Psyllid ID: psy17901
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 218 | ||||||
| 94469092 | 219 | probable ER retained protein [Aedes aegy | 0.697 | 0.694 | 0.554 | 8e-53 | |
| 157131338 | 219 | mannosyltransferase [Aedes aegypti] gi|1 | 0.697 | 0.694 | 0.554 | 8e-53 | |
| 170062742 | 220 | probable ER retained protein [Culex quin | 0.697 | 0.690 | 0.534 | 5e-52 | |
| 158301671 | 222 | AGAP001749-PA [Anopheles gambiae str. PE | 0.724 | 0.711 | 0.502 | 3e-50 | |
| 91094675 | 221 | PREDICTED: similar to AGAP001749-PA [Tri | 0.683 | 0.674 | 0.545 | 2e-49 | |
| 242008388 | 218 | Stromal cell-derived factor 2 precursor, | 0.669 | 0.669 | 0.538 | 4e-49 | |
| 240848605 | 221 | stromal cell-derived factor 2-like precu | 0.688 | 0.678 | 0.534 | 4e-47 | |
| 156541514 | 220 | PREDICTED: stromal cell-derived factor 2 | 0.669 | 0.663 | 0.532 | 6e-47 | |
| 289722624 | 218 | stromal cell derived factor 2 [Glossina | 0.678 | 0.678 | 0.513 | 1e-46 | |
| 195343619 | 216 | GM10645 [Drosophila sechellia] gi|194133 | 0.674 | 0.680 | 0.524 | 2e-46 |
| >gi|94469092|gb|ABF18395.1| probable ER retained protein [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 212 bits (540), Expect = 8e-53, Method: Compositional matrix adjust.
Identities = 106/191 (55%), Positives = 124/191 (64%), Gaps = 39/191 (20%)
Query: 2 VDFKSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWI 61
+D ARNN++VTCG+V+KL N DYRVRLHSHDVKYGTGSGQQSVT TEV+EDVNSHW
Sbjct: 20 IDSTYAARNNKFVTCGTVLKLFNTDYRVRLHSHDVKYGTGSGQQSVTATEVQEDVNSHWA 79
Query: 62 IKAPTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSA----------- 110
IKA TGK C+RGEPIKC DIIRL H TNKNLHSHHF SPLSG QE+SA
Sbjct: 80 IKAATGKNCERGEPIKCGDIIRLHHLATNKNLHSHHFQSPLSGNQEISAYGDEHGVGDSG 139
Query: 111 ---------------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWK 143
YLS + +T+GRPI+GQ E+V VS P ++ W
Sbjct: 140 DHWMVVCTGESWQRNSPVKLRHVDTDMYLSVSGRTFGRPINGQMEVVGVSSP-YSGTDWT 198
Query: 144 TMEGIFIHPSD 154
EG+FIH ++
Sbjct: 199 AAEGLFIHQTE 209
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157131338|ref|XP_001662201.1| mannosyltransferase [Aedes aegypti] gi|108881857|gb|EAT46082.1| AAEL002701-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170062742|ref|XP_001866801.1| probable ER retained protein [Culex quinquefasciatus] gi|167880566|gb|EDS43949.1| probable ER retained protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|158301671|ref|XP_321335.3| AGAP001749-PA [Anopheles gambiae str. PEST] gi|157012585|gb|EAA00948.3| AGAP001749-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|91094675|ref|XP_967123.1| PREDICTED: similar to AGAP001749-PA [Tribolium castaneum] gi|270016502|gb|EFA12948.1| hypothetical protein TcasGA2_TC005068 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242008388|ref|XP_002424988.1| Stromal cell-derived factor 2 precursor, putative [Pediculus humanus corporis] gi|212508617|gb|EEB12250.1| Stromal cell-derived factor 2 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|240848605|ref|NP_001155690.1| stromal cell-derived factor 2-like precursor [Acyrthosiphon pisum] gi|239799256|dbj|BAH70558.1| ACYPI007065 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|156541514|ref|XP_001600201.1| PREDICTED: stromal cell-derived factor 2-like protein 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|289722624|gb|ADD18246.1| stromal cell derived factor 2 [Glossina morsitans morsitans] gi|289743659|gb|ADD20577.1| stromal cell derived factor 2 [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|195343619|ref|XP_002038393.1| GM10645 [Drosophila sechellia] gi|194133414|gb|EDW54930.1| GM10645 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 218 | ||||||
| FB|FBgn0037312 | 216 | CG11999 [Drosophila melanogast | 0.490 | 0.495 | 0.607 | 5.2e-43 | |
| ZFIN|ZDB-GENE-040808-46 | 218 | sdf2l1 "stromal cell-derived f | 0.467 | 0.467 | 0.549 | 9.3e-38 | |
| RGD|1307274 | 211 | Sdf2 "stromal cell derived fac | 0.477 | 0.492 | 0.548 | 4e-37 | |
| MGI|MGI:108019 | 211 | Sdf2 "stromal cell derived fac | 0.477 | 0.492 | 0.548 | 8.2e-37 | |
| UNIPROTKB|J9P9R6 | 211 | SDF2 "Uncharacterized protein" | 0.477 | 0.492 | 0.538 | 1e-36 | |
| UNIPROTKB|Q3SZ45 | 211 | SDF2 "Stromal cell-derived fac | 0.467 | 0.483 | 0.539 | 2.7e-36 | |
| UNIPROTKB|Q99470 | 211 | SDF2 "Stromal cell-derived fac | 0.449 | 0.464 | 0.551 | 3.5e-36 | |
| UNIPROTKB|F1RNB1 | 211 | SDF2 "Uncharacterized protein" | 0.449 | 0.464 | 0.551 | 5.7e-36 | |
| UNIPROTKB|Q3T083 | 221 | SDF2L1 "Stromal cell-derived f | 0.449 | 0.443 | 0.520 | 1.5e-35 | |
| UNIPROTKB|F1RKZ7 | 221 | SDF2L1 "Uncharacterized protei | 0.449 | 0.443 | 0.520 | 1.5e-35 |
| FB|FBgn0037312 CG11999 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 357 (130.7 bits), Expect = 5.2e-43, Sum P(2) = 5.2e-43
Identities = 65/107 (60%), Positives = 75/107 (70%)
Query: 5 KSKARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYXXXXXXXXXXXXEVKEDVNSHWIIKA 64
+ A + VTCGS++KL+N DY RLHSHDVKY E KEDVNSHW+IKA
Sbjct: 18 RGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIKA 77
Query: 65 PTGKTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSAY 111
TG+ C+RGEPI C +RL H +T KNLHSHHFSSPLSG QEVSAY
Sbjct: 78 QTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQEVSAY 124
|
|
| ZFIN|ZDB-GENE-040808-46 sdf2l1 "stromal cell-derived factor 2-like 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1307274 Sdf2 "stromal cell derived factor 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:108019 Sdf2 "stromal cell derived factor 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P9R6 SDF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZ45 SDF2 "Stromal cell-derived factor 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99470 SDF2 "Stromal cell-derived factor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RNB1 SDF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T083 SDF2L1 "Stromal cell-derived factor 2-like protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKZ7 SDF2L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 218 | |||
| COG1928 | 699 | COG1928, PMT1, Dolichyl-phosphate-mannose--protein | 5e-15 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-10 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-10 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 8e-10 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 9e-10 | |
| smart00472 | 57 | smart00472, MIR, Domain in ryanodine and inositol | 1e-09 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-09 | |
| smart00472 | 57 | smart00472, MIR, Domain in ryanodine and inositol | 1e-08 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 4e-08 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 5e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 7e-08 | |
| pfam02815 | 189 | pfam02815, MIR, MIR domain | 9e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-07 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-07 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-07 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 7e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-06 | |
| COG1928 | 699 | COG1928, PMT1, Dolichyl-phosphate-mannose--protein | 4e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-06 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 4e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-06 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 5e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 6e-06 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 7e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-05 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-05 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 2e-05 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-05 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 2e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-05 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 3e-05 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 3e-05 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 3e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 3e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-05 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 4e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-05 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 4e-05 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 5e-05 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 6e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 6e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 6e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 6e-05 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 6e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-05 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 9e-05 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 9e-05 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 9e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 9e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 1e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 1e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 1e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 1e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 1e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 1e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 2e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 2e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 2e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 2e-04 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-04 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 2e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 3e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 3e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 3e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 4e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 4e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 4e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-04 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 4e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 5e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 5e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 5e-04 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 5e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 6e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 6e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 6e-04 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 6e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-04 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 6e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 7e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 7e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 7e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 7e-04 | |
| PTZ00069 | 300 | PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov | 7e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 8e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 9e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 9e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-04 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 9e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 9e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 0.001 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.001 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.001 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.001 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.001 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.001 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.001 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.001 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 0.001 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.002 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.002 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.002 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.002 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.002 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.002 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.002 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.002 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.002 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.002 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.002 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.002 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.002 | |
| PTZ00069 | 300 | PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov | 0.002 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.002 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.002 | |
| pfam11947 | 149 | pfam11947, DUF3464, Protein of unknown function (D | 0.002 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 0.002 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 0.002 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.003 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 0.003 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.003 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.003 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.003 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.003 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.003 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 0.003 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.003 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.003 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 0.003 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.004 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.004 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.004 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.004 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.004 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 0.004 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.004 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 0.004 |
| >gnl|CDD|224839 COG1928, PMT1, Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 72.9 bits (179), Expect = 5e-15
Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
Query: 31 LHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTN 90
LHSH+ Y GS QQ VTG K D N+ W+I+ + + + EP+K +RL H T
Sbjct: 320 LHSHNQLYPEGSEQQQVTGYGHK-DANNEWLIE-LSDENATQIEPLKDGQSVRLRHKYTG 377
Query: 91 KNLHSHHFSSPLSGAQ-EVSAY 111
KNLH H P+SG Q EVS Y
Sbjct: 378 KNLHFHDVKPPVSGNQYEVSGY 399
|
Length = 699 |
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197746 smart00472, MIR, Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197746 smart00472, MIR, Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217239 pfam02815, MIR, MIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|224839 COG1928, PMT1, Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|204792 pfam11947, DUF3464, Protein of unknown function (DUF3464) | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 218 | |||
| KOG3358|consensus | 211 | 100.0 | ||
| KOG3359|consensus | 723 | 100.0 | ||
| COG1928 | 699 | PMT1 Dolichyl-phosphate-mannose--protein O-mannosy | 100.0 | |
| PF02815 | 190 | MIR: MIR domain; InterPro: IPR003608 The MIR domai | 99.94 | |
| KOG3359|consensus | 723 | 99.88 | ||
| KOG3358|consensus | 211 | 99.86 | ||
| COG1928 | 699 | PMT1 Dolichyl-phosphate-mannose--protein O-mannosy | 99.8 | |
| PF02815 | 190 | MIR: MIR domain; InterPro: IPR003608 The MIR domai | 99.77 | |
| smart00472 | 57 | MIR Domain in ryanodine and inositol trisphosphate | 99.67 | |
| smart00472 | 57 | MIR Domain in ryanodine and inositol trisphosphate | 99.53 | |
| PF08709 | 214 | Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanod | 98.82 | |
| PF08709 | 214 | Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanod | 97.37 | |
| PF04601 | 142 | DUF569: Protein of unknown function (DUF569); Inte | 96.09 | |
| KOG3533|consensus | 2706 | 95.22 | ||
| KOG3533|consensus | 2706 | 95.07 | ||
| KOG2243|consensus | 5019 | 92.8 | ||
| PF04601 | 142 | DUF569: Protein of unknown function (DUF569); Inte | 92.41 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 89.87 | |
| KOG2243|consensus | 5019 | 84.41 |
| >KOG3358|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.1e-44 Score=298.34 Aligned_cols=141 Identities=65% Similarity=1.058 Sum_probs=136.9
Q ss_pred ceeecCCEEEEEecCCCCceeccccCCCCCCCceeEEEEccCCCCCCceEEEcCCCCCCCCCCeeeeCCEEEEEecCCcc
Q psy17901 12 QYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTTTNK 91 (218)
Q Consensus 12 ~~V~~Gs~IrL~H~~Tg~~LHSH~~~yp~gS~qQeVT~y~~~~D~Nd~WiIe~~~~~~~~~~~~V~~gd~IRL~H~~T~~ 91 (218)
..|+|||+|+|.|..++..||||+++|++||+||.|||+...+|.|++|+|.+..+..|+.|++|+||+.|||.|+.|++
T Consensus 24 ~~VTcgSvlKlln~~~~~RLHSHDVkYGSgSGQQSVTgv~~~dD~NSyW~Ik~~~~~~c~rG~pikcG~~iRL~H~~Tgk 103 (211)
T KOG3358|consen 24 DVVTCGSVLKLLNTKHKFRLHSHDVKYGSGSGQQSVTGVEGVDDSNSYWRIKPVSGTTCERGDPIKCGQTIRLTHLKTGK 103 (211)
T ss_pred ceEEhhhhHHhhccccceeeeccccCccCCCCcceeecccccccCcceEEEecCCCCcccCCCccccCCeEEEEEeeccc
Confidence 49999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeecCCCCCCCCCceeEE-------------------------------------EEecccccCCCCCCceeEEEeecC
Q psy17901 92 NLHSHHFSSPLSGAQEVSA-------------------------------------YLSATRQTYGRPISGQYEIVTVSW 134 (218)
Q Consensus 92 ~LhSH~~~sPis~qqEVSc-------------------------------------YL~~sg~~~~~~i~gQ~EV~c~~~ 134 (218)
+||||.+.+|+|++||||| ||+++|.+|++||.||+||+++..
T Consensus 104 nLHSHhf~sPlSgnqEVSafG~dgegDtgD~Wtvic~g~~W~r~~~vrl~Hi~T~~yLs~sg~qygrpi~GQ~EV~G~~~ 183 (211)
T KOG3358|consen 104 NLHSHHFTSPLSGNQEVSAFGEDGEGDTGDHWTVICNGKTWKRDARVRLQHIDTSVYLSVSGEQYGRPISGQQEVVGMRS 183 (211)
T ss_pred chhhcccCCCCCCCeeEEeecccCCCCcccceEEEeCCccccccceEEEEEeccceeEEecccccCCccCCceEEecccC
Confidence 9999999999999999999 788999999999999999999999
Q ss_pred CCCCCcceEEeeeeecCCC
Q psy17901 135 PDHNPVLWKTMEGIFIHPS 153 (218)
Q Consensus 135 ~~d~~t~W~Veegv~~~~~ 153 (218)
+...+ +|.++||+|++++
T Consensus 184 ~~~~n-~WkaaEGifikp~ 201 (211)
T KOG3358|consen 184 PKAGN-IWKAAEGIFIKPS 201 (211)
T ss_pred CCCCC-ceeeccceEecCc
Confidence 98777 9999999999987
|
|
| >KOG3359|consensus | Back alignment and domain information |
|---|
| >COG1928 PMT1 Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02815 MIR: MIR domain; InterPro: IPR003608 The MIR domain is named after three of the proteins in which it occurs: protein Mannosyltransferase (2 | Back alignment and domain information |
|---|
| >KOG3359|consensus | Back alignment and domain information |
|---|
| >KOG3358|consensus | Back alignment and domain information |
|---|
| >COG1928 PMT1 Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02815 MIR: MIR domain; InterPro: IPR003608 The MIR domain is named after three of the proteins in which it occurs: protein Mannosyltransferase (2 | Back alignment and domain information |
|---|
| >smart00472 MIR Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases | Back alignment and domain information |
|---|
| >smart00472 MIR Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases | Back alignment and domain information |
|---|
| >PF08709 Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanodine receptor; InterPro: IPR014821 This domain corresponds to the ligand binding region on inositol 1,4,5-trisphosphate receptor, and the N-terminal region of the ryanodine receptor | Back alignment and domain information |
|---|
| >PF08709 Ins145_P3_rec: Inositol 1,4,5-trisphosphate/ryanodine receptor; InterPro: IPR014821 This domain corresponds to the ligand binding region on inositol 1,4,5-trisphosphate receptor, and the N-terminal region of the ryanodine receptor | Back alignment and domain information |
|---|
| >PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins | Back alignment and domain information |
|---|
| >KOG3533|consensus | Back alignment and domain information |
|---|
| >KOG3533|consensus | Back alignment and domain information |
|---|
| >KOG2243|consensus | Back alignment and domain information |
|---|
| >PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >KOG2243|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 218 | ||||
| 1t9f_A | 187 | Structural Genomics Of Caenorhabditis Elegans: Stru | 1e-24 | ||
| 3mal_A | 199 | Crystal Structure Of The Sdf2-Like Protein From Ara | 3e-15 |
| >pdb|1T9F|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Structure Of A Protein With Unknown Function Length = 187 | Back alignment and structure |
|
| >pdb|3MAL|A Chain A, Crystal Structure Of The Sdf2-Like Protein From Arabidopsis Length = 199 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 218 | |||
| 3mal_A | 199 | Stromal cell-derived factor 2-like protein; trefoi | 3e-44 | |
| 1t9f_A | 187 | Protein 1D10; structural genomics, PSI, protein st | 9e-42 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 9e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-07 | |
| 3uj4_A | 604 | Inositol 1,4,5-trisphosphate receptor type 1; APO- | 9e-07 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 7e-06 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 4e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 1e-05 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 2e-05 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 2e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 2e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 7e-04 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 2e-05 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 2e-04 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 3e-04 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 4e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 1e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 1e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-04 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 8e-04 |
| >3mal_A Stromal cell-derived factor 2-like protein; trefoil fold, MIR motifs, unfolded protein response, putativ binding protein, plant protein; 1.95A {Arabidopsis thaliana} Length = 199 | Back alignment and structure |
|---|
Score = 145 bits (368), Expect = 3e-44
Identities = 62/187 (33%), Positives = 86/187 (45%), Gaps = 40/187 (21%)
Query: 8 ARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTG 67
+ +T GS +KLM+ + RLHSHDV YG+GSGQQSVTG D NS+WI+K G
Sbjct: 12 GKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPG 71
Query: 68 KTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQEVSA----------------- 110
T K+G+ +K IRL H T K LHSH +SP+SG EVS
Sbjct: 72 TTEKQGDAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLII 131
Query: 111 ----------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGI 148
YL + + Y R GQ E+ + + +W EG+
Sbjct: 132 EGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKAD-NIWLAAEGV 190
Query: 149 FIHPSDP 155
++ ++
Sbjct: 191 YLPLNES 197
|
| >1t9f_A Protein 1D10; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Caenorhabditis elegans} SCOP: b.42.6.1 Length = 187 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3uj4_A Inositol 1,4,5-trisphosphate receptor type 1; APO-state, suppressor domain, binding core domain, signaling protein; 3.00A {Rattus norvegicus} PDB: 3uj0_A 3t8s_A* Length = 604 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 218 | |||
| 3mal_A | 199 | Stromal cell-derived factor 2-like protein; trefoi | 100.0 | |
| 1t9f_A | 187 | Protein 1D10; structural genomics, PSI, protein st | 100.0 | |
| 3mal_A | 199 | Stromal cell-derived factor 2-like protein; trefoi | 99.93 | |
| 3uj4_A | 604 | Inositol 1,4,5-trisphosphate receptor type 1; APO- | 99.9 | |
| 1t9f_A | 187 | Protein 1D10; structural genomics, PSI, protein st | 99.9 | |
| 1n4k_A | 381 | Inositol 1,4,5-trisphosphate receptor type 1; IP3 | 99.61 | |
| 3uj4_A | 604 | Inositol 1,4,5-trisphosphate receptor type 1; APO- | 99.61 | |
| 2xoa_A | 559 | Ryanodine receptor 1; metal transport, calcium cha | 99.59 | |
| 2xoa_A | 559 | Ryanodine receptor 1; metal transport, calcium cha | 99.51 | |
| 3im6_A | 217 | Cardiac Ca2+ release channel; ryanodine receptor 2 | 98.69 | |
| 1xzz_A | 246 | Inositol 1,4,5-trisphosphate receptor type 1; IP3 | 98.62 | |
| 1n4k_A | 381 | Inositol 1,4,5-trisphosphate receptor type 1; IP3 | 98.05 | |
| 1xzz_A | 246 | Inositol 1,4,5-trisphosphate receptor type 1; IP3 | 93.6 |
| >3mal_A Stromal cell-derived factor 2-like protein; trefoil fold, MIR motifs, unfolded protein response, putativ binding protein, plant protein; 1.95A {Arabidopsis thaliana} SCOP: b.42.6.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=8.4e-47 Score=321.61 Aligned_cols=148 Identities=41% Similarity=0.655 Sum_probs=130.2
Q ss_pred ccCCCceeecCCEEEEEecCCCCceeccccCCCCCCCceeEEEEccCCCCCCceEEEcCCCCCCCCCCeeeeCCEEEEEe
Q psy17901 7 KARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTH 86 (218)
Q Consensus 7 ~~~~~~~V~~Gs~IrL~H~~Tg~~LHSH~~~yp~gS~qQeVT~y~~~~D~Nd~WiIe~~~~~~~~~~~~V~~gd~IRL~H 86 (218)
.+.++..|+|||+|+|+|+.|++|||||.+.||.||+|||||||++.+|.||+|+|++..+..+..+++|.+||.|||+|
T Consensus 11 ~~~~~~~V~~Gs~VtL~h~~t~~~LHSH~~~yp~gS~qQqVT~y~~~~D~Nn~W~I~~~~~~~~~~~~~v~~gd~IRL~H 90 (199)
T 3mal_A 11 SGKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPGTTEKQGDAVKSGATIRLQH 90 (199)
T ss_dssp -----CBCBTTCEEEEEETTTCCEEEEEEEECSSTTCCEEEEEECCSCCGGGCEEEECCTTSSCCTTSBCBTTCEEEEEE
T ss_pred cCCCCCEEeeCCEEEEEECCCCCcceeCCccCCCCCCCEEEEeeCCCCCCCCEEEEEecCcCCcCCCcEeecCCEEEEEE
Confidence 35788999999999999999999999999999999999999999988889999999988776667789999999999999
Q ss_pred cCCcceeeecCCCCCCCCCceeEEE---------------------------------------EecccccCCCCCCcee
Q psy17901 87 TTTNKNLHSHHFSSPLSGAQEVSAY---------------------------------------LSATRQTYGRPISGQY 127 (218)
Q Consensus 87 ~~T~~~LhSH~~~sPis~qqEVScY---------------------------------------L~~sg~~~~~~i~gQ~ 127 (218)
+.|++|||||++++|+|+++||||| |.+++..+|+|+|+|+
T Consensus 91 ~~T~~~LhSH~~~~P~s~~~EVs~~~~~~~~D~~d~W~Vei~~~~~~~~~~~~fRL~H~~T~~yL~sh~~~lp~wg~~Q~ 170 (199)
T 3mal_A 91 MKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLIIEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQ 170 (199)
T ss_dssp TTTCCEEEEEEEECTTTCSEEEEEECBTTBCCGGGCEEEEESSSCCBCBTTCEEEEEETTTCCEEEEEEEECCSSSTTCE
T ss_pred CCCCCCEeECCcCCCCCCCeEEEEeccCCCCCCCCeEEEEEcCCCCEEEcCCeEEEEECCCCeEEeeCCCCCCCCCCcce
Confidence 9999999999999999999999994 4455567899999999
Q ss_pred EEEeecCCCCCCcceEEeeeeecCCCCc
Q psy17901 128 EIVTVSWPDHNPVLWKTMEGIFIHPSDP 155 (218)
Q Consensus 128 EV~c~~~~~d~~t~W~Veegv~~~~~~~ 155 (218)
||+|+...+ .+++|+||||+|+++++.
T Consensus 171 EV~~~~~~~-~~~~W~vee~~~~~~~~~ 197 (199)
T 3mal_A 171 EVCGIREKK-ADNIWLAAEGVYLPLNES 197 (199)
T ss_dssp EEEEESSCC-GGGCEEEEEEECCCCCC-
T ss_pred EEEeeCCCC-CCCeEEeCccccCCcccc
Confidence 999998654 455999999999998775
|
| >1t9f_A Protein 1D10; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Caenorhabditis elegans} SCOP: b.42.6.1 | Back alignment and structure |
|---|
| >3mal_A Stromal cell-derived factor 2-like protein; trefoil fold, MIR motifs, unfolded protein response, putativ binding protein, plant protein; 1.95A {Arabidopsis thaliana} SCOP: b.42.6.0 | Back alignment and structure |
|---|
| >3uj4_A Inositol 1,4,5-trisphosphate receptor type 1; APO-state, suppressor domain, binding core domain, signaling protein; 3.00A {Rattus norvegicus} PDB: 3uj0_A 3t8s_A* | Back alignment and structure |
|---|
| >1t9f_A Protein 1D10; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Caenorhabditis elegans} SCOP: b.42.6.1 | Back alignment and structure |
|---|
| >1n4k_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3-binding core, calcium channel,protein- ligand complex, B-trefoil fold; HET: I3P; 2.20A {Mus musculus} SCOP: a.118.22.1 b.42.6.1 | Back alignment and structure |
|---|
| >3uj4_A Inositol 1,4,5-trisphosphate receptor type 1; APO-state, suppressor domain, binding core domain, signaling protein; 3.00A {Rattus norvegicus} PDB: 3uj0_A 3t8s_A* | Back alignment and structure |
|---|
| >2xoa_A Ryanodine receptor 1; metal transport, calcium channel, ION channel, membrane PROT malignant hyperthermia, cardiac arrhythmia; 2.50A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2xoa_A Ryanodine receptor 1; metal transport, calcium channel, ION channel, membrane PROT malignant hyperthermia, cardiac arrhythmia; 2.50A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3im6_A Cardiac Ca2+ release channel; ryanodine receptor 2, calcium release channel, ION channel, arrhythmia, CPVT, ARVD2, ARVC2, disease mutation; 1.70A {Mus musculus} PDB: 3im5_A 3im7_A 3qr5_A 3ila_A 3hsm_A | Back alignment and structure |
|---|
| >1xzz_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3 receptor suppressor domain, calcium channe trefoil fold, membrane protein; 1.80A {Mus musculus} PDB: 3jrr_A | Back alignment and structure |
|---|
| >1n4k_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3-binding core, calcium channel,protein- ligand complex, B-trefoil fold; HET: I3P; 2.20A {Mus musculus} SCOP: a.118.22.1 b.42.6.1 | Back alignment and structure |
|---|
| >1xzz_A Inositol 1,4,5-trisphosphate receptor type 1; IP3 receptor, IP3 receptor suppressor domain, calcium channe trefoil fold, membrane protein; 1.80A {Mus musculus} PDB: 3jrr_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 218 | ||||
| d1t9fa_ | 178 | b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) | 3e-42 |
| >d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans [TaxId: 6239]} Length = 178 | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Trefoil superfamily: MIR domain family: MIR domain domain: Hypothetical protein R12E2.13 (1D10) species: Caenorhabditis elegans [TaxId: 6239]
Score = 138 bits (350), Expect = 3e-42
Identities = 74/179 (41%), Positives = 89/179 (49%), Gaps = 39/179 (21%)
Query: 8 ARNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTG 67
+ +VTC SV+K +N + RLHSHDVKYG+GSGQQSVT + +D+NSHW I
Sbjct: 1 GSDEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALN 60
Query: 68 KTCKRGEPIKCNDIIRLTHTTTNKNLHSHHFSSPLSGAQ-EVSA---------------- 110
C RG+ IKC D IRL H TT LHSHHF++PLS EVSA
Sbjct: 61 AKCNRGDAIKCGDKIRLKHLTTGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVI 120
Query: 111 ---------------------YLSATRQTYGRPISGQYEIVTVSWPDHNPVLWKTMEGI 148
YLS + Q +GRPI GQ E+V WK EGI
Sbjct: 121 CNGDEWLESEQFKLRHAVTGSYLSLSGQQFGRPIHGQREVVGTDSITGG-SAWKVAEGI 178
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 218 | |||
| d1t9fa_ | 178 | Hypothetical protein R12E2.13 (1D10) {Caenorhabdit | 100.0 | |
| d1t9fa_ | 178 | Hypothetical protein R12E2.13 (1D10) {Caenorhabdit | 99.89 | |
| d1n4ka2 | 200 | IP3 receptor type 1 binding core, domain 1 {Mouse | 98.15 | |
| d1n4ka2 | 200 | IP3 receptor type 1 binding core, domain 1 {Mouse | 97.66 |
| >d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Trefoil superfamily: MIR domain family: MIR domain domain: Hypothetical protein R12E2.13 (1D10) species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=4e-46 Score=309.01 Aligned_cols=139 Identities=54% Similarity=0.870 Sum_probs=129.8
Q ss_pred CCCceeecCCEEEEEecCCCCceeccccCCCCCCCceeEEEEccCCCCCCceEEEcCCCCCCCCCCeeeeCCEEEEEecC
Q psy17901 9 RNNQYVTCGSVVKLMNVDYRVRLHSHDVKYGTGSGQQSVTGTEVKEDVNSHWIIKAPTGKTCKRGEPIKCNDIIRLTHTT 88 (218)
Q Consensus 9 ~~~~~V~~Gs~IrL~H~~Tg~~LHSH~~~yp~gS~qQeVT~y~~~~D~Nd~WiIe~~~~~~~~~~~~V~~gd~IRL~H~~ 88 (218)
+++++|+|||+|+|+|+.||+|||||++.||.||+|||||||++.+|.|++|+|.+.....+..+.+|++||.|||+|+.
T Consensus 2 ~~~~~V~~Gs~i~l~~~~t~~~LHSH~~~Y~~gS~qQqVT~~~~~~d~Nn~W~I~~~~~~~~~~~~~vk~Gd~IrL~H~~ 81 (178)
T d1t9fa_ 2 SDEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALNAKCNRGDAIKCGDKIRLKHLT 81 (178)
T ss_dssp CTTCBCBTTCEEEEEETTTCCEEEEEEEECSSSSCCEEEEEESCSSCGGGCEEEEECTTCCCCTTCBCCTTCEEEEEETT
T ss_pred CCCCEEEECeEEEEEECCCCCceecCcccCCCCCCCceEEEeCCcccCCCcEEEecCCCCCCCCCcEecCCCEEEEEEcC
Confidence 56889999999999999999999999999999999999999999989899999998877667788999999999999999
Q ss_pred CcceeeecCCCCCCC-CCceeEE-------------------------------------EEecccccCCCCCCceeEEE
Q psy17901 89 TNKNLHSHHFSSPLS-GAQEVSA-------------------------------------YLSATRQTYGRPISGQYEIV 130 (218)
Q Consensus 89 T~~~LhSH~~~sPis-~qqEVSc-------------------------------------YL~~sg~~~~~~i~gQ~EV~ 130 (218)
|++|||||++++|++ .++||+| ||++++..||+||++|+||+
T Consensus 82 T~~~L~sh~~~sp~s~~~~eVs~~g~~~~~d~~d~W~Vei~~~~~~~~~~fRL~H~~t~~yL~ss~~~lp~~~~~Q~EV~ 161 (178)
T d1t9fa_ 82 TGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVICNGDEWLESEQFKLRHAVTGSYLSLSGQQFGRPIHGQREVV 161 (178)
T ss_dssp TCCEEEEEEEECSSCTTSEEEEEECCTTTCCGGGCEEEECSSSSCBTTSEEEEEETTTCCEEEEEEEECCTTSTTCEEEE
T ss_pred CCceEecCCcCCCCCccceEEEEeccCCcccccCCEEEEEcCCeecccceEEEEEccCCeEEecCccccCCCCCcceEEE
Confidence 999999999999999 7899999 78888889999999999999
Q ss_pred eecCCCCCCcceEEeeee
Q psy17901 131 TVSWPDHNPVLWKTMEGI 148 (218)
Q Consensus 131 c~~~~~d~~t~W~Veegv 148 (218)
|+++.+.+ ++|+||+||
T Consensus 162 ~~~~~~~~-~~W~ve~gi 178 (178)
T d1t9fa_ 162 GTDSITGG-SAWKVAEGI 178 (178)
T ss_dssp EESSCCTT-CCEEEECCC
T ss_pred ecCCCCCC-CEEEeccCC
Confidence 99988654 599999996
|
| >d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1n4ka2 b.42.6.1 (A:236-435) IP3 receptor type 1 binding core, domain 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4ka2 b.42.6.1 (A:236-435) IP3 receptor type 1 binding core, domain 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|