Psyllid ID: psy17746

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESRQLVSIHPSSSLAGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRIVTDPTS
cEEEEccccccEEcccEEEEEccccccccccccccccEEEEEEEcHHHHHHHHccccccccccEEEEEccHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHcccccHHHHHHHcccccccccccccccc
cEEEEEEEEEEEEEccEEEEEcccccEEccccccccccEEEEccccHHHHHHHcccccccccccEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccEccccccHHHHHHHHHHccccHHHcccccc
IILAtniaetsitvpgikyvidsglvkqkthhpgtgldVLQVTSISQAQAWQRTGRAGREAEGFCyrmyseedfrrmnkntvpeiqrtnLASTALTLLSLEINaatfdfmdkppkeiesrqlvsihpssslagslpeYILFTELLQTSRCYMKtlsvidpawitemvpgyaaqhrivtdpts
iilatniaetsitvpgIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQrtgragreaEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESRQLVSIHPssslagslPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQhrivtdpts
IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDFRRMNKNTVPEIQRTNlastaltllslEINAATFDFMDKPPKEIESRQLVSIHPSSSLAGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRIVTDPTS
**LATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFM*********************AGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRIV*****
IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESRQLVSIHPSSSLAGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAA**********
IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSIS*************EAEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESRQLVSIHPSSSLAGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRIVTDPTS
IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQ***********AEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESRQLVSIHPSSSLAGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRIV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESRQLVSIHPSSSLAGSLPEYILFTELLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRIVTDPTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
Q80VY9 698 Putative ATP-dependent RN yes N/A 0.653 0.170 0.595 8e-38
Q9H6R0 707 Putative ATP-dependent RN no N/A 0.653 0.168 0.586 1e-37
Q09530 1200 Probable pre-mRNA-splicin yes N/A 0.736 0.111 0.544 2e-32
Q14562 1220 ATP-dependent RNA helicas no N/A 0.840 0.125 0.485 2e-32
A2A4P0 1244 ATP-dependent RNA helicas no N/A 0.840 0.122 0.485 2e-32
P0CE10 1787 Putative uncharacterized no N/A 0.802 0.081 0.458 6e-31
Q54F05 1160 ATP-dependent RNA helicas no N/A 0.769 0.120 0.5 3e-30
Q9P774 1173 Pre-mRNA-splicing factor yes N/A 0.637 0.098 0.542 4e-29
O42643 1168 Pre-mRNA-splicing factor no N/A 0.719 0.112 0.503 5e-29
P34498 1131 Probable pre-mRNA-splicin no N/A 0.631 0.101 0.547 3e-28
>sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 Back     alignment and function desciption
 Score =  156 bits (394), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 95/121 (78%), Gaps = 2/121 (1%)

Query: 1   IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGRE 60
           +I++TNIAETSIT+ GIKYV+D+G+VK K ++P +GL+VL V  +S+ QAWQRTGRAGRE
Sbjct: 341 VIISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGRE 400

Query: 61  AEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEI-NAATFDFMDKP-PKEIE 118
             G CYR+Y+E++F +  K TVPEIQR NLAS  L LL++++ N  TFDFM KP P  IE
Sbjct: 401 DSGICYRLYTEDEFEKFEKMTVPEIQRCNLASVILQLLAMKVPNVLTFDFMSKPSPDHIE 460

Query: 119 S 119
           +
Sbjct: 461 A 461
Stimulates RNA polymerase I transcription of the 47S precursor rRNA. Associates with ribosomal DNA (rDNA) loci where it is involved in POLR1A recruitment. Important element of nucleolar organization.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 Back     alignment and function description
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|P0CE10|Y4102_ARATH Putative uncharacterized protein At4g01020, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=4 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description
>sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
110750126 694 PREDICTED: putative ATP-dependent RNA he 0.752 0.197 0.569 3e-41
340708642 693 PREDICTED: putative ATP-dependent RNA he 0.752 0.197 0.569 4e-41
383856542 692 PREDICTED: putative ATP-dependent RNA he 0.752 0.197 0.562 7e-41
350413151 693 PREDICTED: putative ATP-dependent RNA he 0.752 0.197 0.562 9e-41
270006741 706 hypothetical protein TcasGA2_TC013109 [T 0.637 0.164 0.637 1e-40
242005655 695 ATP-dependent RNA helicase, putative [Pe 0.637 0.166 0.646 5e-40
332023762 689 Putative ATP-dependent RNA helicase DHX3 0.868 0.229 0.482 2e-39
307186331 733 Putative ATP-dependent RNA helicase DHX3 0.868 0.215 0.477 6e-39
322790061220 hypothetical protein SINV_09902 [Solenop 0.637 0.527 0.629 1e-38
345490966 696 PREDICTED: putative ATP-dependent RNA he 0.752 0.196 0.540 5e-38
>gi|110750126|ref|XP_001122093.1| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/137 (56%), Positives = 105/137 (76%)

Query: 1   IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGRE 60
           +IL+TN+AETS+T+ GI++VID+G+VK +THHP TGLDVL+V  +S+AQAWQRTGRAGRE
Sbjct: 345 LILSTNVAETSVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGRE 404

Query: 61  AEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEINAATFDFMDKPPKEIESR 120
           A G CYR Y++E+F RM +  VPEIQR +LA  AL LL++ ++  TFDFMDKPPKE    
Sbjct: 405 AAGKCYRTYTKEEFERMKEMPVPEIQRCSLAGVALQLLAIGVDITTFDFMDKPPKEAVDV 464

Query: 121 QLVSIHPSSSLAGSLPE 137
            +  +    ++ GS P+
Sbjct: 465 AVTCLEKLGAVKGSPPQ 481

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340708642|ref|XP_003392931.1| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383856542|ref|XP_003703767.1| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350413151|ref|XP_003489896.1| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|270006741|gb|EFA03189.1| hypothetical protein TcasGA2_TC013109 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242005655|ref|XP_002423679.1| ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212506848|gb|EEB10941.1| ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332023762|gb|EGI63986.1| Putative ATP-dependent RNA helicase DHX33 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307186331|gb|EFN71981.1| Putative ATP-dependent RNA helicase DHX33 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322790061|gb|EFZ15113.1| hypothetical protein SINV_09902 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345490966|ref|XP_001600447.2| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
UNIPROTKB|I3L1L6 617 DHX33 "Putative ATP-dependent 0.653 0.192 0.537 1.4e-42
UNIPROTKB|F1PRA1 616 DHX33 "Uncharacterized protein 0.653 0.193 0.528 2.1e-42
UNIPROTKB|Q9H6R0 707 DHX33 "Putative ATP-dependent 0.653 0.168 0.537 3.7e-42
MGI|MGI:2445102 698 Dhx33 "DEAH (Asp-Glu-Ala-His) 0.653 0.170 0.545 6.8e-42
UNIPROTKB|F1MWZ4 714 F1MWZ4 "Uncharacterized protei 0.653 0.166 0.545 8e-42
TAIR|locus:2062492 1044 MEE29 "maternal effect embryo 0.675 0.117 0.511 5.7e-36
TAIR|locus:2033723 1044 ESP3 "ENHANCED SILENCING PHENO 0.675 0.117 0.472 8.5e-35
FB|FBgn0032194 694 CG4901 [Drosophila melanogaste 0.631 0.165 0.525 2e-34
CGD|CAL0004768 996 PRP22 [Candida albicans (taxid 0.620 0.113 0.504 2.8e-34
DICTYBASE|DDB_G0285843 1387 helD "putative RNA splicing fa 0.631 0.082 0.521 4.7e-33
UNIPROTKB|I3L1L6 DHX33 "Putative ATP-dependent RNA helicase DHX33" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 1.4e-42, Sum P(2) = 1.4e-42
 Identities = 65/121 (53%), Positives = 88/121 (72%)

Query:     1 IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGRE 60
             +I++TNIAETSIT+ GIKYV+D+G+VK K ++P +GL+VL V  +S+ QAWQRTGRAGRE
Sbjct:   260 VIISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGRE 319

Query:    61 AEGFCYRMYSEEDFRRMNKNTVPEIQRTNXXXXXXXXXXXEI-NAATFDFMDKP-PKEIE 118
               G CYR+Y+E++F + +K TVPEIQR N           ++ N  TFDFM KP P  I+
Sbjct:   320 DSGICYRLYTEDEFEKFDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQ 379

Query:   119 S 119
             +
Sbjct:   380 A 380
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F1PRA1 DHX33 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H6R0 DHX33 "Putative ATP-dependent RNA helicase DHX33" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2445102 Dhx33 "DEAH (Asp-Glu-Ala-His) box polypeptide 33" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWZ4 F1MWZ4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2062492 MEE29 "maternal effect embryo arrest 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033723 ESP3 "ENHANCED SILENCING PHENOTYPE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0032194 CG4901 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0004768 PRP22 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285843 helD "putative RNA splicing factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9P774PRP16_SCHPO3, ., 6, ., 4, ., 1, 30.54230.63730.0988yesN/A
Q80VY9DHX33_MOUSE3, ., 6, ., 4, ., 1, 30.59500.65380.1704yesN/A
Q09530MOG5_CAEEL3, ., 6, ., 4, ., 1, 30.54410.73620.1116yesN/A
P45018HRPA_HAEIN3, ., 6, ., 4, ., 1, 30.50870.62080.0866yesN/A
P24384PRP22_YEAST3, ., 6, ., 4, ., 1, 30.50370.71970.1144yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 3e-50
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 4e-33
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 4e-33
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 1e-29
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-26
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 3e-15
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-07
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-07
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-05
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 9e-05
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-04
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-04
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  172 bits (438), Expect = 3e-50
 Identities = 67/126 (53%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGRE 60
           ++LATNIAETS+T+PGI+YVIDSGL K+K + P TGL  L+   IS+A A QR GRAGR 
Sbjct: 316 VVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRT 375

Query: 61  AEGFCYRMYSEEDFRRMNKNTVPEIQRTNLASTALTLLSLEI--NAATFDFMDKPPKE-- 116
             G CYR+YSEEDF    + T+PEI RT+L+   L L SL I  + A F F+D PP+   
Sbjct: 376 GPGICYRLYSEEDFLAFPEFTLPEILRTDLSGLVLQLKSLGIGQDIAPFPFLDPPPEAAI 435

Query: 117 IESRQL 122
             +  L
Sbjct: 436 QAALTL 441

Length = 845
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
KOG0922|consensus674 100.0
KOG0923|consensus902 100.0
KOG0924|consensus1042 100.0
KOG0925|consensus699 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0926|consensus 1172 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0920|consensus 924 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PHA02653675 RNA helicase NPH-II; Provisional 99.92
KOG0921|consensus 1282 99.72
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.59
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.39
PTZ00424401 helicase 45; Provisional 98.38
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.37
PTZ00110545 helicase; Provisional 98.31
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.29
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 98.25
PRK01172 674 ski2-like helicase; Provisional 98.19
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.18
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.17
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 98.15
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.13
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.13
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.01
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 98.01
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 97.99
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.95
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 97.94
KOG0921|consensus 1282 97.94
smart0049082 HELICc helicase superfamily c-terminal domain. 97.92
PRK02362 737 ski2-like helicase; Provisional 97.91
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.91
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 97.81
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.76
KOG0354|consensus 746 97.75
PRK13766 773 Hef nuclease; Provisional 97.7
PRK10689 1147 transcription-repair coupling factor; Provisional 97.63
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 97.56
PRK00254 720 ski2-like helicase; Provisional 97.43
KOG0331|consensus519 97.43
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.42
PRK13767 876 ATP-dependent helicase; Provisional 97.32
PRK05298652 excinuclease ABC subunit B; Provisional 97.31
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 97.23
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.19
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 97.04
KOG0345|consensus567 96.97
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 96.9
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 96.85
PRK09200 790 preprotein translocase subunit SecA; Reviewed 96.72
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 96.4
KOG0336|consensus629 96.38
KOG4150|consensus 1034 96.27
KOG0333|consensus673 96.27
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 96.19
PHA02558501 uvsW UvsW helicase; Provisional 96.18
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 96.17
KOG0344|consensus593 96.01
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 95.97
KOG0335|consensus482 95.96
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 95.94
COG4098441 comFA Superfamily II DNA/RNA helicase required for 95.89
PRK09694878 helicase Cas3; Provisional 95.69
KOG0330|consensus476 95.66
TIGR00595505 priA primosomal protein N'. All proteins in this f 95.62
KOG0338|consensus691 95.45
PRK05580679 primosome assembly protein PriA; Validated 95.31
KOG0342|consensus543 95.12
COG1200677 RecG RecG-like helicase [DNA replication, recombin 95.11
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 94.83
KOG0340|consensus442 94.74
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 94.72
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 94.64
COG1205 851 Distinct helicase family with a unique C-terminal 94.6
KOG0348|consensus708 94.54
KOG0339|consensus731 94.09
PRK04914 956 ATP-dependent helicase HepA; Validated 93.12
KOG0341|consensus610 92.92
KOG0352|consensus 641 92.56
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 92.3
KOG0351|consensus 941 92.04
COG1201 814 Lhr Lhr-like helicases [General function predictio 91.47
KOG0920|consensus924 90.96
KOG0953|consensus 700 90.86
KOG0347|consensus731 90.59
KOG0350|consensus620 88.89
KOG0343|consensus 758 88.81
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 88.29
KOG0328|consensus400 85.97
KOG0326|consensus459 85.59
KOG0332|consensus477 85.08
>KOG0922|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.3e-63  Score=446.97  Aligned_cols=176  Identities=51%  Similarity=0.838  Sum_probs=171.5

Q ss_pred             CEEEecccccCCCCCCceEEEeCCeEEEeEEeCCCCceeeeEEEeeHHHHHhhcCcCCccccceEEeecCHHHHHhccCC
Q psy17746          1 IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDFRRMNKN   80 (182)
Q Consensus         1 vilaTniaEtsiti~~v~~VID~G~~k~~~~~~~~~~~~l~~~~isk~~a~qR~graGr~~~G~c~rL~t~~~~~~l~~~   80 (182)
                      ||+||||||||+|||||+||||+|++|++.|||++|+++|..+||||++|.||+|||||++||+|||||++++|++|+++
T Consensus       319 vIlsTNIAETSlTI~GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGRAGRt~pGkcyRLYte~~~~~~~~~  398 (674)
T KOG0922|consen  319 VILSTNIAETSLTIDGIRYVVDSGFVKQKKYNPRTGLDSLIVVPISKASANQRAGRAGRTGPGKCYRLYTESAYDKMPLQ  398 (674)
T ss_pred             EEEEcceeeeeEEecceEEEEcCCceEEEeeccccCccceeEEechHHHHhhhcccCCCCCCceEEEeeeHHHHhhcccC
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhccCChHHHHHHHHhcCC-CcccccCcCCCcccc------------------------------------------
Q psy17746         81 TVPEIQRTNLASTALTLLSLEI-NAATFDFMDKPPKEI------------------------------------------  117 (182)
Q Consensus        81 ~~PeI~r~~L~~~vL~lk~lg~-~~~~f~~~dpP~~~~------------------------------------------  117 (182)
                      ++|||+|++|+..+|+||++|+ |+..|+|+|||++++                                          
T Consensus       399 ~~PEI~R~~Ls~~vL~Lkalgi~d~l~F~f~d~P~~~~l~~AL~~L~~lgald~~g~lt~p~G~~ma~~Pl~p~lsk~ll  478 (674)
T KOG0922|consen  399 TVPEIQRVNLSSAVLQLKALGINDPLRFPFIDPPPPEALEEALEELYSLGALDDRGKLTSPLGRQMAELPLEPHLSKMLL  478 (674)
T ss_pred             CCCceeeechHHHHHHHHhcCCCCcccCCCCCCCChHHHHHHHHHHHhcCcccCcCCcCchHHhhhhhcCCCcchhhhhh
Confidence            9999999999999999999999 999999999999988                                          


Q ss_pred             --------------------------------------------------------------------------------
Q psy17746        118 --------------------------------------------------------------------------------  117 (182)
Q Consensus       118 --------------------------------------------------------------------------------  117 (182)
                                                                                                      
T Consensus       479 ~s~~~gc~~e~l~i~a~Lsv~~~f~~p~~~~~~~a~~~~~kf~~~eGDh~tlL~vy~~~~~~~~~~~wC~en~i~~r~l~  558 (674)
T KOG0922|consen  479 KSSELGCSEEILTIAAMLSVQSVFSRPKDKKAEDADRKRAKFANPEGDHLTLLNVYESWKENGTSKKWCKENFINARSLK  558 (674)
T ss_pred             hccccCCcchhhhheeeeeccceecCccchhhhhhhHHHHhhcCcccCHHHHHHHHHHHHhcCChhhHHHHhcccHHHHH
Confidence                                                                                            


Q ss_pred             ------------------------------------------------------ccceeEeeecccccCCCCCceeeeee
Q psy17746        118 ------------------------------------------------------ESRQLVSIHPSSSLAGSLPEYILFTE  143 (182)
Q Consensus       118 ------------------------------------------------------~~~~~v~iHPsS~l~~~~p~~ivy~e  143 (182)
                                                                            .+++.|+|||||+||+++|+||||||
T Consensus       559 ~a~~ir~QL~~i~~~~~~~~~s~~~d~~~i~k~l~aGff~N~A~~~~~~~Yrti~~~~~v~IHPSS~l~~~~p~~viy~e  638 (674)
T KOG0922|consen  559 RAKDIRKQLRRILDKFGLPVSSCGGDMEKIRKCLCAGFFRNVAERDYQDGYRTIRGGQPVYIHPSSVLFRRKPEWVIYHE  638 (674)
T ss_pred             HHHHHHHHHHHHHHHcCCCccCCCCCHHHHHHHHHHHHHHHHHHhhcCCCeEEccCCcEEEEechHHhhcCCCCEEEEEE
Confidence                                                                  46899999999999999999999999


Q ss_pred             eeeccccceeeeeeeChhhhhhhCccccccCcc
Q psy17746        144 LLQTSRCYMKTLSVIDPAWITEMVPGYAAQHRI  176 (182)
Q Consensus       144 lv~t~~~yir~vs~i~~~WL~e~~p~~~~~~~~  176 (182)
                      ++.|+|.|||+|+.|+++||.|+||+||+.+..
T Consensus       639 l~~Ttk~Y~r~Vt~i~~~wL~e~ap~~~~~~~~  671 (674)
T KOG0922|consen  639 LLQTTKEYMRNVTAIDPEWLLELAPHFFKQSDE  671 (674)
T ss_pred             EeecchHhHhheeecCHHHHHHhCchHhhcccc
Confidence            999999999999999999999999999887653

>KOG0923|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 7e-22
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-05
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 7e-22
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-05
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 2e-08
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 76/124 (61%), Gaps = 2/124 (1%)
Query: 1   IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGRE 60
           ++++TNIAETS+T+ GI YV+D G  KQK ++P   ++ L V+ IS+A A QR GRAGR 
Sbjct: 372 VVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRT 431
Query: 61  AEGFCYRMYSEEDFRR-MNKNTVPEIQRTNXXXXXXXXXXXEINAAT-FDFMDKPPKEIE 118
             G C+R+Y+EE F++ + + + PEI R+N            I+    FDFMD P  E  
Sbjct: 432 RPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETM 491
Query: 119 SRQL 122
            R L
Sbjct: 492 MRAL 495
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 3e-64
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 2e-16
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-26
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 7e-26
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-25
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 5e-24
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-23
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 6e-23
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-21
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 3e-20
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  209 bits (534), Expect = 3e-64
 Identities = 57/118 (48%), Positives = 80/118 (67%), Gaps = 2/118 (1%)

Query: 1   IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGRE 60
           ++++TNIAETS+T+ GI YV+D G  KQK ++P   ++ L V+ IS+A A QR GRAGR 
Sbjct: 372 VVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRT 431

Query: 61  AEGFCYRMYSEEDFR-RMNKNTVPEIQRTNLASTALTLLSLEI-NAATFDFMDKPPKE 116
             G C+R+Y+EE F+  + + + PEI R+NL+ST L L  L I +   FDFMD P  E
Sbjct: 432 RPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPE 489
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 99.63
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.55
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.54
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.52
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.49
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.45
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.4
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.28
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.25
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.24
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.19
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.15
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.05
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.97
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.79
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.73
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.7
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.67
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.64
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.59
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.59
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.57
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.56
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.55
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 98.54
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.54
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.52
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.5
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.5
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.49
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.48
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.47
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.45
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 98.44
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.42
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.4
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 97.76
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 98.36
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.34
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.32
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.28
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 98.27
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.25
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.23
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.21
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.2
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.07
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 98.06
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.03
4gl2_A699 Interferon-induced helicase C domain-containing P; 98.03
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 97.95
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 97.77
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.75
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.74
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.59
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.45
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.35
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.16
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 97.08
3jux_A 822 Protein translocase subunit SECA; protein transloc 96.93
3h1t_A590 Type I site-specific restriction-modification syst 96.93
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 96.21
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.91
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 95.41
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 94.99
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 94.42
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 91.93
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 91.38
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 89.67
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=9.4e-41  Score=313.22  Aligned_cols=117  Identities=49%  Similarity=0.802  Sum_probs=114.1

Q ss_pred             CEEEecccccCCCCCCceEEEeCCeEEEeEEeCCCCceeeeEEEeeHHHHHhhcCcCCccccceEEeecCHHHH-HhccC
Q psy17746          1 IILATNIAETSITVPGIKYVIDSGLVKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEGFCYRMYSEEDF-RRMNK   79 (182)
Q Consensus         1 vilaTniaEtsiti~~v~~VID~G~~k~~~~~~~~~~~~l~~~~isk~~a~qR~graGr~~~G~c~rL~t~~~~-~~l~~   79 (182)
                      ||||||+||+||+||+|++|||+|+.|++.||+..|++.|.+.|+|++++.||+|||||.++|.||+||+++.| +.|.+
T Consensus       372 VlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~  451 (773)
T 2xau_A          372 VVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIE  451 (773)
T ss_dssp             EEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCS
T ss_pred             EEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999 68999


Q ss_pred             CCCChhccCChHHHHHHHHhcCC-CcccccCcCCCcccc
Q psy17746         80 NTVPEIQRTNLASTALTLLSLEI-NAATFDFMDKPPKEI  117 (182)
Q Consensus        80 ~~~PeI~r~~L~~~vL~lk~lg~-~~~~f~~~dpP~~~~  117 (182)
                      +..|||++.+|.+++|+++++|+ ++..|+|+|||++++
T Consensus       452 ~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~~~~~p~~~~  490 (773)
T 2xau_A          452 QSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPET  490 (773)
T ss_dssp             SCCCGGGGSCCHHHHHHHHHTTCCCGGGCCCSSCCCHHH
T ss_pred             cCCCccccCcHHHHHHHHHHcCCCChhhccccCCCcHHH
Confidence            99999999999999999999999 999999999998876
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 6e-25
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-13
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 0.004
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score = 96.2 bits (239), Expect = 6e-25
 Identities = 27/123 (21%), Positives = 41/123 (33%), Gaps = 12/123 (9%)

Query: 1   IILATNIAETSITVPGIKYVIDSGL-VKQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGR 59
            ILAT+IAE    +  ++ V+D     K      G  + +     IS + A QR GR GR
Sbjct: 85  FILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGR 143

Query: 60  EAEG-FCYRMYSEEDFRRMNKNTVPEIQRTN----LASTALTLLSLEIN-AATFDFMDKP 113
                     YSE      ++N    +        L +  +    +              
Sbjct: 144 NPNRDGDSYYYSEP----TSENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPVS 199

Query: 114 PKE 116
           P E
Sbjct: 200 PGE 202
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.86
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.13
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.58
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.53
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 98.31
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.31
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.29
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 98.26
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.26
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.18
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 98.1
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.1
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 98.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.99
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.95
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 97.79
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 97.64
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.87
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 95.69
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 87.59
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 85.25
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 81.6
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=99.86  E-value=5e-23  Score=172.36  Aligned_cols=112  Identities=24%  Similarity=0.223  Sum_probs=87.2

Q ss_pred             CEEEecccccCCCCCCceEEEeCCeE-EEeEEeCCCCceeeeEEEeeHHHHHhhcCcCCccccc-eEEeecCHHHHHhcc
Q psy17746          1 IILATNIAETSITVPGIKYVIDSGLV-KQKTHHPGTGLDVLQVTSISQAQAWQRTGRAGREAEG-FCYRMYSEEDFRRMN   78 (182)
Q Consensus         1 vilaTniaEtsiti~~v~~VID~G~~-k~~~~~~~~~~~~l~~~~isk~~a~qR~graGr~~~G-~c~rL~t~~~~~~l~   78 (182)
                      |||||||||+|+|| ||+||||+|+. |...||+.+++..+...|||+++|.||+||+||...| .||.+|+..    +.
T Consensus        85 ~~~~t~~~~~~~~~-~~~~vid~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~qr~gr~gr~~~~~~~~~~y~~~----~~  159 (299)
T d1yksa2          85 FILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYYYSEP----TS  159 (299)
T ss_dssp             EEEESSSTTCCTTC-CCSEEEECCEEEEEEEETTTTEEEEEEEEECCHHHHHHHHTTSSCCTTCCCEEEEECSC----CC
T ss_pred             EEEEechhhhceec-CceEEEecCceeceeeecCCCCeeEEeeeecCHHHHHHhcccccccCCCceEEEEeCCC----CC
Confidence            68999999999999 69999999995 8889999999999999999999999999999998554 356666643    23


Q ss_pred             CCCCChhccCC----hHHHHHHHHhcCC-CcccccCcCCCcccc
Q psy17746         79 KNTVPEIQRTN----LASTALTLLSLEI-NAATFDFMDKPPKEI  117 (182)
Q Consensus        79 ~~~~PeI~r~~----L~~~vL~lk~lg~-~~~~f~~~dpP~~~~  117 (182)
                      +...+++.+..    |.++.+.++.+|. +...++++++|+.+.
T Consensus       160 ~d~~~~~~~te~~i~l~~i~l~~~~~g~~~~~e~~~~~~p~g~~  203 (299)
T d1yksa2         160 ENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPVSPGEM  203 (299)
T ss_dssp             CCCTTBHHHHHHHHHHTTSCCGGGCCCCCSTTHHHHSSSCTTTT
T ss_pred             CcccchhhhhhHHHHhhCcccccccccccchhhhccccCCCchh
Confidence            33333333322    2333455677787 788889999988764
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure