13
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.13
PLN02200234 adenylate kinase family protein 97.12
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.1
PRK08356195 hypothetical protein; Provisional 97.1
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.09
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.08
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.08
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.08
COG3638258 ABC-type phosphate/phosphonate transport system, A 97.07
PTZ00301210 uridine kinase; Provisional 97.07
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.07
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.06
PRK00279215 adk adenylate kinase; Reviewed 97.06
PRK04040188 adenylate kinase; Provisional 97.06
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.05
PRK04195 482 replication factor C large subunit; Provisional 97.05
PRK14529223 adenylate kinase; Provisional 97.05
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.04
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.03
PHA00729226 NTP-binding motif containing protein 97.02
PRK14526211 adenylate kinase; Provisional 97.02
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.02
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.01
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.01
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 96.99
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.99
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.99
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.99
PLN02459261 probable adenylate kinase 96.99
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 96.98
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 96.97
>KOG0084|consensus Back     alignment and domain information
Probab=100.00  E-value=4.6e-39  Score=225.67  Aligned_cols=160  Identities=34%  Similarity=0.495  Sum_probs=146.5

Q ss_pred             CCCCCCceEEEEEcCCCCCHHHHHHHHHhCCCCCCCCCcccceeeeeEEEEEECCeEEEEEEEeCCCccccccchHHHhc
Q psy17231          2 ASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYK   81 (189)
Q Consensus         2 ~~~~~~~~~i~i~G~~g~GKTtli~~l~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~i~D~~g~~~~~~~~~~~~~   81 (189)
                      +..-.+.+||+++|++|||||+|+.||..+.|.+.+  ..|+|+++...++.++++.+++++|||+||++|+++...+|+
T Consensus         3 ~~~~dylFKiiliGds~VGKtCL~~Rf~~~~f~e~~--~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~syYR   80 (205)
T KOG0084|consen    3 NPEYDYLFKIILIGDSGVGKTCLLLRFKDDTFTESY--ISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSYYR   80 (205)
T ss_pred             CcccceEEEEEEECCCCcChhhhhhhhccCCcchhh--cceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhhcc
Confidence            344467899999999999999999999999998777  899999999999999999999999999999999999999999


Q ss_pred             CCcEEEEEEeCCChhhHHHHHHHHHHHHHhC-CCCcEEEEeeccccccc---------------CCc-eEEeeccCCCCH
Q psy17231         82 FAEAAILVFSLDNAASFHVLSQHLLEIVTYA-ENAKIFLCGNNEQCHNL---------------ISS-TYKTSCKTGEGV  144 (189)
Q Consensus        82 ~~~~~i~v~d~~~~~s~~~~~~~~~~~~~~~-~~~p~ivv~nK~d~~~~---------------~~~-~~~~Sa~~~~~i  144 (189)
                      ++|++|+|||+++++||+.+..|+.++.++. +++|.++||||||+...               ..+ |+|+|||++.|+
T Consensus        81 ~ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~v~~lLVGNK~Dl~~~~~v~~~~a~~fa~~~~~~~f~ETSAK~~~NV  160 (205)
T KOG0084|consen   81 GAHGIIFVYDITKQESFNNVKRWIQEIDRYASENVPKLLVGNKCDLTEKRVVSTEEAQEFADELGIPIFLETSAKDSTNV  160 (205)
T ss_pred             CCCeEEEEEEcccHHHhhhHHHHHHHhhhhccCCCCeEEEeeccccHhheecCHHHHHHHHHhcCCcceeecccCCccCH
Confidence            9999999999999999999999999999998 77899999999996533               225 999999999999


Q ss_pred             HHHHHHHHHHHHHhhhhhh
Q psy17231        145 EEMFADIGRQLILSNRSRL  163 (189)
Q Consensus       145 ~~~~~~i~~~i~~~~~~~~  163 (189)
                      ++.|..+...+..+.....
T Consensus       161 e~~F~~la~~lk~~~~~~~  179 (205)
T KOG0084|consen  161 EDAFLTLAKELKQRKGLHV  179 (205)
T ss_pred             HHHHHHHHHHHHHhcccCC
Confidence            9999999999988876544



>KOG0092|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG0085|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4273|consensus Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 1e-18
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 2e-18
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 2e-18
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 2e-18
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 3e-18
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 3e-18
4fmc_B171 Espg-Rab1 Complex Length = 171 3e-18
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 5e-18
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 6e-18
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 8e-18
2ew1_A201 Crystal Structure Of Rab30 In Complex With A Gtp An 9e-18
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 1e-17
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 1e-17
4fmc_F117 Espg-Rab1 Complex Length = 117 1e-17
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 1e-17
2efc_B181 Ara7-GdpATVPS9A Length = 181 1e-17
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 1e-17
1t91_A207 Crystal Structure Of Human Small Gtpase Rab7(Gtp) L 2e-17
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 2e-17
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 2e-17
1vg1_A185 Gdp-bound Rab7 Length = 185 2e-17
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 3e-17
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 3e-17
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 3e-17
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 5e-17
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 6e-17
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 6e-17
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 7e-17
2ocb_A180 Crystal Structure Of Human Rab9b In Complex With A 7e-17
1yzl_A179 Gppnhp-Bound Rab9 Gtpase Length = 179 9e-17
1ky2_A182 Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 1e-16
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 1e-16
1s8f_A177 Crystal Structure Of Rab9 Complexed To Gdp Reveals 2e-16
1wms_A177 High Resolution Crystal Structure Of Human Rab9 Gtp 2e-16
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 2e-16
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 2e-16
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 2e-16
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 2e-16
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 2e-16
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 2e-16
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 3e-16
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 3e-16
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 5e-16
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 9e-16
1z22_A168 Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac 2e-15
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 2e-15
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 3e-15
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 3e-15
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 3e-15
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 3e-15
2oil_A193 Crystal Structure Of Human Rab25 In Complex With Gd 3e-15
3tso_A178 Structure Of The Cancer Associated Rab25 Protein In 4e-15
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 5e-15
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 5e-15
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 7e-15
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 8e-15
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 1e-14
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 1e-14
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 1e-14
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 1e-14
1z0k_A172 Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W 1e-14
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 1e-14
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 1e-14
3mjh_A168 Crystal Structure Of Human Rab5a In Complex With Th 1e-14
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 1e-14
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 2e-14
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 2e-14
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 2e-14
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 3e-14
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 3e-14
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 4e-14
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 5e-14
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 6e-14
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 6e-14
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 9e-14
1z0d_A167 Gdp-bound Rab5c Gtpase Length = 167 9e-14
1z0f_A179 Gdp-Bound Rab14 Gtpase Length = 179 9e-14
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 1e-13
1huq_A164 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 3e-13
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 3e-13
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 5e-13
4drz_A196 Crystal Structure Of Human Rab14 Length = 196 6e-13
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 6e-13
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 7e-13
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 2e-12
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 2e-12
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 3e-12
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 3e-12
2a5j_A191 Crystal Structure Of Human Rab2b Length = 191 6e-12
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 7e-12
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 8e-12
1zc3_A175 Crystal Structure Of The Ral-Binding Domain Of Exo8 1e-11
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 2e-11
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 2e-11
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 2e-11
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 2e-11
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 3e-11
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 3e-11
2kwi_A178 Ralb-Rlip76 (Ralbp1) Complex Length = 178 4e-11
2ke5_A174 Solution Structure And Dynamics Of The Small Gtpase 4e-11
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 5e-11
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 7e-11
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 8e-11
3ran_A216 Canine Gdp-Ran Q69l Mutant Length = 216 1e-10
3nc1_C182 Crystal Structure Of The Crm1-Rangtp Complex Length 1e-10
3nby_C176 Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea 2e-10
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 2e-10
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 2e-10
2x19_A172 Crystal Structure Of Importin13 - Rangtp Complex Le 2e-10
3icq_B171 Karyopherin Nuclear State Length = 171 2e-10
3gj0_A221 Crystal Structure Of Human Rangdp Length = 221 2e-10
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 2e-10
3gj4_A221 Crystal Structure Of Human Rangdp-Nup153znf3 Comple 2e-10
1rrp_A204 Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 2e-10
1a2k_C216 Gdpran-Ntf2 Complex Length = 216 3e-10
1qg2_A216 Canine Gdp-Ran R76e Mutant Length = 216 3e-10
1byu_A216 Canine Gdp-Ran Length = 216 3e-10
3m1i_A219 Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex 3e-10
1qg4_A216 Canine Gdp-Ran F72y Mutant Length = 216 3e-10
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 3e-10
1wa5_A176 Crystal Structure Of The Exportin Cse1p Complexed W 3e-10
2bku_A177 Kap95p:rangtp Complex Length = 177 4e-10
3ea5_A216 Kap95p Binding Induces The Switch Loops Of Rangdp T 4e-10
1qbk_C216 Structure Of The Karyopherin Beta2-ran Gppnhp Nucle 8e-10
1jah_A166 H-Ras P21 Protein Mutant G12p, Complexed With Guano 7e-09
1clu_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 7e-09
421p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 8e-09
1agp_A166 Three-Dimensional Structures And Properties Of A Tr 1e-08
2j0v_A212 The Crystal Structure Of Arabidopsis Thaliana Rac7- 1e-08
2nty_C180 Rop4-Gdp-Prone8 Length = 180 2e-08
1cxz_A182 Crystal Structure Of Human Rhoa Complexed With The 2e-08
3ihw_A184 Crystal Structure Of The Ras-Like Domain Of Centg3 2e-08
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-08
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 4e-08
2wkp_A332 Structure Of A Photoactivatable Rac1 Containing Lov 4e-08
2wkr_A332 Structure Of A Photoactivatable Rac1 Containing The 4e-08
2wkq_A332 Structure Of A Photoactivatable Rac1 Containing The 4e-08
1dpf_A180 Crystal Structure Of A Mg-Free Form Of Rhoa Complex 4e-08
1x86_B196 Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A 4e-08
3tvd_A193 Crystal Structure Of Mouse Rhoa-Gtp Complex Length 4e-08
1lb1_B192 Crystal Structure Of The Dbl And Pleckstrin Homolog 4e-08
1s1c_A183 Crystal Structure Of The Complex Between The Human 4e-08
3kz1_E182 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 4e-08
4f38_A195 Crystal Structure Of Geranylgeranylated Rhoa In Com 4e-08
3bwd_D182 Crystal Structure Of The Plant Rho Protein Rop5 Len 5e-08
2wbl_C180 Three-Dimensional Structure Of A Binary Rop-Prone C 1e-07
3lw8_A185 Shigella Ipgb2 In Complex With Human Rhoa, Gdp And 1e-07
2gcn_A201 Crystal Structure Of The Human Rhoc-Gdp Complex Len 1e-07
2q3h_A201 The Crystal Structure Of Rhoua In The Gdp-bound Sta 2e-07
1mh1_A186 Small G-Protein Length = 186 2e-07
2gco_A201 Crystal Structure Of The Human Rhoc-gppnhp Complex 2e-07
2h7v_A188 Co-crystal Structure Of Ypka-rac1 Length = 188 2e-07
1ow3_B193 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 2e-07
1g4u_R184 Crystal Structure Of The Salmonella Tyrosine Phosph 2e-07
1cc0_A190 Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le 2e-07
1hh4_A192 Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ 2e-07
3msx_A180 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 2e-07
1kmq_A184 Crystal Structure Of A Constitutively Activated Rho 2e-07
4gzl_A204 Crystal Structure Of Rac1 Q61l Mutant Length = 204 2e-07
3ryt_C180 The Plexin A1 Intracellular Region In Complex With 2e-07
1e96_A192 Structure Of The RacP67PHOX COMPLEX Length = 192 2e-07
1i4t_D192 Crystal Structure Analysis Of Rac1-Gmppnp In Comple 2e-07
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 2e-07
3sbd_A187 Crystal Structure Of Rac1 P29s Mutant Length = 187 2e-07
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 4e-07
3th5_A204 Crystal Structure Of Wild-Type Rac1 Length = 204 4e-07
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 4e-07
2yin_C196 Structure Of The Complex Between Dock2 And Rac1. Le 5e-07
3b13_B184 Crystal Structure Of The Dhr-2 Domain Of Dock2 In C 5e-07
2vrw_A184 Critical Structural Role For The Ph And C1 Domains 5e-07
1he1_C176 Crystal Structure Of The Complex Between The Gap Do 5e-07
1xcg_B178 Crystal Structure Of Human Rhoa In Complex With DhP 5e-07
1tx4_B177 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 5e-07
1foe_B177 Crystal Structure Of Rac1 In Complex With The Guani 5e-07
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 5e-07
2v55_B200 Mechanism Of Multi-site Phosphorylation From A Rock 5e-07
2fju_A178 Activated Rac1 Bound To Its Effector Phospholipase 6e-07
1i4d_D192 Crystal Structure Analysis Of Rac1-Gdp Complexed Wi 6e-07
3sua_A184 Crystal Structure Of The Intracellular Domain Of Pl 6e-07
1gwn_A205 The Crystal Structure Of The Core Domain Of RhoeRND 7e-07
1z2c_A193 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 7e-07
1m7b_A184 Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI 9e-07
1lf0_A166 Crystal Structure Of Rasa59g In The Gtp-Bound Form 1e-06
3rap_R167 The Small G Protein Rap2 In A Non Catalytic Complex 1e-06
2atv_A196 The Crystal Structure Of Human Rerg In The Gdp Boun 1e-06
2w2t_A185 Rac2 (G12v) In Complex With Gdp Length = 185 1e-06
2w2v_A184 Rac2 (G12v) In Complex With Gtpgs Length = 184 1e-06
4efn_A171 Crystal Structure Of H-Ras Q61l In Complex With Gpp 2e-06
2ic5_A180 Crystal Structure Of Human Rac3 Grown In The Presen 2e-06
2g0n_A179 The Crystal Structure Of The Human Rac3 In Complex 2e-06
4gzm_A204 Crystal Structure Of Rac1 F28l Mutant Length = 204 2e-06
2c2h_A192 Crystal Structure Of The Human Rac3 In Complex With 2e-06
2fv8_A207 The Crystal Structure Of Rhob In The Gdp-Bound Stat 3e-06
721p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 3e-06
3clv_A208 Crystal Structure Of Rab5a From Plasmodium Falcipar 3e-06
2c5l_A173 Structure Of Plc Epsilon Ras Association Domain Wit 3e-06
2rga_A166 Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 3e-06
3kkm_A172 Crystal Structure Of H-Ras T35s In Complex With Gpp 3e-06
1ds6_A192 Crystal Structure Of A Rac-Rhogdi Complex Length = 4e-06
4efm_A171 Crystal Structure Of H-Ras G12v In Complex With Gpp 4e-06
4efl_A171 Crystal Structure Of H-Ras Wt In Complex With Gppnh 4e-06
2rgc_A166 Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 4e-06
1nvv_Q166 Structural Evidence For Feedback Activation By Rasg 4e-06
4q21_A189 Molecular Switch For Signal Transduction: Structura 5e-06
2cld_X166 Crystal Structure Analysis Of A Fluorescent Form Of 5e-06
6q21_A171 Molecular Switch For Signal Transduction: Structura 5e-06
2q21_A171 Crystal Structures At 2.2 Angstroms Resolution Of T 5e-06
3con_A190 Crystal Structure Of The Human Nras Gtpase Bound Wi 5e-06
3k9n_A166 Allosteric Modulation Of H-Ras Gtpase Length = 166 5e-06
3ddc_A166 Crystal Structure Of Nore1a In Complex With Ras Len 5e-06
1lfd_B167 Crystal Structure Of The Active Ras Protein Complex 5e-06
2cl0_X166 Crystal Structure Analysis Of A Fluorescent Form Of 5e-06
2quz_A166 Crystal Structure Of The Activating H-Rask117r Muta 5e-06
1iaq_A166 C-H-Ras P21 Protein Mutant With Thr 35 Replaced By 5e-06
3v4f_A166 H-Ras Peg 400CACL2, ORDERED OFF Length = 166 5e-06
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 6e-06
1wq1_R166 Ras-Rasgap Complex Length = 166 6e-06
1rvd_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 6e-06
3lo5_A166 Crystal Structure Of The Dominant Negative S17n Mut 6e-06
2hxs_A178 Crystal Structure Of Rab28a Gtpase In The Inactive 6e-06
2rgb_A166 Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 7e-06
621p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 8e-06
2x1v_A166 Crystal Structure Of The Activating H-Ras I163f Mut 9e-06
4djt_A218 Crystal Structure Of A Nuclear Gtp-Binding Protein 9e-06
521p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 9e-06
1zw6_A166 Crystal Structure Of The Gtp-Bound Form Of Rasq61g 9e-06
1zvq_A166 Structure Of The Q61g Mutant Of Ras In The Gdp-Boun 1e-05
4epx_A170 Discovery Of Small Molecules That Bind To K-Ras And 1e-05
4ept_A170 Discovery Of Small Molecules That Bind To K-Ras And 1e-05
3i3s_R166 Crystal Structure Of H-Ras With Thr50 Replaced By I 1e-05
221p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 2e-05
3gft_A187 Human K-Ras In Complex With A Gtp Analogue Length = 2e-05
2j1l_A214 Crystal Structure Of Human Rho-Related Gtp-Binding 2e-05
3a58_B188 Crystal Structure Of Sec3p - Rho1p Complex From Sac 2e-05
1xj0_A166 Crystal Structure Of The Gdp-Bound Form Of The Rasg 2e-05
1xcm_A167 Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu 2e-05
2g3y_A211 Crystal Structure Of The Human Small Gtpase Gem Len 3e-05
3ref_B194 Crystal Structure Of Ehrho1 Bound To Gdp And Magnes 5e-05
4dvg_A188 Crystal Structure Of E. Histolytica Formin1 Bound T 6e-05
2ht6_A174 Crystal Structure Of Human Gem G-Domain Bound To Gd 6e-05
2cjw_B192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 6e-05
2cjw_A192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 1e-04
2cls_A198 The Crystal Structure Of The Human Rnd1 Gtpase In T 1e-04
3q3j_B214 Crystal Structure Of Plexin A2 Rbd In Complex With 1e-04
2rex_B197 Crystal Structure Of The Effector Domain Of Plxnb1 1e-04
1ryf_A203 Alternative Splicing Of Rac1 Generates Rac1b, A Sel 1e-04
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 1e-04
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 3e-04
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 3e-04
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 3e-04
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 4e-04
2ery_A172 The Crystal Structure Of The Ras Related Protein Rr 5e-04
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 5e-04
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure

Iteration: 1

Score = 89.0 bits (219), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 3/120 (2%) Query: 10 KVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGM 69 +VI+ G GVGK+SL R+ DTF + KST+G+D K ++ + I++Q+WDT G Sbjct: 28 QVIIIGSRGVGKTSLMERFTDDTFCEAC--KSTVGVDFKIKTVELRGKKIRLQIWDTAGQ 85 Query: 70 ERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYA-ENAKIFLCGNNEQCHN 128 ER SITS+YY+ A+ ILV+ + +F L + + I YA E+A++ L GN C Sbjct: 86 ERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCET 145
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 Back     alignment and structure
>pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 Back     alignment and structure
>pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 Back     alignment and structure
>pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 Back     alignment and structure
>pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure
>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 Back     alignment and structure
>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 Back     alignment and structure
>pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 Back     alignment and structure
>pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 Back     alignment and structure
>pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 Back     alignment and structure
>pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 Back     alignment and structure
>pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 Back     alignment and structure
>pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 Back     alignment and structure
>pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 Back     alignment and structure
>pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Back     alignment and structure
>pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 Back     alignment and structure
>pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 Back     alignment and structure
>pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 Back     alignment and structure
>pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 Back     alignment and structure
>pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 Back     alignment and structure
>pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 Back     alignment and structure
>pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 Back     alignment and structure
>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 Back     alignment and structure
>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 Back     alignment and structure
>pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 Back     alignment and structure
>pdb|3IHW|A Chain A, Crystal Structure Of The Ras-Like Domain Of Centg3 Length = 184 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 Back     alignment and structure
>pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 Back     alignment and structure
>pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 Back     alignment and structure
>pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 Back     alignment and structure
>pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 Back     alignment and structure
>pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 Back     alignment and structure
>pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 Back     alignment and structure
>pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 Back     alignment and structure
>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 Back     alignment and structure
>pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 Back     alignment and structure
>pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 Back     alignment and structure
>pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 Back     alignment and structure
>pdb|1MH1|A Chain A, Small G-Protein Length = 186 Back     alignment and structure
>pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 Back     alignment and structure
>pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 Back     alignment and structure
>pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 Back     alignment and structure
>pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 Back     alignment and structure
>pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 Back     alignment and structure
>pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 Back     alignment and structure
>pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 Back     alignment and structure
>pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 Back     alignment and structure
>pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 Back     alignment and structure
>pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 Back     alignment and structure
>pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 Back     alignment and structure
>pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 Back     alignment and structure
>pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 Back     alignment and structure
>pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 Back     alignment and structure
>pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 Back     alignment and structure
>pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 Back     alignment and structure
>pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 Back     alignment and structure
>pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 Back     alignment and structure
>pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 Back     alignment and structure
>pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 Back     alignment and structure
>pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 Back     alignment and structure
>pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 Back     alignment and structure
>pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 Back     alignment and structure
>pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 Back     alignment and structure
>pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 Back     alignment and structure
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 Back     alignment and structure
>pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 Back     alignment and structure
>pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 Back     alignment and structure
>pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 Back     alignment and structure
>pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 Back     alignment and structure
>pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 Back     alignment and structure
>pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 Back     alignment and structure
>pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 Back     alignment and structure
>pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 Back     alignment and structure
>pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 Back     alignment and structure
>pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 Back     alignment and structure
>pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 Back     alignment and structure
>pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 Back     alignment and structure
>pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 Back     alignment and structure
>pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 Back     alignment and structure
>pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 Back     alignment and structure
>pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 Back     alignment and structure
>pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 Back     alignment and structure
>pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 Back     alignment and structure
>pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 Back     alignment and structure
>pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 Back     alignment and structure
>pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 Back     alignment and structure
>pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 Back     alignment and structure
>pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 Back     alignment and structure
>pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 Back     alignment and structure
>pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 Back     alignment and structure
>pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 Back     alignment and structure
>pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 Back     alignment and structure
>pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 Back     alignment and structure
>pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 Back     alignment and structure
>pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 Back     alignment and structure
>pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 Back     alignment and structure
>pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 Back     alignment and structure
>pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 Back     alignment and structure
>pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 Back     alignment and structure
>pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 Back     alignment and structure
>pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 Back     alignment and structure
>pdb|2G3Y|A Chain A, Crystal Structure Of The Human Small Gtpase Gem Length = 211 Back     alignment and structure
>pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 Back     alignment and structure
>pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 Back     alignment and structure
>pdb|2HT6|A Chain A, Crystal Structure Of Human Gem G-Domain Bound To Gdp Length = 174 Back     alignment and structure
>pdb|2CJW|B Chain B, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2CJW|A Chain A, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 Back     alignment and structure
>pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 Back     alignment and structure
>pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 Back     alignment and structure
>pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 7e-39
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 1e-38
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 3e-38
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 7e-37
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 8e-36
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 1e-35
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 2e-35
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 3e-35
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 3e-35
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 3e-35
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 3e-35
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 4e-35
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 5e-35
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 7e-35
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 7e-35
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 7e-35
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 1e-34
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 1e-34
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 2e-34
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 2e-34
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 3e-34
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 3e-34
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 3e-34
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 3e-34
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-34
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 3e-34
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 4e-34
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 5e-34
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 5e-34
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 5e-34
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 6e-34
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 7e-34
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 7e-34
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 8e-34
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 9e-34
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 1e-33
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 2e-33
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 3e-33
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 1e-32
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 2e-32
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 1e-31
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 3e-31
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 3e-31
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 4e-31
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 4e-31
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 5e-31
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 5e-31
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 6e-31
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 7e-31
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 9e-31
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 1e-30
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 1e-30
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 2e-30
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 3e-30
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 5e-30
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 5e-30
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 6e-30
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 6e-30
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 2e-29
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 2e-29
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 6e-29
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 9e-29
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 2e-28
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 2e-28
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 2e-27
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 2e-25
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 3e-25
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 5e-25
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-24
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 9e-24
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 3e-23
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 3e-22
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 2e-21
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 3e-21
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 3e-21
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 7e-21
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 8e-21
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 9e-21
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 7e-20
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 8e-20
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 8e-20
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 9e-20
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 7e-19
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 9e-14
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-08
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 2e-07
3t1o_A198 Gliding protein MGLA; G domain containing protein, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 1e-05
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 4e-05
2fh5_B214 SR-beta, signal recognition particle receptor beta 5e-05
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 7e-05
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 9e-05
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 9e-05
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 1e-04
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 1e-04
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 2e-04
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 2e-04
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 2e-04
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 7e-04
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
 Score =  131 bits (331), Expect = 7e-39
 Identities = 61/193 (31%), Positives = 87/193 (45%), Gaps = 23/193 (11%)

Query: 1   MASIKVPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQ 60
           M S K    KVI+ G+ GVGK+SL  +Y    F +    K+T+G D   KE  VDDR + 
Sbjct: 1   MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQY--KATIGADFLTKEVMVDDRLVT 58

Query: 61  MQLWDTGGMERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYA-----ENA 115
           MQ+WDT G ER  S+  ++Y+ A+  +LVF +    +F  L     E +  A     EN 
Sbjct: 59  MQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENF 118

Query: 116 KIFLCGN--------------NEQCHNLISSTY-KTSCKTGEGVEEMFADIGRQLILSNR 160
              + GN                 C++  +  Y +TS K    VE+ F  I R   L   
Sbjct: 119 PFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARN-ALKQE 177

Query: 161 SRLELQTMGAGGI 173
           + +EL       I
Sbjct: 178 TEVELYNEFPEPI 190


>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 100.0
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 100.0
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 100.0
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 100.0
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 100.0
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 100.0
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 100.0
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 100.0
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 100.0
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 100.0
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 100.0
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 100.0
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 100.0
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 100.0
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 100.0
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 100.0
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 100.0
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 100.0
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 100.0
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 100.0
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 100.0
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 100.0
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 100.0
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 100.0
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 100.0
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 100.0
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.98
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.98
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.98
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.98
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.98
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.98
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.98
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.98
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.98
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.98
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.98
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.98
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.98
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.98
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.98
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.98
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.98
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.98
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.98
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.98
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.98
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.98
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.98
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.98
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.98
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.97
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.97
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.97
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.97
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.97
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.97
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.97
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.97
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.97
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.97
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.97
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.97
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.97
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.97
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.97
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.97
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.97
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.97
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.97
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.97
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.97
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.97
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.97
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.97
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.97
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.97
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.97
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.97
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.97
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.97
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.97
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.97
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.97
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.97
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.97
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.97
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.97
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.97
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.96
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.96
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.96
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.96
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.96
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.96
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.96
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.96
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.96
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.95
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.92
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.95
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.95
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.95
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.95
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.95
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.94
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.94
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.94
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.94
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.94
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.93
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.93
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.93
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.93
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.92
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.92
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.91
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.91
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.91
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.91
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.91
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.91
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.9
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.9
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.89
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.88
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.88
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.88
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.87
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.87
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.87
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.87
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.87
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.86
2ged_A193 SR-beta, signal recognition particle receptor beta 99.86
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.86
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.86
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.86
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.85
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.85
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.85
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.85
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.85
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.85
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.85
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.84
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.84
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.84
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.83
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.83
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.83
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.83
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.82
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.82
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.82
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.82
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.82
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.82
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.82
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.82
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.81
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.8
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.8
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.8
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.79
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.79
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.79
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.78
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.78
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.77
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.77
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.77
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.76
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.76
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.76
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.76
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.75
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.74
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.73
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.73
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.71
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.71
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.7
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.69
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.69
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.68
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.66
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.66
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.65
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.65
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.64
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.62
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.61
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.6
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.57
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.57
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 99.56
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.55
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.54
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.53
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.5
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.49
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.48
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 99.48
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.43
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.39
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.33
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.3
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.21
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.16
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 99.08
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.97
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 98.76
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.75
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.73
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.71
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.59
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.59
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.59
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.59
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.58
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.54
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.25
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.24
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 98.2
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 98.11
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 98.02
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.76
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.7
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.67
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.63
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.62
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.59
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.58
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.57
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.54
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.52
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.52
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.49
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.48
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.44
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.43
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.42
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.41
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.41
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.4
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.4
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.4
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.4
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.39
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.39
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.38
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.38
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.37
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.37
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.36
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.36
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.36
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.36
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.35
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.34
1via_A175 Shikimate kinase; structural genomics, transferase 97.33
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.33
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.32
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.31
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.31
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.31
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.31
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.3
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.29
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 97.29
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.29
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.28
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.27
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.27
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.26
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.26
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.25
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.25
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.24
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.23
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.23
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.23
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.22
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.22
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.2
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.2
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.2
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.18
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.18
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.18
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.17
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.15
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.15
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.15
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.14
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.13
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.13
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.13
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.12
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.11
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.11
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.11
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.1
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.1
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.1
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.09
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 97.09
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.09
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.09
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.09
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.09
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.09
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.09
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.08
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.07
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.07
1g6h_A257 High-affinity branched-chain amino acid transport 97.07
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.05
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.05
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.05
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.04
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.04
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.04
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.03
2ghi_A260 Transport protein; multidrug resistance protein, M 97.03
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.03
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.03
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.02
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.02
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.02
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 97.02
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.02
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.02
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.01
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.01
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.01
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.01
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.99
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.99
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.99
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.99
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.98
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.96
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 96.95
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 96.95
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.94
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.94
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.94
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.94
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.93
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.93
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.93
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.93
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.92
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.92
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.92
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.91
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.91
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.91
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.9
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.9
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.9
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.88
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.87
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 96.86
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.86
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.86
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.86
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.85
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.85
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.83
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.83
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.82
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 96.82
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.82
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.82
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.82
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.8
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.8
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.8
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 96.79
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.79
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.79
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 96.78
3bos_A242 Putative DNA replication factor; P-loop containing 96.77
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.76
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.75
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.74
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.73
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.72
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.72
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.72
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.71
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.71
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.71
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.7
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.7
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.69
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.68
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.68
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.65
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.64
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.64
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.64
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.64
2og2_A359 Putative signal recognition particle receptor; nuc 96.63
1p9r_A418 General secretion pathway protein E; bacterial typ 96.63
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.63
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.62
3kta_A182 Chromosome segregation protein SMC; structural mai 96.62
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.59
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 96.58
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.57
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.56
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.56
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.56
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.56
2oap_1511 GSPE-2, type II secretion system protein; hexameri 96.55
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.55
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.54
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.54
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 96.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.53
1tue_A212 Replication protein E1; helicase, replication, E1E 96.53
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.53
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.53
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.53
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.5
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.5
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 96.5
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 96.48
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.48
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.46
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 96.42
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 96.42
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.42
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.41
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.41
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.4
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.4
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.4
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.37
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.35
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 96.31
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.31
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.3
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.3
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.29
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.27
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.24
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 96.24
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.24
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.23
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.22
3co5_A143 Putative two-component system transcriptional RES 96.2
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.2
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.2
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.18
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.17
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 96.16
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.15
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.14
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.14
2r62_A268 Cell division protease FTSH homolog; ATPase domain 96.12
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 96.11
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.1
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.1
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.08
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.07
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.06
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 96.06
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.06
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.05
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.01
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.01
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.99
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.99
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.99
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.97
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.96
2qgz_A308 Helicase loader, putative primosome component; str 95.96
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.96
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.95
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.94
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.94
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.94
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.93
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.93
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.91
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 95.91
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.9
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.9
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.9
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 95.89
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.89
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.88
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 95.88
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=100.00  E-value=5.8e-38  Score=231.43  Aligned_cols=153  Identities=31%  Similarity=0.541  Sum_probs=127.2

Q ss_pred             CCceEEEEEcCCCCCHHHHHHHHHhCCCCCCCCCcccceeeeeEEEEEECCeEEEEEEEeCCCccccccchHHHhcCCcE
Q psy17231          6 VPEQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEA   85 (189)
Q Consensus         6 ~~~~~i~i~G~~g~GKTtli~~l~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~i~D~~g~~~~~~~~~~~~~~~~~   85 (189)
                      ++.+||+|+|++|||||||+++|..+.|...+  .+|++.++.......++..+.+.+|||+|+++|..++..+++.+++
T Consensus        11 ~k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~--~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~   88 (216)
T 4dkx_A           11 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTY--QATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAA   88 (216)
T ss_dssp             --CEEEEEECSTTSSHHHHHHHHHHSCCC------------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSE
T ss_pred             CCcEEEEEECcCCcCHHHHHHHHHhCCCCCCc--CCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccE
Confidence            56799999999999999999999999997665  7889989988888899999999999999999999999999999999


Q ss_pred             EEEEEeCCChhhHHHHHHHHHHHHHhC-CCCcEEEEeeccccccc---------------CCceEEeeccCCCCHHHHHH
Q psy17231         86 AILVFSLDNAASFHVLSQHLLEIVTYA-ENAKIFLCGNNEQCHNL---------------ISSTYKTSCKTGEGVEEMFA  149 (189)
Q Consensus        86 ~i~v~d~~~~~s~~~~~~~~~~~~~~~-~~~p~ivv~nK~d~~~~---------------~~~~~~~Sa~~~~~i~~~~~  149 (189)
                      +++|||++++++|+.+..|+..+.... +++|++|||||+|+...               ..+|++|||++|.||+++|+
T Consensus        89 ~ilv~di~~~~Sf~~i~~~~~~i~~~~~~~~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~~~~~e~SAktg~nV~e~F~  168 (216)
T 4dkx_A           89 AVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFR  168 (216)
T ss_dssp             EEEEEETTCHHHHHTHHHHHHHHHHHHTTSSEEEEEEECTTCGGGCCSCHHHHHHHHHHHTCEEEEEBTTTTBSHHHHHH
T ss_pred             EEEEeecchhHHHHHHHHHHHHHHHhcCCCCeEEEEeeccchHhcCcccHHHHhhHHHHhCCeeEEEeCCCCcCHHHHHH
Confidence            999999999999999999999988765 78999999999997542               23899999999999999999


Q ss_pred             HHHHHHHHhhh
Q psy17231        150 DIGRQLILSNR  160 (189)
Q Consensus       150 ~i~~~i~~~~~  160 (189)
                      .|++.+.+...
T Consensus       169 ~i~~~i~~~~~  179 (216)
T 4dkx_A          169 RVAAALPGMES  179 (216)
T ss_dssp             HHHHHC-----
T ss_pred             HHHHHHHhhhc
Confidence            99998875543



>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 1e-30
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 7e-30
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-28
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-26
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 1e-25
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 2e-25
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 4e-25
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 6e-25
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 2e-24
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 4e-24
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 2e-23
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 3e-23
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 7e-22
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 4e-21
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 8e-21
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 1e-20
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 1e-20
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 2e-20
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 3e-20
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-19
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 2e-19
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 2e-18
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 3e-18
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 4e-18
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 5e-18
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9e-18
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-16
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 4e-16
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 8e-16
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 1e-15
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 9e-15
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 1e-14
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 2e-14
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 3e-14
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 9e-14
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 1e-13
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 1e-13
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-13
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 3e-13
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 6e-12
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 7e-12
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 1e-11
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 2e-11
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 3e-11
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-10
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-10
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 4e-10
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 1e-09
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 4e-09
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 1e-08
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 8e-08
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 8e-08
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 1e-07
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 2e-07
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 4e-07
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 2e-06
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 5e-05
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 2e-04
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 0.002
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 0.004
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  107 bits (269), Expect = 1e-30
 Identities = 45/162 (27%), Positives = 81/162 (50%), Gaps = 18/162 (11%)

Query: 10  KVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGM 69
           K++L G+ GVGK+ +  R++ D F S+    ST+G+D   +  ++D + I++Q+WDT G 
Sbjct: 8   KLLLIGDSGVGKTCVLFRFSEDAFNSTF--ISTIGIDFKIRTIELDGKRIKLQIWDTAGQ 65

Query: 70  ERVASITSSYYKFAEAAILVFSLDNAASFHVLSQHLLEIVTYA-ENAKIFLCGNNEQCHN 128
           ER  +IT++YY+ A   +LV+ + N  SF  +   +  I  +A  + +  + GN    ++
Sbjct: 66  ERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVND 125

Query: 129 LISST---------------YKTSCKTGEGVEEMFADIGRQL 155
               +                +TS K    VE  F  + R +
Sbjct: 126 KRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDI 167


>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 100.0
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 100.0
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 100.0
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 100.0
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 100.0
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 100.0
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 100.0
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 100.0
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 100.0
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 100.0
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.97
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.97
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.97
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.97
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.97
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.96
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.94
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.93
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.93
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.93
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.93
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.92
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.91
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.91
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.89
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.88
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.88
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.88
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.86
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.86
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.86
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.85
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.84
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.84
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.83
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.79
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.79
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.78
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.74
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.73
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.69
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.66
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.66
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.64
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.64
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.63
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.58
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.57
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.56
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.55
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.55
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.5
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.35
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.11
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.05
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.94
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.94
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.92
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.82
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.68
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.63
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.55
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.32
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.08
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.02
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.99
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.92
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.86
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.84
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.81
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.8
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.8
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.79
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.76
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.74
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.74
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.73
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.68
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.65
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.62
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.61
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.59
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.56
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.56
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.55
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.5
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.49
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.46
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.43
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.42
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.4
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.39
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.39
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.36
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.35
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.34
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.31
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.31
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.29
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.29
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.28
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.28
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.27
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.24
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.23
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.22
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.22
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.21
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.2
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.19
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.19
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.18
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.17
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.17
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.17
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.15
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.14
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.11
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.11
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.09
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.09
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.04
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.04
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.03
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.03
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.01
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.0
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.99
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.96
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.95
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.94
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.92
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.92
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.91
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.86
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.84
d1vmaa2213 GTPase domain of the signal recognition particle r 96.84
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.82
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.81
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.81
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.81
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.8
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.79
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.79
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.79
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.76
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.75
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.75
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.74
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.73
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.72
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.72
d2qy9a2211 GTPase domain of the signal recognition particle r 96.68
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.67
d1okkd2207 GTPase domain of the signal recognition particle r 96.66
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.63
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.54
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.52
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.49
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.43
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.39
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.3
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 96.29
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.28
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.23
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.23
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.22
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.13
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.1
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.08
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.88
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.87
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.86
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.85
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.84
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.83
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.82
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.78
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.77
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.75
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.74
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.69
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.65
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.61
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.58
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.55
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.51
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.48
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.41
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.37
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.37
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.36
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.27
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.2
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 95.14
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.14
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.03
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.84
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.82
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 94.76
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 94.7
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.62
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.53
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.26
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.18
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.13
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 93.95
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.79
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.78
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.34
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 92.52
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 92.17
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.62
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 91.49
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.02
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 90.52
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 90.36
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 90.29
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.1
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.01
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 89.7
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 89.34
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.6
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.31
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 88.26
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 88.05
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 87.74
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 87.73
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.44
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 86.41
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 86.32
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 86.29
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.83
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.79
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 85.14
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 83.47
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 83.25
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 83.16
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 80.75
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 80.57
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.5e-35  Score=206.24  Aligned_cols=148  Identities=30%  Similarity=0.491  Sum_probs=134.6

Q ss_pred             ceEEEEEcCCCCCHHHHHHHHHhCCCCCCCCCcccceeeeeEEEEEECCeEEEEEEEeCCCccccccchHHHhcCCcEEE
Q psy17231          8 EQKVILCGEYGVGKSSLFRRYAYDTFISSSSRKSTLGLDNFNKEYKVDDRSIQMQLWDTGGMERVASITSSYYKFAEAAI   87 (189)
Q Consensus         8 ~~~i~i~G~~g~GKTtli~~l~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~i~D~~g~~~~~~~~~~~~~~~~~~i   87 (189)
                      .+||+++|++|||||||+++|..+.+...+  .+|++.+.........+..+.+.+||++|++++..++..+++.+++++
T Consensus         2 ~iKv~liG~~~vGKSsLi~rl~~~~~~~~~--~~ti~~~~~~~~~~~~~~~~~~~i~d~~g~~~~~~~~~~~~~~~~~~i   79 (164)
T d1z2aa1           2 AIKMVVVGNGAVGKSSMIQRYCKGIFTKDY--KKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACV   79 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHHCCCCCCS--SCCCSSSEEEEEEEETTEEEEEEEECCTTGGGTTCCCHHHHTTCCEEE
T ss_pred             eEEEEEECCCCcCHHHHHHHHHhCCCCccc--ccccccccceeeeeecCceeeeeeeccCCccchhhhhhhhhccCceEE
Confidence            479999999999999999999999887665  778887888888888999999999999999999999999999999999


Q ss_pred             EEEeCCChhhHHHHHHHHHHHHHhCCCCcEEEEeeccccccc---------------CCceEEeeccCCCCHHHHHHHHH
Q psy17231         88 LVFSLDNAASFHVLSQHLLEIVTYAENAKIFLCGNNEQCHNL---------------ISSTYKTSCKTGEGVEEMFADIG  152 (189)
Q Consensus        88 ~v~d~~~~~s~~~~~~~~~~~~~~~~~~p~ivv~nK~d~~~~---------------~~~~~~~Sa~~~~~i~~~~~~i~  152 (189)
                      +|||++++++|+.+..|+..+.+..+++|+++|+||+|+...               ..+|++|||++|.||+++|++++
T Consensus        80 ~v~d~~~~~s~~~~~~~~~~i~~~~~~~~iilVgnK~Dl~~~~~v~~~~~~~~~~~~~~~~~e~Sak~g~~v~e~f~~l~  159 (164)
T d1z2aa1          80 LVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSCIKNEEAEGLAKRLKLRFYRTSVKEDLNVSEVFKYLA  159 (164)
T ss_dssp             EEEETTCHHHHHTHHHHHHHHHHHHCSCCEEEEEECGGGGGGCSSCHHHHHHHHHHHTCEEEECBTTTTBSSHHHHHHHH
T ss_pred             EEEeccchhhhhhcccccccccccCCCceEEEeeccCCcccceeeeehhhHHHHHHcCCEEEEeccCCCcCHHHHHHHHH
Confidence            999999999999999999999888789999999999996432               23899999999999999999999


Q ss_pred             HHHHH
Q psy17231        153 RQLIL  157 (189)
Q Consensus       153 ~~i~~  157 (189)
                      +.+++
T Consensus       160 ~~~lq  164 (164)
T d1z2aa1         160 EKHLQ  164 (164)
T ss_dssp             HHHHC
T ss_pred             HHHhC
Confidence            98863



>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure