Psyllid ID: psy17901


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MVDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIHPSDPVANSHRRRRKKEKKKKEEKKKKKKKKKKKKNKKKKKEKKKKKKKKKKKKKKKKKKKIMRKEEN
ccccccccccccEEEEccEEEEEEcccccEEEccccccccccccccEEEEcccccccccEEEEcccccccccccccccccEEEEEEccccccccccccccccccccEEEEEEccccccccccccccEEEEEEEccccccccEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cEEEEEccccccEEEEcEEEEEEEcccccEEcccEEEcccccccEEEEEEcccccccccEEEEcccccccccccEcccccEEEEEEccccccccccccccccccccEEEEEEccccccccccccccEEEEEEcccccccEEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mvdfkskarnnqyVTCGSVVKLMNVDYRVRLhshdvkygtgsgqqsvtgtevkedvnshwiikaptgktckrgepikcndiIRLTHtttnknlhshhfssplsgAQEVSAYLSATRqtygrpisgqyeivtvswpdhnpvlwktmegifihpsdpvanshrRRRKKEKKKKEEKKKKKKKKKKKKNKKKKKEKKKKKKKKKKKKKKKKKKKIMRKEEN
mvdfkskarnnqyvtcgSVVKLMNVDYRVRLHSHdvkygtgsgqqsvtgtevkedvnshwiikaptgktckrgepikCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIfihpsdpvanshrrrrkkekkkkeekkkkkkkkkkkknkkkkkekkkkkkkkkkkkkkkkkkkimrkeen
MVDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYgtgsgqqsvtgtEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIHPSDPVANSHRRRRkkekkkkeekkkkkkkkkkkknkkkkkekkkkkkkkkkkkkkkkkkkIMRKEEN
***********QYVTCGSVVKLMNVDYRVRLHSHDVKYGTG*******GTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLH*************VSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIH*******************************************************************
*********NNQYVTCGSVVKLMNVDYRVRLH***************TGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIHPSD****************************************************************
MVDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIHPSDP***************************************************************
MVDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIHPS***********K**KKKKEEKKKKKKKKKKKKNKKKKKEKKKKKKKKKKKKKKKKKKKIM*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAYLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFIHPSDPVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q9DCT5211 Stromal cell-derived fact yes N/A 0.669 0.691 0.489 1e-41
Q3SZ45211 Stromal cell-derived fact yes N/A 0.669 0.691 0.478 7e-41
Q99470211 Stromal cell-derived fact yes N/A 0.642 0.663 0.488 2e-40
Q3T083221 Stromal cell-derived fact no N/A 0.665 0.656 0.459 4e-39
Q9HCN8221 Stromal cell-derived fact no N/A 0.665 0.656 0.462 1e-38
Q9ESP1221 Stromal cell-derived fact no N/A 0.669 0.660 0.446 8e-38
Q93ZE8218 Stromal cell-derived fact yes N/A 0.444 0.444 0.504 4e-21
Q54P23212 Stromal cell-derived fact yes N/A 0.449 0.462 0.504 2e-14
Q8BGQ4 820 Protein O-mannosyl-transf no N/A 0.454 0.120 0.366 3e-08
Q9UKY4 750 Protein O-mannosyl-transf no N/A 0.435 0.126 0.345 1e-07
>sp|Q9DCT5|SDF2_MOUSE Stromal cell-derived factor 2 OS=Mus musculus GN=Sdf2 PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (428), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/184 (48%), Positives = 107/184 (58%), Gaps = 38/184 (20%)

Query: 8   ARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTG 67
           A N   VTCGSVVKL+N  + VRLHSHDV+YG+GSGQQSVTG    +D NS+W I+  T 
Sbjct: 18  ASNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTA 77

Query: 68  KTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAY---------------- 111
             C+RG PIKC   IRLTH  T +NLHSHHF+SPLSG QEVSA+                
Sbjct: 78  TVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLC 137

Query: 112 ---------------------LSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIFI 150
                                LS T + YGRPISGQ E+  ++ P  N   WK MEGIF+
Sbjct: 138 NGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNN-YWKAMEGIFM 196

Query: 151 HPSD 154
            PS+
Sbjct: 197 KPSE 200





Mus musculus (taxid: 10090)
>sp|Q3SZ45|SDF2_BOVIN Stromal cell-derived factor 2 OS=Bos taurus GN=SDF2 PE=2 SV=1 Back     alignment and function description
>sp|Q99470|SDF2_HUMAN Stromal cell-derived factor 2 OS=Homo sapiens GN=SDF2 PE=1 SV=2 Back     alignment and function description
>sp|Q3T083|SDF2L_BOVIN Stromal cell-derived factor 2-like protein 1 OS=Bos taurus GN=SDF2L1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCN8|SDF2L_HUMAN Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens GN=SDF2L1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ESP1|SDF2L_MOUSE Stromal cell-derived factor 2-like protein 1 OS=Mus musculus GN=Sdf2l1 PE=2 SV=2 Back     alignment and function description
>sp|Q93ZE8|SDF2_ARATH Stromal cell-derived factor 2-like protein OS=Arabidopsis thaliana GN=At2g25110 PE=1 SV=1 Back     alignment and function description
>sp|Q54P23|SDF2_DICDI Stromal cell-derived factor 2-like protein OS=Dictyostelium discoideum GN=DDB_G0284847 PE=3 SV=1 Back     alignment and function description
>sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
94469092219 probable ER retained protein [Aedes aegy 0.697 0.694 0.554 8e-53
157131338219 mannosyltransferase [Aedes aegypti] gi|1 0.697 0.694 0.554 8e-53
170062742220 probable ER retained protein [Culex quin 0.697 0.690 0.534 5e-52
158301671222 AGAP001749-PA [Anopheles gambiae str. PE 0.724 0.711 0.502 3e-50
91094675221 PREDICTED: similar to AGAP001749-PA [Tri 0.683 0.674 0.545 2e-49
242008388218 Stromal cell-derived factor 2 precursor, 0.669 0.669 0.538 4e-49
240848605221 stromal cell-derived factor 2-like precu 0.688 0.678 0.534 4e-47
156541514220 PREDICTED: stromal cell-derived factor 2 0.669 0.663 0.532 6e-47
289722624218 stromal cell derived factor 2 [Glossina 0.678 0.678 0.513 1e-46
195343619216 GM10645 [Drosophila sechellia] gi|194133 0.674 0.680 0.524 2e-46
>gi|94469092|gb|ABF18395.1| probable ER retained protein [Aedes aegypti] Back     alignment and taxonomy information
 Score =  212 bits (540), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 124/191 (64%), Gaps = 39/191 (20%)

Query: 2   VDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWI 61
           +D    ARNN++VTCG+V+KL N DYRVRLHSHDVKYGTGSGQQSVT TEV+EDVNSHW 
Sbjct: 20  IDSTYAARNNKFVTCGTVLKLFNTDYRVRLHSHDVKYGTGSGQQSVTATEVQEDVNSHWA 79

Query: 62  IKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSA----------- 110
           IKA TGK C+RGEPIKC DIIRL H  TNKNLHSHHF SPLSG QE+SA           
Sbjct: 80  IKAATGKNCERGEPIKCGDIIRLHHLATNKNLHSHHFQSPLSGNQEISAYGDEHGVGDSG 139

Query: 111 ---------------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWK 143
                                      YLS + +T+GRPI+GQ E+V VS P ++   W 
Sbjct: 140 DHWMVVCTGESWQRNSPVKLRHVDTDMYLSVSGRTFGRPINGQMEVVGVSSP-YSGTDWT 198

Query: 144 TMEGIFIHPSD 154
             EG+FIH ++
Sbjct: 199 AAEGLFIHQTE 209




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157131338|ref|XP_001662201.1| mannosyltransferase [Aedes aegypti] gi|108881857|gb|EAT46082.1| AAEL002701-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170062742|ref|XP_001866801.1| probable ER retained protein [Culex quinquefasciatus] gi|167880566|gb|EDS43949.1| probable ER retained protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158301671|ref|XP_321335.3| AGAP001749-PA [Anopheles gambiae str. PEST] gi|157012585|gb|EAA00948.3| AGAP001749-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91094675|ref|XP_967123.1| PREDICTED: similar to AGAP001749-PA [Tribolium castaneum] gi|270016502|gb|EFA12948.1| hypothetical protein TcasGA2_TC005068 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008388|ref|XP_002424988.1| Stromal cell-derived factor 2 precursor, putative [Pediculus humanus corporis] gi|212508617|gb|EEB12250.1| Stromal cell-derived factor 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|240848605|ref|NP_001155690.1| stromal cell-derived factor 2-like precursor [Acyrthosiphon pisum] gi|239799256|dbj|BAH70558.1| ACYPI007065 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|156541514|ref|XP_001600201.1| PREDICTED: stromal cell-derived factor 2-like protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|289722624|gb|ADD18246.1| stromal cell derived factor 2 [Glossina morsitans morsitans] gi|289743659|gb|ADD20577.1| stromal cell derived factor 2 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195343619|ref|XP_002038393.1| GM10645 [Drosophila sechellia] gi|194133414|gb|EDW54930.1| GM10645 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
FB|FBgn0037312216 CG11999 [Drosophila melanogast 0.490 0.495 0.607 5.2e-43
ZFIN|ZDB-GENE-040808-46218 sdf2l1 "stromal cell-derived f 0.467 0.467 0.549 9.3e-38
RGD|1307274211 Sdf2 "stromal cell derived fac 0.477 0.492 0.548 4e-37
MGI|MGI:108019211 Sdf2 "stromal cell derived fac 0.477 0.492 0.548 8.2e-37
UNIPROTKB|J9P9R6211 SDF2 "Uncharacterized protein" 0.477 0.492 0.538 1e-36
UNIPROTKB|Q3SZ45211 SDF2 "Stromal cell-derived fac 0.467 0.483 0.539 2.7e-36
UNIPROTKB|Q99470211 SDF2 "Stromal cell-derived fac 0.449 0.464 0.551 3.5e-36
UNIPROTKB|F1RNB1211 SDF2 "Uncharacterized protein" 0.449 0.464 0.551 5.7e-36
UNIPROTKB|Q3T083221 SDF2L1 "Stromal cell-derived f 0.449 0.443 0.520 1.5e-35
UNIPROTKB|F1RKZ7221 SDF2L1 "Uncharacterized protei 0.449 0.443 0.520 1.5e-35
FB|FBgn0037312 CG11999 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 5.2e-43, Sum P(2) = 5.2e-43
 Identities = 65/107 (60%), Positives = 75/107 (70%)

Query:     5 KSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYXXXXXXXXXXXXEVKEDVNSHWIIKA 64
             +  A  +  VTCGS++KL+N DY  RLHSHDVKY            E KEDVNSHW+IKA
Sbjct:    18 RGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIKA 77

Query:    65 PTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAY 111
              TG+ C+RGEPI C   +RL H +T KNLHSHHFSSPLSG QEVSAY
Sbjct:    78 QTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQEVSAY 124


GO:0016020 "membrane" evidence=IEA
ZFIN|ZDB-GENE-040808-46 sdf2l1 "stromal cell-derived factor 2-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1307274 Sdf2 "stromal cell derived factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:108019 Sdf2 "stromal cell derived factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9R6 SDF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ45 SDF2 "Stromal cell-derived factor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q99470 SDF2 "Stromal cell-derived factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNB1 SDF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T083 SDF2L1 "Stromal cell-derived factor 2-like protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKZ7 SDF2L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3SZ45SDF2_BOVINNo assigned EC number0.47820.66970.6919yesN/A
Q93ZE8SDF2_ARATHNo assigned EC number0.50460.44490.4449yesN/A
Q54P23SDF2_DICDINo assigned EC number0.50490.44950.4622yesN/A
Q9DCT5SDF2_MOUSENo assigned EC number0.48910.66970.6919yesN/A
Q99470SDF2_HUMANNo assigned EC number0.48870.64220.6635yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
COG1928 699 COG1928, PMT1, Dolichyl-phosphate-mannose--protein 5e-15
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-10
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-10
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-10
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 9e-10
smart0047257 smart00472, MIR, Domain in ryanodine and inositol 1e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 5e-09
smart0047257 smart00472, MIR, Domain in ryanodine and inositol 1e-08
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 4e-08
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 5e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-08
pfam02815189 pfam02815, MIR, MIR domain 9e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-07
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 7e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-06
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 3e-06
COG1928 699 COG1928, PMT1, Dolichyl-phosphate-mannose--protein 4e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-06
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 4e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-06
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 5e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 6e-06
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 7e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-05
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-05
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 1e-05
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-05
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 2e-05
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 2e-05
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 3e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 3e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 3e-05
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 3e-05
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 3e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 4e-05
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 4e-05
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 4e-05
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 5e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 6e-05
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 6e-05
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 6e-05
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 6e-05
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 6e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 9e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 9e-05
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 9e-05
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 9e-05
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 9e-05
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 9e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 1e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 1e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 1e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-04
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 1e-04
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 1e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 1e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 2e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 2e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 2e-04
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 2e-04
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 2e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 2e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 2e-04
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 2e-04
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 3e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 3e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 3e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 3e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 4e-04
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 4e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 4e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 4e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 4e-04
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 4e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 4e-04
TIGR02794 346 TIGR02794, tolA_full, TolA protein 4e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 5e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 5e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 5e-04
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 5e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 5e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 6e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 6e-04
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 6e-04
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 6e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 6e-04
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 6e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 6e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 7e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 7e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 7e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 7e-04
PTZ00069300 PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov 7e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 8e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 8e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 9e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 9e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-04
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 9e-04
pfam13166 713 pfam13166, AAA_13, AAA domain 9e-04
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 0.001
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.001
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.001
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.001
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.001
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.001
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.001
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.001
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.001
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.001
COG0810 244 COG0810, TonB, Periplasmic protein TonB, links inn 0.001
PRK07219822 PRK07219, PRK07219, DNA topoisomerase I; Validated 0.001
pfam10278178 pfam10278, Med19, Mediator of RNA pol II transcrip 0.001
pfam05764 238 pfam05764, YL1, YL1 nuclear protein 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.002
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 0.002
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.002
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.002
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.002
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.002
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.002
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 0.002
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 0.002
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.002
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.002
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.002
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.002
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.002
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.002
PTZ00069300 PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov 0.002
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 0.002
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 0.002
pfam11947149 pfam11947, DUF3464, Protein of unknown function (D 0.002
cd09270211 cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni 0.002
pfam09831 177 pfam09831, DUF2058, Uncharacterized protein conser 0.002
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 0.003
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.003
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.003
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.003
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.003
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.003
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.003
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.003
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.003
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.003
COG0810 244 COG0810, TonB, Periplasmic protein TonB, links inn 0.003
pfam05764238 pfam05764, YL1, YL1 nuclear protein 0.003
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 0.003
cd09270211 cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni 0.003
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.003
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 0.003
COG5163591 COG5163, NOP7, Protein required for biogenesis of 0.003
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.004
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.004
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.004
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.004
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 0.004
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.004
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
PTZ00217393 PTZ00217, PTZ00217, flap endonuclease-1; Provision 0.004
>gnl|CDD|224839 COG1928, PMT1, Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 72.9 bits (179), Expect = 5e-15
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query: 31  LHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTN 90
           LHSH+  Y  GS QQ VTG   K D N+ W+I+  + +   + EP+K    +RL H  T 
Sbjct: 320 LHSHNQLYPEGSEQQQVTGYGHK-DANNEWLIE-LSDENATQIEPLKDGQSVRLRHKYTG 377

Query: 91  KNLHSHHFSSPLSGAQ-EVSAY 111
           KNLH H    P+SG Q EVS Y
Sbjct: 378 KNLHFHDVKPPVSGNQYEVSGY 399


Length = 699

>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|197746 smart00472, MIR, Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|197746 smart00472, MIR, Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|217239 pfam02815, MIR, MIR domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|224839 COG1928, PMT1, Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated Back     alignment and domain information
>gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|204792 pfam11947, DUF3464, Protein of unknown function (DUF3464) Back     alignment and domain information
>gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids Back     alignment and domain information
>gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG3358|consensus211 100.0
KOG3359|consensus 723 100.0
COG1928 699 PMT1 Dolichyl-phosphate-mannose--protein O-mannosy 100.0
PF02815190 MIR: MIR domain; InterPro: IPR003608 The MIR domai 99.94
KOG3359|consensus 723 99.88
KOG3358|consensus211 99.86
COG1928 699 PMT1 Dolichyl-phosphate-mannose--protein O-mannosy 99.8
PF02815190 MIR: MIR domain; InterPro: IPR003608 The MIR domai 99.77
smart0047257 MIR Domain in ryanodine and inositol trisphosphate 99.67
smart0047257 MIR Domain in ryanodine and inositol trisphosphate 99.53
PF08709214 Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanod 98.82
PF08709214 Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanod 97.37
PF04601142 DUF569: Protein of unknown function (DUF569); Inte 96.09
KOG3533|consensus 2706 95.22
KOG3533|consensus 2706 95.07
KOG2243|consensus 5019 92.8
PF04601142 DUF569: Protein of unknown function (DUF569); Inte 92.41
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 89.87
KOG2243|consensus 5019 84.41
>KOG3358|consensus Back     alignment and domain information
Probab=100.00  E-value=8.1e-44  Score=298.34  Aligned_cols=141  Identities=65%  Similarity=1.058  Sum_probs=136.9

Q ss_pred             ceeecCCEEEEEecCCCCceeccccCCCCCCCceeEEEEccCCCCCCceEEEcCCCCCCCCCCeeeeCCEEEEEecCCcc
Q psy17901         12 QYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNK   91 (218)
Q Consensus        12 ~~V~~Gs~IrL~H~~Tg~~LHSH~~~yp~gS~qQeVT~y~~~~D~Nd~WiIe~~~~~~~~~~~~V~~gd~IRL~H~~T~~   91 (218)
                      ..|+|||+|+|.|..++..||||+++|++||+||.|||+...+|.|++|+|.+..+..|+.|++|+||+.|||.|+.|++
T Consensus        24 ~~VTcgSvlKlln~~~~~RLHSHDVkYGSgSGQQSVTgv~~~dD~NSyW~Ik~~~~~~c~rG~pikcG~~iRL~H~~Tgk  103 (211)
T KOG3358|consen   24 DVVTCGSVLKLLNTKHKFRLHSHDVKYGSGSGQQSVTGVEGVDDSNSYWRIKPVSGTTCERGDPIKCGQTIRLTHLKTGK  103 (211)
T ss_pred             ceEEhhhhHHhhccccceeeeccccCccCCCCcceeecccccccCcceEEEecCCCCcccCCCccccCCeEEEEEeeccc
Confidence            49999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecCCCCCCCCCceeEE-------------------------------------EEecccccCCCCCCceeEEEeecC
Q psy17901         92 NLHSHHFSSPLSGAQEVSA-------------------------------------YLSATRQTYGRPISGQYEIVTVSW  134 (218)
Q Consensus        92 ~LhSH~~~sPis~qqEVSc-------------------------------------YL~~sg~~~~~~i~gQ~EV~c~~~  134 (218)
                      +||||.+.+|+|++|||||                                     ||+++|.+|++||.||+||+++..
T Consensus       104 nLHSHhf~sPlSgnqEVSafG~dgegDtgD~Wtvic~g~~W~r~~~vrl~Hi~T~~yLs~sg~qygrpi~GQ~EV~G~~~  183 (211)
T KOG3358|consen  104 NLHSHHFTSPLSGNQEVSAFGEDGEGDTGDHWTVICNGKTWKRDARVRLQHIDTSVYLSVSGEQYGRPISGQQEVVGMRS  183 (211)
T ss_pred             chhhcccCCCCCCCeeEEeecccCCCCcccceEEEeCCccccccceEEEEEeccceeEEecccccCCccCCceEEecccC
Confidence            9999999999999999999                                     788999999999999999999999


Q ss_pred             CCCCCcceEEeeeeecCCC
Q psy17901        135 PDHNPVLWKTMEGIFIHPS  153 (218)
Q Consensus       135 ~~d~~t~W~Veegv~~~~~  153 (218)
                      +...+ +|.++||+|++++
T Consensus       184 ~~~~n-~WkaaEGifikp~  201 (211)
T KOG3358|consen  184 PKAGN-IWKAAEGIFIKPS  201 (211)
T ss_pred             CCCCC-ceeeccceEecCc
Confidence            98777 9999999999987



>KOG3359|consensus Back     alignment and domain information
>COG1928 PMT1 Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02815 MIR: MIR domain; InterPro: IPR003608 The MIR domain is named after three of the proteins in which it occurs: protein Mannosyltransferase (2 Back     alignment and domain information
>KOG3359|consensus Back     alignment and domain information
>KOG3358|consensus Back     alignment and domain information
>COG1928 PMT1 Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02815 MIR: MIR domain; InterPro: IPR003608 The MIR domain is named after three of the proteins in which it occurs: protein Mannosyltransferase (2 Back     alignment and domain information
>smart00472 MIR Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases Back     alignment and domain information
>smart00472 MIR Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases Back     alignment and domain information
>PF08709 Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanodine receptor; InterPro: IPR014821 This domain corresponds to the ligand binding region on inositol 1,4,5-trisphosphate receptor, and the N-terminal region of the ryanodine receptor Back     alignment and domain information
>PF08709 Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanodine receptor; InterPro: IPR014821 This domain corresponds to the ligand binding region on inositol 1,4,5-trisphosphate receptor, and the N-terminal region of the ryanodine receptor Back     alignment and domain information
>PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins Back     alignment and domain information
>KOG3533|consensus Back     alignment and domain information
>KOG3533|consensus Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1t9f_A187 Structural Genomics Of Caenorhabditis Elegans: Stru 1e-24
3mal_A199 Crystal Structure Of The Sdf2-Like Protein From Ara 3e-15
>pdb|1T9F|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Structure Of A Protein With Unknown Function Length = 187 Back     alignment and structure

Iteration: 1

Score = 109 bits (273), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 67/181 (37%), Positives = 82/181 (45%), Gaps = 39/181 (21%) Query: 8 ARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYXXXXXXXXXXXXEVKEDVNSHWIIKAPTG 67 + +VTC SV+K +N + RLHSHDVKY + +D+NSHW I Sbjct: 1 GSDEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALN 60 Query: 68 KTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGA-QEVSA---------------- 110 C RG+ IKC D IRL H TT LHSHHF++PLS QEVSA Sbjct: 61 AKCNRGDAIKCGDKIRLKHLTTGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVI 120 Query: 111 ---------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGIF 149 YLS + Q +GRPI GQ E+V WK EGI+ Sbjct: 121 CNGDEWLESEQFKLRHAVTGSYLSLSGQQFGRPIHGQREVVGTDSITGGSA-WKVAEGIY 179 Query: 150 I 150 I Sbjct: 180 I 180
>pdb|3MAL|A Chain A, Crystal Structure Of The Sdf2-Like Protein From Arabidopsis Length = 199 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3mal_A199 Stromal cell-derived factor 2-like protein; trefoi 3e-44
1t9f_A187 Protein 1D10; structural genomics, PSI, protein st 9e-42
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 9e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-07
3uj4_A 604 Inositol 1,4,5-trisphosphate receptor type 1; APO- 9e-07
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 7e-06
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 4e-04
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 1e-05
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 2e-05
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 2e-04
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 2e-04
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 7e-04
3lvh_D205 LCB, clathrin light chain B; SELF assembly, coated 2e-05
3lvh_D205 LCB, clathrin light chain B; SELF assembly, coated 2e-04
3lvh_D205 LCB, clathrin light chain B; SELF assembly, coated 3e-04
3lvh_D205 LCB, clathrin light chain B; SELF assembly, coated 4e-04
3kio_B332 Ribonuclease H2 subunit B; aicardi-goutieres syndr 1e-04
3kio_B332 Ribonuclease H2 subunit B; aicardi-goutieres syndr 1e-04
3kio_B332 Ribonuclease H2 subunit B; aicardi-goutieres syndr 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-04
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 8e-04
>3mal_A Stromal cell-derived factor 2-like protein; trefoil fold, MIR motifs, unfolded protein response, putativ binding protein, plant protein; 1.95A {Arabidopsis thaliana} Length = 199 Back     alignment and structure
 Score =  145 bits (368), Expect = 3e-44
 Identities = 62/187 (33%), Positives = 86/187 (45%), Gaps = 40/187 (21%)

Query: 8   ARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTG 67
            +    +T GS +KLM+   + RLHSHDV YG+GSGQQSVTG     D NS+WI+K   G
Sbjct: 12  GKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPG 71

Query: 68  KTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSA----------------- 110
            T K+G+ +K    IRL H  T K LHSH  +SP+SG  EVS                  
Sbjct: 72  TTEKQGDAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLII 131

Query: 111 ----------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGI 148
                                 YL +  + Y R   GQ E+  +     +  +W   EG+
Sbjct: 132 EGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKAD-NIWLAAEGV 190

Query: 149 FIHPSDP 155
           ++  ++ 
Sbjct: 191 YLPLNES 197


>1t9f_A Protein 1D10; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Caenorhabditis elegans} SCOP: b.42.6.1 Length = 187 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3uj4_A Inositol 1,4,5-trisphosphate receptor type 1; APO-state, suppressor domain, binding core domain, signaling protein; 3.00A {Rattus norvegicus} PDB: 3uj0_A 3t8s_A* Length = 604 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 Back     alignment and structure
>3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 Back     alignment and structure
>3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 Back     alignment and structure
>3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 Back     alignment and structure
>3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 Back     alignment and structure
>3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 Back     alignment and structure
>3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
3mal_A199 Stromal cell-derived factor 2-like protein; trefoi 100.0
1t9f_A187 Protein 1D10; structural genomics, PSI, protein st 100.0
3mal_A199 Stromal cell-derived factor 2-like protein; trefoi 99.93
3uj4_A 604 Inositol 1,4,5-trisphosphate receptor type 1; APO- 99.9
1t9f_A187 Protein 1D10; structural genomics, PSI, protein st 99.9
1n4k_A 381 Inositol 1,4,5-trisphosphate receptor type 1; IP3 99.61
3uj4_A 604 Inositol 1,4,5-trisphosphate receptor type 1; APO- 99.61
2xoa_A 559 Ryanodine receptor 1; metal transport, calcium cha 99.59
2xoa_A 559 Ryanodine receptor 1; metal transport, calcium cha 99.51
3im6_A217 Cardiac Ca2+ release channel; ryanodine receptor 2 98.69
1xzz_A246 Inositol 1,4,5-trisphosphate receptor type 1; IP3 98.62
1n4k_A381 Inositol 1,4,5-trisphosphate receptor type 1; IP3 98.05
1xzz_A246 Inositol 1,4,5-trisphosphate receptor type 1; IP3 93.6
>3mal_A Stromal cell-derived factor 2-like protein; trefoil fold, MIR motifs, unfolded protein response, putativ binding protein, plant protein; 1.95A {Arabidopsis thaliana} SCOP: b.42.6.0 Back     alignment and structure
Probab=100.00  E-value=8.4e-47  Score=321.61  Aligned_cols=148  Identities=41%  Similarity=0.655  Sum_probs=130.2

Q ss_pred             ccCCCceeecCCEEEEEecCCCCceeccccCCCCCCCceeEEEEccCCCCCCceEEEcCCCCCCCCCCeeeeCCEEEEEe
Q psy17901          7 KARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTH   86 (218)
Q Consensus         7 ~~~~~~~V~~Gs~IrL~H~~Tg~~LHSH~~~yp~gS~qQeVT~y~~~~D~Nd~WiIe~~~~~~~~~~~~V~~gd~IRL~H   86 (218)
                      .+.++..|+|||+|+|+|+.|++|||||.+.||.||+|||||||++.+|.||+|+|++..+..+..+++|.+||.|||+|
T Consensus        11 ~~~~~~~V~~Gs~VtL~h~~t~~~LHSH~~~yp~gS~qQqVT~y~~~~D~Nn~W~I~~~~~~~~~~~~~v~~gd~IRL~H   90 (199)
T 3mal_A           11 SGKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPGTTEKQGDAVKSGATIRLQH   90 (199)
T ss_dssp             -----CBCBTTCEEEEEETTTCCEEEEEEEECSSTTCCEEEEEECCSCCGGGCEEEECCTTSSCCTTSBCBTTCEEEEEE
T ss_pred             cCCCCCEEeeCCEEEEEECCCCCcceeCCccCCCCCCCEEEEeeCCCCCCCCEEEEEecCcCCcCCCcEeecCCEEEEEE
Confidence            35788999999999999999999999999999999999999999988889999999988776667789999999999999


Q ss_pred             cCCcceeeecCCCCCCCCCceeEEE---------------------------------------EecccccCCCCCCcee
Q psy17901         87 TTTNKNLHSHHFSSPLSGAQEVSAY---------------------------------------LSATRQTYGRPISGQY  127 (218)
Q Consensus        87 ~~T~~~LhSH~~~sPis~qqEVScY---------------------------------------L~~sg~~~~~~i~gQ~  127 (218)
                      +.|++|||||++++|+|+++|||||                                       |.+++..+|+|+|+|+
T Consensus        91 ~~T~~~LhSH~~~~P~s~~~EVs~~~~~~~~D~~d~W~Vei~~~~~~~~~~~~fRL~H~~T~~yL~sh~~~lp~wg~~Q~  170 (199)
T 3mal_A           91 MKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLIIEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQ  170 (199)
T ss_dssp             TTTCCEEEEEEEECTTTCSEEEEEECBTTBCCGGGCEEEEESSSCCBCBTTCEEEEEETTTCCEEEEEEEECCSSSTTCE
T ss_pred             CCCCCCEeECCcCCCCCCCeEEEEeccCCCCCCCCeEEEEEcCCCCEEEcCCeEEEEECCCCeEEeeCCCCCCCCCCcce
Confidence            9999999999999999999999994                                       4455567899999999


Q ss_pred             EEEeecCCCCCCcceEEeeeeecCCCCc
Q psy17901        128 EIVTVSWPDHNPVLWKTMEGIFIHPSDP  155 (218)
Q Consensus       128 EV~c~~~~~d~~t~W~Veegv~~~~~~~  155 (218)
                      ||+|+...+ .+++|+||||+|+++++.
T Consensus       171 EV~~~~~~~-~~~~W~vee~~~~~~~~~  197 (199)
T 3mal_A          171 EVCGIREKK-ADNIWLAAEGVYLPLNES  197 (199)
T ss_dssp             EEEEESSCC-GGGCEEEEEEECCCCCC-
T ss_pred             EEEeeCCCC-CCCeEEeCccccCCcccc
Confidence            999998654 455999999999998775



>1t9f_A Protein 1D10; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Caenorhabditis elegans} SCOP: b.42.6.1 Back     alignment and structure
>3mal_A Stromal cell-derived factor 2-like protein; trefoil fold, MIR motifs, unfolded protein response, putativ binding protein, plant protein; 1.95A {Arabidopsis thaliana} SCOP: b.42.6.0 Back     alignment and structure
>3uj4_A Inositol 1,4,5-trisphosphate receptor type 1; APO-state, suppressor domain, binding core domain, signaling protein; 3.00A {Rattus norvegicus} PDB: 3uj0_A 3t8s_A* Back     alignment and structure
>1t9f_A Protein 1D10; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Caenorhabditis elegans} SCOP: b.42.6.1 Back     alignment and structure
>1n4k_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3-binding core, calcium channel,protein- ligand complex, B-trefoil fold; HET: I3P; 2.20A {Mus musculus} SCOP: a.118.22.1 b.42.6.1 Back     alignment and structure
>3uj4_A Inositol 1,4,5-trisphosphate receptor type 1; APO-state, suppressor domain, binding core domain, signaling protein; 3.00A {Rattus norvegicus} PDB: 3uj0_A 3t8s_A* Back     alignment and structure
>2xoa_A Ryanodine receptor 1; metal transport, calcium channel, ION channel, membrane PROT malignant hyperthermia, cardiac arrhythmia; 2.50A {Oryctolagus cuniculus} Back     alignment and structure
>2xoa_A Ryanodine receptor 1; metal transport, calcium channel, ION channel, membrane PROT malignant hyperthermia, cardiac arrhythmia; 2.50A {Oryctolagus cuniculus} Back     alignment and structure
>3im6_A Cardiac Ca2+ release channel; ryanodine receptor 2, calcium release channel, ION channel, arrhythmia, CPVT, ARVD2, ARVC2, disease mutation; 1.70A {Mus musculus} PDB: 3im5_A 3im7_A 3qr5_A 3ila_A 3hsm_A Back     alignment and structure
>1xzz_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3 receptor suppressor domain, calcium channe trefoil fold, membrane protein; 1.80A {Mus musculus} PDB: 3jrr_A Back     alignment and structure
>1n4k_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3-binding core, calcium channel,protein- ligand complex, B-trefoil fold; HET: I3P; 2.20A {Mus musculus} SCOP: a.118.22.1 b.42.6.1 Back     alignment and structure
>1xzz_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3 receptor suppressor domain, calcium channe trefoil fold, membrane protein; 1.80A {Mus musculus} PDB: 3jrr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1t9fa_178 b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) 3e-42
>d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans [TaxId: 6239]} Length = 178 Back     information, alignment and structure

class: All beta proteins
fold: beta-Trefoil
superfamily: MIR domain
family: MIR domain
domain: Hypothetical protein R12E2.13 (1D10)
species: Caenorhabditis elegans [TaxId: 6239]
 Score =  138 bits (350), Expect = 3e-42
 Identities = 74/179 (41%), Positives = 89/179 (49%), Gaps = 39/179 (21%)

Query: 8   ARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTG 67
             +  +VTC SV+K +N +   RLHSHDVKYG+GSGQQSVT  +  +D+NSHW I     
Sbjct: 1   GSDEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALN 60

Query: 68  KTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQ-EVSA---------------- 110
             C RG+ IKC D IRL H TT   LHSHHF++PLS    EVSA                
Sbjct: 61  AKCNRGDAIKCGDKIRLKHLTTGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVI 120

Query: 111 ---------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGI 148
                                YLS + Q +GRPI GQ E+V           WK  EGI
Sbjct: 121 CNGDEWLESEQFKLRHAVTGSYLSLSGQQFGRPIHGQREVVGTDSITGG-SAWKVAEGI 178


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1t9fa_178 Hypothetical protein R12E2.13 (1D10) {Caenorhabdit 100.0
d1t9fa_178 Hypothetical protein R12E2.13 (1D10) {Caenorhabdit 99.89
d1n4ka2200 IP3 receptor type 1 binding core, domain 1 {Mouse 98.15
d1n4ka2200 IP3 receptor type 1 binding core, domain 1 {Mouse 97.66
>d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: beta-Trefoil
superfamily: MIR domain
family: MIR domain
domain: Hypothetical protein R12E2.13 (1D10)
species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00  E-value=4e-46  Score=309.01  Aligned_cols=139  Identities=54%  Similarity=0.870  Sum_probs=129.8

Q ss_pred             CCCceeecCCEEEEEecCCCCceeccccCCCCCCCceeEEEEccCCCCCCceEEEcCCCCCCCCCCeeeeCCEEEEEecC
Q psy17901          9 RNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTT   88 (218)
Q Consensus         9 ~~~~~V~~Gs~IrL~H~~Tg~~LHSH~~~yp~gS~qQeVT~y~~~~D~Nd~WiIe~~~~~~~~~~~~V~~gd~IRL~H~~   88 (218)
                      +++++|+|||+|+|+|+.||+|||||++.||.||+|||||||++.+|.|++|+|.+.....+..+.+|++||.|||+|+.
T Consensus         2 ~~~~~V~~Gs~i~l~~~~t~~~LHSH~~~Y~~gS~qQqVT~~~~~~d~Nn~W~I~~~~~~~~~~~~~vk~Gd~IrL~H~~   81 (178)
T d1t9fa_           2 SDEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALNAKCNRGDAIKCGDKIRLKHLT   81 (178)
T ss_dssp             CTTCBCBTTCEEEEEETTTCCEEEEEEEECSSSSCCEEEEEESCSSCGGGCEEEEECTTCCCCTTCBCCTTCEEEEEETT
T ss_pred             CCCCEEEECeEEEEEECCCCCceecCcccCCCCCCCceEEEeCCcccCCCcEEEecCCCCCCCCCcEecCCCEEEEEEcC
Confidence            56889999999999999999999999999999999999999999989899999998877667788999999999999999


Q ss_pred             CcceeeecCCCCCCC-CCceeEE-------------------------------------EEecccccCCCCCCceeEEE
Q psy17901         89 TNKNLHSHHFSSPLS-GAQEVSA-------------------------------------YLSATRQTYGRPISGQYEIV  130 (218)
Q Consensus        89 T~~~LhSH~~~sPis-~qqEVSc-------------------------------------YL~~sg~~~~~~i~gQ~EV~  130 (218)
                      |++|||||++++|++ .++||+|                                     ||++++..||+||++|+||+
T Consensus        82 T~~~L~sh~~~sp~s~~~~eVs~~g~~~~~d~~d~W~Vei~~~~~~~~~~fRL~H~~t~~yL~ss~~~lp~~~~~Q~EV~  161 (178)
T d1t9fa_          82 TGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVICNGDEWLESEQFKLRHAVTGSYLSLSGQQFGRPIHGQREVV  161 (178)
T ss_dssp             TCCEEEEEEEECSSCTTSEEEEEECCTTTCCGGGCEEEECSSSSCBTTSEEEEEETTTCCEEEEEEEECCTTSTTCEEEE
T ss_pred             CCceEecCCcCCCCCccceEEEEeccCCcccccCCEEEEEcCCeecccceEEEEEccCCeEEecCccccCCCCCcceEEE
Confidence            999999999999999 7899999                                     78888889999999999999


Q ss_pred             eecCCCCCCcceEEeeee
Q psy17901        131 TVSWPDHNPVLWKTMEGI  148 (218)
Q Consensus       131 c~~~~~d~~t~W~Veegv  148 (218)
                      |+++.+.+ ++|+||+||
T Consensus       162 ~~~~~~~~-~~W~ve~gi  178 (178)
T d1t9fa_         162 GTDSITGG-SAWKVAEGI  178 (178)
T ss_dssp             EESSCCTT-CCEEEECCC
T ss_pred             ecCCCCCC-CEEEeccCC
Confidence            99988654 599999996



>d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n4ka2 b.42.6.1 (A:236-435) IP3 receptor type 1 binding core, domain 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n4ka2 b.42.6.1 (A:236-435) IP3 receptor type 1 binding core, domain 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure