Psyllid ID: psy17730

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFKHSLD
ccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHcccccHHcccccEEEccccEEEEEEHHHHHHHHHccccHHHHHHHHHHHccc
cccccEcHccccccccccHHHHHHHHHHHcccccEEEcccccccHHHHccccccEHEcccccccccccEEEEEHHHHHHHcccccccHHHHHHHHHHcccc
mpqkknpdiprtlseakpesCLRQRLFNmlthpmeisassvhdkdmqeckQPRATAIdnrlhvmsrpsITIIYVQKQLCNSVRGLACTSCAAELWFKHSLD
mpqkknpdiprtlseakpesCLRQRLFNMLTHPMEISassvhdkdmQECKQPRATAIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAelwfkhsld
MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFKHSLD
********************************************************IDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFK****
********************CLRQRLFNMLTHPMEIS******************AIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFKHS**
***********TLSEAKPESCLRQRLFNMLTHPMEISAS*********CKQPRATAIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFKHSLD
***KKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFKH***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDNRLHVMSRPSITIIYVQKQLCNSVRGLACTSCAAELWFKHSLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
TIGR00838455 TIGR00838, argH, argininosuccinate lyase 3e-04
>gnl|CDD|129918 TIGR00838, argH, argininosuccinate lyase Back     alignment and domain information 
 Score = 37.7 bits (88), Expect = 3e-04
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 1   MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEI--SASSVHDKDMQECKQPRATAID 58
           MPQKKNPD+   L   K       R+   LT  +    +    +++D+QE K+P   A+ 
Sbjct: 278 MPQKKNPDVAE-LIRGKT-----GRVQGNLTGMLMTLKALPLAYNRDLQEDKEPLFDALK 331

Query: 59  NRLHVM 64
                +
Sbjct: 332 TVELSL 337

This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens [Amino acid biosynthesis, Glutamate family]. Length = 455

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
COG0165459 ArgH Argininosuccinate lyase [Amino acid transport 95.18
PRK06389434 argininosuccinate lyase; Provisional 94.06
KOG1316|consensus464 90.53
PRK00485464 fumC fumarate hydratase; Reviewed 87.38
PLN02646474 argininosuccinate lyase 86.87
cd01595381 Adenylsuccinate_lyase_like Adenylsuccinate lyase ( 86.68
TIGR02426338 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisom 86.56
PRK06390451 adenylosuccinate lyase; Provisional 86.37
PRK12425464 fumarate hydratase; Provisional 85.77
cd01334325 Lyase_I Lyase class I family; a group of proteins 84.63
cd01360387 Adenylsuccinate_lyase_1 Adenylsuccinate lyase (ASL 84.28
cd01597437 pCLME prokaryotic 3-carboxy-cis,cis-muconate cyclo 84.07
PRK08540449 adenylosuccinate lyase; Reviewed 83.94
PRK06705 502 argininosuccinate lyase; Provisional 83.68
PRK08937216 adenylosuccinate lyase; Provisional 82.73
TIGR00928435 purB adenylosuccinate lyase. This family consists 82.64
PRK04833455 argininosuccinate lyase; Provisional 82.42
TIGR00838455 argH argininosuccinate lyase. This model describes 82.35
PRK12308 614 bifunctional argininosuccinate lyase/N-acetylgluta 82.25
PLN00134458 fumarate hydratase; Provisional 81.58
PRK02186887 argininosuccinate lyase; Provisional 81.37
PRK12273472 aspA aspartate ammonia-lyase; Provisional 80.59
cd01596450 Aspartase_like aspartase (L-aspartate ammonia-lyas 80.55
PRK13353473 aspartate ammonia-lyase; Provisional 80.05
>COG0165 ArgH Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=95.18  E-value=0.0078  Score=50.43  Aligned_cols=55  Identities=33%  Similarity=0.443  Sum_probs=32.1

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhcCccchhccc
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDN   59 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeckqprataidn   59 (101)
                      ||||||||...-+. +|--. .--.|.-|||=.+-  .-.-..|||||=|.|--.+++.
T Consensus       281 MPQKKNPD~~ELiR-gk~gr-v~G~l~~ll~~~k~--lPlaYnrDlQedke~lfds~~t  335 (459)
T COG0165         281 MPQKKNPDVLELIR-GKAGR-VIGALTGLLTIMKG--LPLAYNRDLQEDKEPLFDSVDT  335 (459)
T ss_pred             CCCCCCCcHHHHHH-Hhhhh-hHHHHHHHHHHHhc--CcccccHHHHhhhHHHHHHHHH
Confidence            99999999875432 22111 11123334433222  1234679999999987766653

>PRK06389 argininosuccinate lyase; Provisional Back     alignment and domain information
>KOG1316|consensus Back     alignment and domain information
>PRK00485 fumC fumarate hydratase; Reviewed Back     alignment and domain information
>PLN02646 argininosuccinate lyase Back     alignment and domain information
>cd01595 Adenylsuccinate_lyase_like Adenylsuccinate lyase (ASL)_like Back     alignment and domain information
>TIGR02426 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase Back     alignment and domain information
>PRK06390 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK12425 fumarate hydratase; Provisional Back     alignment and domain information
>cd01334 Lyase_I Lyase class I family; a group of proteins which catalyze similar beta-elimination reactions Back     alignment and domain information
>cd01360 Adenylsuccinate_lyase_1 Adenylsuccinate lyase (ASL)_subgroup 1 Back     alignment and domain information
>cd01597 pCLME prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like Back     alignment and domain information
>PRK08540 adenylosuccinate lyase; Reviewed Back     alignment and domain information
>PRK06705 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK08937 adenylosuccinate lyase; Provisional Back     alignment and domain information
>TIGR00928 purB adenylosuccinate lyase Back     alignment and domain information
>PRK04833 argininosuccinate lyase; Provisional Back     alignment and domain information
>TIGR00838 argH argininosuccinate lyase Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PLN00134 fumarate hydratase; Provisional Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK12273 aspA aspartate ammonia-lyase; Provisional Back     alignment and domain information
>cd01596 Aspartase_like aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes Back     alignment and domain information
>PRK13353 aspartate ammonia-lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
1tj7_A457 Argininosuccinate lyase; crystallin, E. coli, fuma 4e-04
2e9f_A462 Argininosuccinate lyase; alpha helix bundle; HET: 4e-04
>1tj7_A Argininosuccinate lyase; crystallin, E. coli, fumarase, ASPA lyase; 2.44A {Escherichia coli} SCOP: a.127.1.1 Length = 457 Back     alignment and structure
 Score = 36.8 bits (86), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 16/65 (24%)

Query: 1   MPQKKNPDIPRTLSEAKPESCLRQ--RLFNMLTH----PMEISASSVHDKDMQECKQPRA 54
           MPQKKNPD    L   K   C R    L  M+      P+       ++KDMQE K+   
Sbjct: 280 MPQKKNPDALE-LIRGK---CGRVQGALTGMMMTLKGLPL------AYNKDMQEDKEGLF 329

Query: 55  TAIDN 59
            A+D 
Sbjct: 330 DALDT 334
>2e9f_A Argininosuccinate lyase; alpha helix bundle; HET: ARG; 2.80A {Thermus thermophilus} Length = 462 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
1q5n_A454 3-carboxy-CIS,CIS-muconate cycloisomerase; CMLE, a 91.12
3c8t_A451 Fumarate lyase; structural genomics, PSI-2, protei 90.8
1dof_A403 Adenylosuccinate lyase; purine biosynthesis; 2.10A 90.13
2e9f_A462 Argininosuccinate lyase; alpha helix bundle; HET: 89.04
2ptr_A462 Adenylosuccinate lyase; mutant-substrate complex; 87.84
1k7w_A468 Delta 2 crystallin; eye lens protein, argininosucc 86.13
1c3c_A429 Protein (adenylosuccinate lyase); purine biosynthe 85.36
2qga_B465 Adenylosuccinate lyase; malaria, PV003765, SGC, st 85.3
2pfm_A444 Adenylosuccinate lyase; PURB, purine biosynthesis, 84.36
3bhg_A459 Adenylosuccinate lyase; structural G PSI-2, protei 83.93
1vdk_A466 Fumarase C, fumarate hydratase class II; TCA cycle 83.4
1re5_A450 3-carboxy-CIS,CIS-muconate cycloisomerase; homotet 83.4
1jsw_A478 L-aspartase, L-aspartate ammonia-lyase; amino acid 82.94
1yis_A478 Adenylosuccinate lyase; structural genomics, PSI, 82.83
1tj7_A457 Argininosuccinate lyase; crystallin, E. coli, fuma 82.11
2fel_A359 3-carboxy-CIS,CIS-muconate lactonizing enzyme; bio 81.99
3r6q_A468 Aspartase; aspartate ammonia lyase, lyase; 2.40A { 81.78
1fur_A467 Fumarase C, FUMC; hydrolyase, carbon oxygen lyase, 81.73
4adm_A495 Fumarase C, fumarate hydratase class II; lyase, tr 80.29
4eei_A438 Adenylosuccinate lyase; structural genomics, niaid 80.02
>1q5n_A 3-carboxy-CIS,CIS-muconate cycloisomerase; CMLE, aromatic degradation; 2.30A {Acinetobacter calcoaceticus} SCOP: a.127.1.1 Back     alignment and structure
Probab=91.12  E-value=0.037  Score=42.38  Aligned_cols=42  Identities=19%  Similarity=0.339  Sum_probs=20.3

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhh
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQEC   49 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqec   49 (101)
                      ||||+||+++..+.-      +-.+++..+.--+ ....+-|.+|+|+-
T Consensus       283 MP~K~NP~~~E~i~~------~a~~v~g~~~~~~-~~~~~~~erd~~~~  324 (454)
T 1q5n_A          283 MPHKRNPVAAASVLA------AANRVPALMSSIY-QSMVQEHERSLGAW  324 (454)
T ss_dssp             ----CCCHHHHHHHH------HHHHHHHHHHHHH-HTTCCCTTSCSSHH
T ss_pred             CCCCCCCHHHHHHHH------HHHHHHHHHHHHH-Hhccchhcccccch
Confidence            999999999865432      1112222211111 23567788998873
>3c8t_A Fumarate lyase; structural genomics, PSI-2, protein structure initiat YORK SGX research center for structural genomics, nysgxrc; 2.20A {Mesorhizobium SP} Back     alignment and structure
>1dof_A Adenylosuccinate lyase; purine biosynthesis; 2.10A {Pyrobaculum aerophilum} SCOP: a.127.1.1 Back     alignment and structure
>2e9f_A Argininosuccinate lyase; alpha helix bundle; HET: ARG; 2.80A {Thermus thermophilus} Back     alignment and structure
>2ptr_A Adenylosuccinate lyase; mutant-substrate complex; HET: 2SA; 1.85A {Escherichia coli} PDB: 2ptq_A* 2pts_A 3gzh_A Back     alignment and structure
>1k7w_A Delta 2 crystallin; eye lens protein, argininosuccinate lyase, enzyme mechanism; HET: AS1; 1.96A {Anas platyrhynchos} SCOP: a.127.1.1 PDB: 1hy1_A 1tju_A 1auw_A 1tjv_A 1tjw_A* 1u16_A* 1u15_A* 1dcn_A* 1xwo_A 1hy0_A 1i0a_A 1aos_A 1k62_A Back     alignment and structure
>1c3c_A Protein (adenylosuccinate lyase); purine biosynthesis; 1.80A {Thermotoga maritima} SCOP: a.127.1.1 PDB: 1c3u_A Back     alignment and structure
>2qga_B Adenylosuccinate lyase; malaria, PV003765, SGC, structural G consortium; HET: AMP; 2.01A {Plasmodium vivax} PDB: 2hvg_A Back     alignment and structure
>2pfm_A Adenylosuccinate lyase; PURB, purine biosynthesis, B anthracis; 2.00A {Bacillus anthracis} PDB: 1f1o_A 2x75_A* Back     alignment and structure
>3bhg_A Adenylosuccinate lyase; structural G PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.90A {Legionella pneumophila subsp} Back     alignment and structure
>1vdk_A Fumarase C, fumarate hydratase class II; TCA cycle, riken structural genomics/proteomics in RSGI, structural genomics, lyase; 1.80A {Thermus thermophilus} SCOP: a.127.1.1 Back     alignment and structure
>1re5_A 3-carboxy-CIS,CIS-muconate cycloisomerase; homotetramer, fumarase class II cycloisomerase, molecular EV isomerase; HET: CIT; 2.60A {Pseudomonas putida} SCOP: a.127.1.1 Back     alignment and structure
>1jsw_A L-aspartase, L-aspartate ammonia-lyase; amino acid ammonia-lyase; HET: BGC; 2.70A {Escherichia coli} SCOP: a.127.1.1 Back     alignment and structure
>1yis_A Adenylosuccinate lyase; structural genomics, PSI, P structure initiative, southeast collaboratory for structura genomics, secsg; 2.40A {Caenorhabditis elegans} Back     alignment and structure
>1tj7_A Argininosuccinate lyase; crystallin, E. coli, fumarase, ASPA lyase; 2.44A {Escherichia coli} SCOP: a.127.1.1 Back     alignment and structure
>2fel_A 3-carboxy-CIS,CIS-muconate lactonizing enzyme; biodegradation, sulphonic acids, 3-sulphomuconate; 2.20A {Agrobacterium tumefaciens} PDB: 2fen_A Back     alignment and structure
>3r6q_A Aspartase; aspartate ammonia lyase, lyase; 2.40A {Bacillus SP} SCOP: a.127.1.1 PDB: 1j3u_A 3r6v_A 3r6y_A Back     alignment and structure
>1fur_A Fumarase C, FUMC; hydrolyase, carbon oxygen lyase, KREB'S cycle enzyme, fumara hydratase; 1.95A {Escherichia coli} SCOP: a.127.1.1 PDB: 1fuo_A* 1yfe_A 1kq7_A* 1fuq_A* 1fup_A* 2fus_A* 3tv2_A Back     alignment and structure
>4adm_A Fumarase C, fumarate hydratase class II; lyase, tricarboxylic acid cycle; HET: SRT; 1.65A {Mycobacterium tuberculosis} PDB: 4adl_A* 3no9_A 4apa_A 4apb_A 3qbp_A 3rd8_A 3rrp_A Back     alignment and structure
>4eei_A Adenylosuccinate lyase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: AMP; 1.92A {Francisella tularensis subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d1j3ua_462 L-aspartate ammonia lyase {Bacillus sp., ym55-1 [T 86.49
d1f1oa_408 Adenylosuccinate lyase {Bacillus subtilis [TaxId: 85.35
d1fuoa_456 Fumarase {Escherichia coli [TaxId: 562]} 85.15
d1re5a_448 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) { 84.21
d1tj7a_455 Argininosuccinate lyase/delta-crystallin {Escheric 83.85
d1jswa_459 L-aspartate ammonia lyase {Escherichia coli [TaxId 82.43
d1c3ca_429 Adenylosuccinate lyase {Thermotoga maritima [TaxId 81.53
d1tjva_449 Argininosuccinate lyase/delta-crystallin {Domestic 80.93
d1k62b_459 Argininosuccinate lyase/delta-crystallin {Human (H 80.77
>d1j3ua_ a.127.1.1 (A:) L-aspartate ammonia lyase {Bacillus sp., ym55-1 [TaxId: 1409]} Back     information, alignment and structure
class: All alpha proteins
fold: L-aspartase-like
superfamily: L-aspartase-like
family: L-aspartase/fumarase
domain: L-aspartate ammonia lyase
species: Bacillus sp., ym55-1 [TaxId: 1409]

Probab=86.49  E-value=0.056  Score=39.78  Aligned_cols=13  Identities=46%  Similarity=0.876  Sum_probs=11.2

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       317 MP~KrNP~~~E~v  329 (462)
T d1j3ua_         317 MPGKVNPVMPEVM  329 (462)
T ss_dssp             CTTCCCCHHHHHH
T ss_pred             hccccCChhHhhh
Confidence            9999999988654
>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fuoa_ a.127.1.1 (A:) Fumarase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1re5a_ a.127.1.1 (A:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440 [TaxId: 303]} Back     information, alignment and structure
>d1tj7a_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jswa_ a.127.1.1 (A:) L-aspartate ammonia lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c3ca_ a.127.1.1 (A:) Adenylosuccinate lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tjva_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]} Back     information, alignment and structure
>d1k62b_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure