Psyllid ID: psy18009
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 277 | ||||||
| 345485389 | 844 | PREDICTED: ATP-binding cassette sub-fami | 0.422 | 0.138 | 0.648 | 6e-35 | |
| 307178084 | 843 | ATP-binding cassette sub-family B member | 0.444 | 0.145 | 0.602 | 3e-33 | |
| 332030756 | 798 | ATP-binding cassette sub-family B member | 0.429 | 0.149 | 0.609 | 3e-33 | |
| 195570524 | 817 | GD20321 [Drosophila simulans] gi|1941991 | 0.509 | 0.172 | 0.472 | 5e-33 | |
| 322796995 | 112 | hypothetical protein SINV_13547 [Solenop | 0.292 | 0.723 | 0.864 | 2e-32 | |
| 383865681 | 838 | PREDICTED: ATP-binding cassette sub-fami | 0.288 | 0.095 | 0.862 | 3e-32 | |
| 291237155 | 621 | PREDICTED: ABCB7-like [Saccoglossus kowa | 0.519 | 0.231 | 0.435 | 3e-32 | |
| 380021186 | 840 | PREDICTED: LOW QUALITY PROTEIN: ATP-bind | 0.332 | 0.109 | 0.760 | 8e-32 | |
| 350398414 | 837 | PREDICTED: ATP-binding cassette sub-fami | 0.288 | 0.095 | 0.85 | 1e-31 | |
| 340725080 | 841 | PREDICTED: ATP-binding cassette sub-fami | 0.288 | 0.095 | 0.85 | 1e-31 |
| >gi|345485389|ref|XP_003425259.1| PREDICTED: ATP-binding cassette sub-family B member 6, mitochondrial-like isoform 2 [Nasonia vitripennis] gi|345485391|ref|XP_001605354.2| PREDICTED: ATP-binding cassette sub-family B member 6, mitochondrial-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 6e-35, Method: Compositional matrix adjust.
Identities = 83/128 (64%), Positives = 98/128 (76%), Gaps = 11/128 (8%)
Query: 15 IDIPQAPMLCVAQGA-VEFRNVSFSYTPERAILKNISFTVPAGKTLALLSGGEKQRVAIA 73
ID P+A ++ A+ A + R ++F P+ + G+ LSGGEKQRVAIA
Sbjct: 684 IDAPEADIIAAAKYADIHERILTF---PD-------GYETQVGERGLRLSGGEKQRVAIA 733
Query: 74 RTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLSTIIHADEILVMH 133
RT+LKAP+IVLLDEATSALDT+TERNIQSALNRVCA+RTTII+AHRLSTIIHADEILVM
Sbjct: 734 RTMLKAPKIVLLDEATSALDTQTERNIQSALNRVCANRTTIIIAHRLSTIIHADEILVMK 793
Query: 134 AGEIVERG 141
GEIVERG
Sbjct: 794 EGEIVERG 801
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307178084|gb|EFN66911.1| ATP-binding cassette sub-family B member 6, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332030756|gb|EGI70432.1| ATP-binding cassette sub-family B member 6, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|195570524|ref|XP_002103257.1| GD20321 [Drosophila simulans] gi|194199184|gb|EDX12760.1| GD20321 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|322796995|gb|EFZ19311.1| hypothetical protein SINV_13547 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383865681|ref|XP_003708301.1| PREDICTED: ATP-binding cassette sub-family B member 6, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|291237155|ref|XP_002738501.1| PREDICTED: ABCB7-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|380021186|ref|XP_003694452.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family B member 6, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350398414|ref|XP_003485185.1| PREDICTED: ATP-binding cassette sub-family B member 6, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340725080|ref|XP_003400902.1| PREDICTED: ATP-binding cassette sub-family B member 6, mitochondrial-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 277 | ||||||
| TAIR|locus:2141365 | 1230 | ABCB5 "ATP-binding cassette B5 | 0.357 | 0.080 | 0.588 | 4.7e-41 | |
| TAIR|locus:2141350 | 1229 | ABCB3 "ATP-binding cassette B3 | 0.357 | 0.080 | 0.607 | 9.4e-41 | |
| UNIPROTKB|A5D7P7 | 843 | ABCB6 "ABCB6 protein" [Bos tau | 0.288 | 0.094 | 0.762 | 2.9e-40 | |
| FB|FBgn0010241 | 1313 | Mdr50 "Multi drug resistance 5 | 0.314 | 0.066 | 0.620 | 4.6e-39 | |
| TAIR|locus:2117656 | 1236 | ABCB9 "ATP-binding cassette B9 | 0.397 | 0.088 | 0.486 | 2.4e-20 | |
| TAIR|locus:2151496 | 1248 | ABCB7 "ATP-binding cassette B7 | 0.292 | 0.064 | 0.592 | 1.5e-37 | |
| ZFIN|ZDB-GENE-030131-6414 | 1338 | abcb5 "ATP-binding cassette, s | 0.314 | 0.065 | 0.597 | 2e-37 | |
| UNIPROTKB|Q804Z6 | 1292 | Q804Z6 "Uncharacterized protei | 0.393 | 0.084 | 0.467 | 1.4e-19 | |
| WB|WBGene00003996 | 1272 | pgp-2 [Caenorhabditis elegans | 0.292 | 0.063 | 0.679 | 2.7e-36 | |
| UNIPROTKB|G5EDF9 | 1272 | pgp-2 "ABC transporter PGP-2" | 0.292 | 0.063 | 0.679 | 2.7e-36 |
| TAIR|locus:2141365 ABCB5 "ATP-binding cassette B5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 270 (100.1 bits), Expect = 4.7e-41, Sum P(3) = 4.7e-41
Identities = 60/102 (58%), Positives = 79/102 (77%)
Query: 62 LSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLS 121
LSGG+KQR+AIAR +LK P+I+LLDEATSALD ++ER +Q AL+R+ +RTT+IVAHRLS
Sbjct: 492 LSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRIMVNRTTVIVAHRLS 551
Query: 122 TIIHADEILVMHAGEIVERGSLFVSLLQVGQSGAGKSTIIRL 163
T+ +AD I V+H G+IVE GS LL+ GA S ++RL
Sbjct: 552 TVRNADIIAVIHRGKIVEEGS-HSELLK-DHEGA-YSQLLRL 590
|
|
| TAIR|locus:2141350 ABCB3 "ATP-binding cassette B3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D7P7 ABCB6 "ABCB6 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0010241 Mdr50 "Multi drug resistance 50" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117656 ABCB9 "ATP-binding cassette B9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151496 ABCB7 "ATP-binding cassette B7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6414 abcb5 "ATP-binding cassette, sub-family B (MDR/TAP), member 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q804Z6 Q804Z6 "Uncharacterized protein" [Takifugu rubripes (taxid:31033)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003996 pgp-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5EDF9 pgp-2 "ABC transporter PGP-2" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 277 | |||
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 1e-45 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 8e-41 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 6e-40 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 1e-39 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 6e-39 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 1e-33 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 5e-33 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 2e-32 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 1e-31 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 1e-31 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 2e-31 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 1e-30 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 3e-30 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 3e-29 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 7e-28 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 8e-28 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 2e-26 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 2e-26 | |
| PRK10790 | 592 | PRK10790, PRK10790, putative multidrug transporter | 1e-25 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 2e-25 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 2e-24 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 4e-24 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 1e-23 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 1e-23 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 2e-23 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 4e-23 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 5e-23 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 9e-23 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 3e-22 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 3e-22 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 5e-22 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 1e-21 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 4e-21 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 4e-21 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 6e-21 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 1e-20 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 1e-20 | |
| cd03369 | 207 | cd03369, ABCC_NFT1, ATP-binding cassette domain 2 | 4e-20 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 6e-20 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 9e-20 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 1e-19 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 2e-19 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 3e-19 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 4e-19 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 4e-19 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 7e-19 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 1e-18 | |
| PLN03130 | 1622 | PLN03130, PLN03130, ABC transporter C family membe | 1e-18 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 2e-18 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 3e-18 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 4e-18 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 4e-18 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 5e-18 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 5e-18 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 5e-18 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 1e-17 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 1e-17 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 2e-17 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 3e-17 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 7e-17 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 7e-17 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 7e-17 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 8e-17 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 8e-17 | |
| cd03369 | 207 | cd03369, ABCC_NFT1, ATP-binding cassette domain 2 | 1e-16 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 1e-16 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 3e-16 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 3e-16 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 3e-16 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 4e-16 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 4e-16 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 5e-16 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 6e-16 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 7e-16 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 8e-16 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 1e-15 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 1e-15 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 2e-15 | |
| PRK11144 | 352 | PRK11144, modC, molybdate transporter ATP-binding | 2e-15 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 3e-15 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 4e-15 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 4e-15 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 4e-15 | |
| PRK13648 | 269 | PRK13648, cbiO, cobalt transporter ATP-binding sub | 6e-15 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 1e-14 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 1e-14 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 1e-14 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 1e-14 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 2e-14 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 2e-14 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 3e-14 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 3e-14 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 3e-14 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 4e-14 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 4e-14 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 4e-14 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 5e-14 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 5e-14 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 6e-14 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 6e-14 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 7e-14 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 9e-14 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 9e-14 | |
| cd03288 | 257 | cd03288, ABCC_SUR2, ATP-binding cassette domain 2 | 1e-13 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 1e-13 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 2e-13 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 2e-13 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 3e-13 | |
| TIGR03005 | 252 | TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB | 3e-13 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 3e-13 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 3e-13 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 4e-13 | |
| TIGR00957 | 1522 | TIGR00957, MRP_assoc_pro, multi drug resistance-as | 4e-13 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 5e-13 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 5e-13 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 5e-13 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 5e-13 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 5e-13 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 6e-13 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 8e-13 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 8e-13 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 9e-13 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 9e-13 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 1e-12 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 1e-12 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 1e-12 | |
| TIGR02314 | 343 | TIGR02314, ABC_MetN, D-methionine ABC transporter, | 2e-12 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 2e-12 | |
| TIGR01187 | 325 | TIGR01187, potA, spermidine/putrescine ABC transpo | 2e-12 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 2e-12 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 2e-12 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 2e-12 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 3e-12 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 3e-12 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 4e-12 | |
| PRK13640 | 282 | PRK13640, cbiO, cobalt transporter ATP-binding sub | 4e-12 | |
| TIGR03265 | 353 | TIGR03265, PhnT2, putative 2-aminoethylphosphonate | 4e-12 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 4e-12 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 4e-12 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 4e-12 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 6e-12 | |
| PRK13633 | 280 | PRK13633, PRK13633, cobalt transporter ATP-binding | 6e-12 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 6e-12 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 7e-12 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 7e-12 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 7e-12 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 8e-12 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 9e-12 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 9e-12 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 1e-11 | |
| PRK13631 | 320 | PRK13631, cbiO, cobalt transporter ATP-binding sub | 1e-11 | |
| PRK15112 | 267 | PRK15112, PRK15112, antimicrobial peptide ABC syst | 1e-11 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 1e-11 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 2e-11 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 2e-11 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 2e-11 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 2e-11 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 3e-11 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 3e-11 | |
| PRK14275 | 286 | PRK14275, PRK14275, phosphate ABC transporter ATP- | 3e-11 | |
| PTZ00243 | 1560 | PTZ00243, PTZ00243, ABC transporter; Provisional | 3e-11 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 4e-11 | |
| PLN03130 | 1622 | PLN03130, PLN03130, ABC transporter C family membe | 4e-11 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 4e-11 | |
| COG4161 | 242 | COG4161, ArtP, ABC-type arginine transport system, | 5e-11 | |
| PRK10851 | 353 | PRK10851, PRK10851, sulfate/thiosulfate transporte | 5e-11 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 6e-11 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 6e-11 | |
| PRK11124 | 242 | PRK11124, artP, arginine transporter ATP-binding s | 7e-11 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 7e-11 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 7e-11 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 8e-11 | |
| COG4167 | 267 | COG4167, SapF, ABC-type antimicrobial peptide tran | 8e-11 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 1e-10 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 1e-10 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 1e-10 | |
| PRK13646 | 286 | PRK13646, cbiO, cobalt transporter ATP-binding sub | 1e-10 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 1e-10 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 2e-10 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 2e-10 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 2e-10 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 2e-10 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 2e-10 | |
| PRK13642 | 277 | PRK13642, cbiO, cobalt transporter ATP-binding sub | 2e-10 | |
| PRK13652 | 277 | PRK13652, cbiO, cobalt transporter ATP-binding sub | 3e-10 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 3e-10 | |
| cd03291 | 282 | cd03291, ABCC_CFTR1, ATP-binding cassette domain o | 3e-10 | |
| PRK14261 | 253 | PRK14261, PRK14261, phosphate ABC transporter ATP- | 3e-10 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 3e-10 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 3e-10 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 3e-10 | |
| TIGR02770 | 230 | TIGR02770, nickel_nikD, nickel import ATP-binding | 3e-10 | |
| PRK13645 | 289 | PRK13645, cbiO, cobalt transporter ATP-binding sub | 4e-10 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 5e-10 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 5e-10 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 5e-10 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 6e-10 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 6e-10 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 7e-10 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 7e-10 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 7e-10 | |
| PRK14266 | 250 | PRK14266, PRK14266, phosphate ABC transporter ATP- | 7e-10 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 8e-10 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 8e-10 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 8e-10 | |
| PRK10070 | 400 | PRK10070, PRK10070, glycine betaine transporter AT | 8e-10 | |
| PRK14274 | 259 | PRK14274, PRK14274, phosphate ABC transporter ATP- | 9e-10 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 1e-09 | |
| PRK14252 | 265 | PRK14252, PRK14252, phosphate ABC transporter ATP- | 1e-09 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 1e-09 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 1e-09 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 1e-09 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 1e-09 | |
| PRK10419 | 268 | PRK10419, nikE, nickel transporter ATP-binding pro | 1e-09 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 1e-09 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 1e-09 | |
| PRK10790 | 592 | PRK10790, PRK10790, putative multidrug transporter | 2e-09 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 2e-09 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 2e-09 | |
| TIGR00957 | 1522 | TIGR00957, MRP_assoc_pro, multi drug resistance-as | 2e-09 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 2e-09 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 2e-09 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 2e-09 | |
| PRK14259 | 269 | PRK14259, PRK14259, phosphate ABC transporter ATP- | 2e-09 | |
| PRK14271 | 276 | PRK14271, PRK14271, phosphate ABC transporter ATP- | 2e-09 | |
| PRK14251 | 251 | PRK14251, PRK14251, phosphate ABC transporter ATP- | 2e-09 | |
| PRK14253 | 249 | PRK14253, PRK14253, phosphate ABC transporter ATP- | 2e-09 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 2e-09 | |
| PRK14255 | 252 | PRK14255, PRK14255, phosphate ABC transporter ATP- | 2e-09 | |
| PRK14269 | 246 | PRK14269, PRK14269, phosphate ABC transporter ATP- | 2e-09 | |
| cd03290 | 218 | cd03290, ABCC_SUR1_N, ATP-binding cassette domain | 2e-09 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-09 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 3e-09 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 3e-09 | |
| PRK14272 | 252 | PRK14272, PRK14272, phosphate ABC transporter ATP- | 3e-09 | |
| PRK14273 | 254 | PRK14273, PRK14273, phosphate ABC transporter ATP- | 3e-09 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 3e-09 | |
| PRK14256 | 252 | PRK14256, PRK14256, phosphate ABC transporter ATP- | 3e-09 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 4e-09 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 4e-09 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 4e-09 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 4e-09 | |
| PRK15079 | 331 | PRK15079, PRK15079, oligopeptide ABC transporter A | 4e-09 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 4e-09 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 4e-09 | |
| cd03222 | 177 | cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett | 4e-09 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 4e-09 | |
| PRK13641 | 287 | PRK13641, cbiO, cobalt transporter ATP-binding sub | 4e-09 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 5e-09 | |
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 5e-09 | |
| TIGR02769 | 265 | TIGR02769, nickel_nikE, nickel import ATP-binding | 5e-09 | |
| PRK14248 | 268 | PRK14248, PRK14248, phosphate ABC transporter ATP- | 5e-09 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 5e-09 | |
| PRK09473 | 330 | PRK09473, oppD, oligopeptide transporter ATP-bindi | 6e-09 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 6e-09 | |
| PRK11432 | 351 | PRK11432, fbpC, ferric transporter ATP-binding sub | 7e-09 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 7e-09 | |
| PRK14244 | 251 | PRK14244, PRK14244, phosphate ABC transporter ATP- | 7e-09 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 8e-09 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 8e-09 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 8e-09 | |
| PRK14237 | 267 | PRK14237, PRK14237, phosphate transporter ATP-bind | 9e-09 | |
| PRK14243 | 264 | PRK14243, PRK14243, phosphate transporter ATP-bind | 9e-09 | |
| TIGR00954 | 659 | TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra | 9e-09 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 1e-08 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 1e-08 | |
| PLN03130 | 1622 | PLN03130, PLN03130, ABC transporter C family membe | 1e-08 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 1e-08 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 1e-08 | |
| TIGR00957 | 1522 | TIGR00957, MRP_assoc_pro, multi drug resistance-as | 1e-08 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 1e-08 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 1e-08 | |
| PRK14245 | 250 | PRK14245, PRK14245, phosphate ABC transporter ATP- | 1e-08 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 1e-08 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 1e-08 | |
| PRK14242 | 253 | PRK14242, PRK14242, phosphate transporter ATP-bind | 1e-08 | |
| PRK14268 | 258 | PRK14268, PRK14268, phosphate ABC transporter ATP- | 1e-08 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 1e-08 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 2e-08 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 2e-08 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 2e-08 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 2e-08 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 2e-08 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 2e-08 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 2e-08 | |
| cd03238 | 176 | cd03238, ABC_UvrA, ATP-binding cassette domain of | 2e-08 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 3e-08 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 3e-08 | |
| PRK14267 | 253 | PRK14267, PRK14267, phosphate ABC transporter ATP- | 3e-08 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 3e-08 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 3e-08 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 4e-08 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 4e-08 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 4e-08 | |
| PRK03695 | 248 | PRK03695, PRK03695, vitamin B12-transporter ATPase | 4e-08 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 4e-08 | |
| COG4138 | 248 | COG4138, BtuD, ABC-type cobalamin transport system | 5e-08 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 5e-08 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 5e-08 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 6e-08 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 6e-08 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 7e-08 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 7e-08 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 7e-08 | |
| PRK14247 | 250 | PRK14247, PRK14247, phosphate ABC transporter ATP- | 8e-08 | |
| PRK14257 | 329 | PRK14257, PRK14257, phosphate ABC transporter ATP- | 8e-08 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 9e-08 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 9e-08 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 9e-08 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 1e-07 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 1e-07 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 1e-07 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 1e-07 | |
| PRK14254 | 285 | PRK14254, PRK14254, phosphate ABC transporter ATP- | 1e-07 | |
| cd03289 | 275 | cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 | 1e-07 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 1e-07 | |
| PRK14264 | 305 | PRK14264, PRK14264, phosphate ABC transporter ATP- | 1e-07 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 1e-07 | |
| COG4107 | 258 | COG4107, PhnK, ABC-type phosphonate transport syst | 1e-07 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 2e-07 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 2e-07 | |
| PRK13644 | 274 | PRK13644, cbiO, cobalt transporter ATP-binding sub | 2e-07 | |
| CHL00131 | 252 | CHL00131, ycf16, sulfate ABC transporter protein; | 2e-07 | |
| PRK13409 | 590 | PRK13409, PRK13409, putative ATPase RIL; Provision | 2e-07 | |
| PRK14241 | 258 | PRK14241, PRK14241, phosphate transporter ATP-bind | 2e-07 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 2e-07 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 2e-07 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 3e-07 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 3e-07 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 3e-07 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 3e-07 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 3e-07 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 3e-07 | |
| PRK15056 | 272 | PRK15056, PRK15056, manganese/iron transporter ATP | 3e-07 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 3e-07 | |
| PRK09544 | 251 | PRK09544, znuC, high-affinity zinc transporter ATP | 3e-07 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 3e-07 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 4e-07 | |
| PRK13409 | 590 | PRK13409, PRK13409, putative ATPase RIL; Provision | 4e-07 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 4e-07 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 4e-07 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 5e-07 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 5e-07 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 6e-07 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 7e-07 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 7e-07 | |
| PRK11022 | 326 | PRK11022, dppD, dipeptide transporter ATP-binding | 7e-07 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 8e-07 | |
| TIGR02633 | 500 | TIGR02633, xylG, D-xylose ABC transporter, ATP-bin | 8e-07 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 9e-07 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 9e-07 | |
| PRK14265 | 274 | PRK14265, PRK14265, phosphate ABC transporter ATP- | 9e-07 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 9e-07 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 1e-06 | |
| PTZ00243 | 1560 | PTZ00243, PTZ00243, ABC transporter; Provisional | 1e-06 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 1e-06 | |
| PRK14263 | 261 | PRK14263, PRK14263, phosphate ABC transporter ATP- | 1e-06 | |
| PRK15093 | 330 | PRK15093, PRK15093, antimicrobial peptide ABC tran | 1e-06 | |
| PRK13651 | 305 | PRK13651, PRK13651, cobalt transporter ATP-binding | 1e-06 | |
| TIGR00630 | 925 | TIGR00630, uvra, excinuclease ABC, A subunit | 1e-06 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 1e-06 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 2e-06 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 2e-06 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 2e-06 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 2e-06 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 2e-06 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 2e-06 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 2e-06 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 2e-06 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 2e-06 | |
| PRK13643 | 288 | PRK13643, cbiO, cobalt transporter ATP-binding sub | 2e-06 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 2e-06 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 3e-06 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 3e-06 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 3e-06 | |
| cd03237 | 246 | cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin | 3e-06 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 3e-06 | |
| PRK14260 | 259 | PRK14260, PRK14260, phosphate ABC transporter ATP- | 3e-06 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 3e-06 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 4e-06 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 4e-06 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 4e-06 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 4e-06 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 4e-06 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 4e-06 | |
| cd03271 | 261 | cd03271, ABC_UvrA_II, ATP-binding cassette domain | 4e-06 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 5e-06 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 5e-06 | |
| PRK10070 | 400 | PRK10070, PRK10070, glycine betaine transporter AT | 5e-06 | |
| COG0178 | 935 | COG0178, UvrA, Excinuclease ATPase subunit [DNA re | 5e-06 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 6e-06 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 6e-06 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 6e-06 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 6e-06 | |
| cd03289 | 275 | cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 | 6e-06 | |
| PRK13638 | 271 | PRK13638, cbiO, cobalt transporter ATP-binding sub | 6e-06 | |
| TIGR03415 | 382 | TIGR03415, ABC_choXWV_ATP, choline ABC transporter | 6e-06 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 7e-06 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 7e-06 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 8e-06 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 8e-06 | |
| COG4170 | 330 | COG4170, SapD, ABC-type antimicrobial peptide tran | 8e-06 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 9e-06 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 1e-05 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 1e-05 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 1e-05 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 1e-05 | |
| cd03288 | 257 | cd03288, ABCC_SUR2, ATP-binding cassette domain 2 | 1e-05 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 1e-05 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 1e-05 | |
| COG2401 | 593 | COG2401, COG2401, ABC-type ATPase fused to a predi | 1e-05 | |
| TIGR01288 | 303 | TIGR01288, nodI, ATP-binding ABC transporter famil | 1e-05 | |
| PRK10418 | 254 | PRK10418, nikD, nickel transporter ATP-binding pro | 1e-05 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 1e-05 | |
| PRK00635 | 1809 | PRK00635, PRK00635, excinuclease ABC subunit A; Pr | 1e-05 | |
| cd03236 | 255 | cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin | 1e-05 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 2e-05 | |
| PTZ00243 | 1560 | PTZ00243, PTZ00243, ABC transporter; Provisional | 2e-05 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 2e-05 | |
| TIGR00630 | 925 | TIGR00630, uvra, excinuclease ABC, A subunit | 2e-05 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 2e-05 | |
| PRK09580 | 248 | PRK09580, sufC, cysteine desulfurase ATPase compon | 2e-05 | |
| TIGR01194 | 555 | TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo | 2e-05 | |
| PLN03073 | 718 | PLN03073, PLN03073, ABC transporter F family; Prov | 2e-05 | |
| PRK11650 | 356 | PRK11650, ugpC, glycerol-3-phosphate transporter A | 2e-05 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 3e-05 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 3e-05 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 3e-05 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 3e-05 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 4e-05 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 4e-05 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 4e-05 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 4e-05 | |
| COG0178 | 935 | COG0178, UvrA, Excinuclease ATPase subunit [DNA re | 4e-05 | |
| PRK10908 | 222 | PRK10908, PRK10908, cell division protein FtsE; Pr | 4e-05 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 4e-05 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 5e-05 | |
| cd03270 | 226 | cd03270, ABC_UvrA_I, ATP-binding cassette domain I | 5e-05 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 5e-05 | |
| PRK10253 | 265 | PRK10253, PRK10253, iron-enterobactin transporter | 5e-05 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 5e-05 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 5e-05 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 6e-05 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 6e-05 | |
| PLN03073 | 718 | PLN03073, PLN03073, ABC transporter F family; Prov | 6e-05 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 6e-05 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 7e-05 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 7e-05 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 8e-05 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 8e-05 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 9e-05 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 9e-05 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 9e-05 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 1e-04 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 1e-04 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 1e-04 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 1e-04 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 1e-04 | |
| PRK13648 | 269 | PRK13648, cbiO, cobalt transporter ATP-binding sub | 1e-04 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 1e-04 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 1e-04 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 1e-04 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 1e-04 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 1e-04 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 2e-04 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 2e-04 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 2e-04 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 2e-04 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 2e-04 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 2e-04 | |
| PRK00635 | 1809 | PRK00635, PRK00635, excinuclease ABC subunit A; Pr | 2e-04 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 2e-04 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 2e-04 | |
| PRK10522 | 547 | PRK10522, PRK10522, multidrug transporter membrane | 2e-04 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 2e-04 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 3e-04 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 3e-04 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 3e-04 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 3e-04 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 3e-04 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 4e-04 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 4e-04 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 4e-04 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 4e-04 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 4e-04 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 4e-04 | |
| COG4615 | 546 | COG4615, PvdE, ABC-type siderophore export system, | 4e-04 | |
| PRK15064 | 530 | PRK15064, PRK15064, ABC transporter ATP-binding pr | 4e-04 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 5e-04 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 5e-04 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 5e-04 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 5e-04 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 6e-04 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 6e-04 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 6e-04 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 6e-04 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 6e-04 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 7e-04 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 7e-04 | |
| PRK14245 | 250 | PRK14245, PRK14245, phosphate ABC transporter ATP- | 7e-04 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 8e-04 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 8e-04 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 9e-04 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 0.001 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 0.001 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 0.001 | |
| TIGR01187 | 325 | TIGR01187, potA, spermidine/putrescine ABC transpo | 0.001 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 0.001 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 0.001 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 0.001 | |
| PRK14261 | 253 | PRK14261, PRK14261, phosphate ABC transporter ATP- | 0.001 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 0.001 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 0.001 | |
| PRK14242 | 253 | PRK14242, PRK14242, phosphate transporter ATP-bind | 0.001 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 0.001 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 0.001 | |
| COG1134 | 249 | COG1134, TagH, ABC-type polysaccharide/polyol phos | 0.001 | |
| PRK10895 | 241 | PRK10895, PRK10895, lipopolysaccharide ABC transpo | 0.001 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 0.001 | |
| PRK13547 | 272 | PRK13547, hmuV, hemin importer ATP-binding subunit | 0.001 | |
| pfam13558 | 79 | pfam13558, SbcCD_C, Putative exonuclease SbcCD, C | 0.001 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 0.002 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 0.002 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 0.002 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 0.002 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 0.002 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 0.002 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 0.002 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 0.002 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 0.002 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 0.002 | |
| TIGR02314 | 343 | TIGR02314, ABC_MetN, D-methionine ABC transporter, | 0.002 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 0.002 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 0.002 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 0.002 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 0.002 | |
| PRK11432 | 351 | PRK11432, fbpC, ferric transporter ATP-binding sub | 0.002 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 0.002 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 0.002 | |
| PRK10522 | 547 | PRK10522, PRK10522, multidrug transporter membrane | 0.002 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 0.002 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 0.002 | |
| PRK13540 | 200 | PRK13540, PRK13540, cytochrome c biogenesis protei | 0.002 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| PRK10790 | 592 | PRK10790, PRK10790, putative multidrug transporter | 0.003 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 0.003 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 0.003 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 0.003 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 0.003 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 0.003 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 0.003 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 0.003 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 0.003 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 0.003 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 0.003 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 0.003 | |
| PRK11614 | 237 | PRK11614, livF, leucine/isoleucine/valine transpor | 0.003 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 0.003 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 0.004 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 0.004 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 0.004 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 0.004 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 0.004 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 0.004 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 0.004 |
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
Score = 152 bits (387), Expect = 1e-45
Identities = 57/81 (70%), Positives = 68/81 (83%)
Query: 62 LSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLS 121
LSGGEKQRVAIAR +LK P I+LLDEATSALDT TER IQ+AL V RTTI++AHRLS
Sbjct: 138 LSGGEKQRVAIARAILKNPPILLLDEATSALDTHTEREIQAALRDVSKGRTTIVIAHRLS 197
Query: 122 TIIHADEILVMHAGEIVERGS 142
TI++AD+I+V+ G IVERG+
Sbjct: 198 TIVNADKIIVLKDGRIVERGT 218
|
ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Length = 236 |
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter | Back alignment and domain information |
|---|
| >gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|213237 cd03270, ABC_UvrA_I, ATP-binding cassette domain I of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222219 pfam13558, SbcCD_C, Putative exonuclease SbcCD, C subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 277 | |||
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 100.0 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 100.0 | |
| KOG0055|consensus | 1228 | 100.0 | ||
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 100.0 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 100.0 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 100.0 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 100.0 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.98 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.98 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.97 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.97 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.97 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.97 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.97 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.97 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.97 | |
| KOG0058|consensus | 716 | 99.97 | ||
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.96 | |
| KOG0055|consensus | 1228 | 99.96 | ||
| KOG0056|consensus | 790 | 99.96 | ||
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.96 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.95 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.95 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.95 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.95 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.95 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.94 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 99.94 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.94 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.94 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.94 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.94 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.94 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.94 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.94 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.94 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.94 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.93 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.93 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.93 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.93 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.93 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.93 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.93 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.93 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.93 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.93 | |
| KOG0054|consensus | 1381 | 99.93 | ||
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.93 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.92 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.92 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.92 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.92 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.92 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.92 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.92 | |
| KOG0057|consensus | 591 | 99.92 | ||
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.92 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.92 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.92 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.91 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.91 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.91 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.91 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.91 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.91 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.9 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.9 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.9 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.9 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.9 | |
| KOG0054|consensus | 1381 | 99.9 | ||
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.9 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.9 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.9 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.9 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.9 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.9 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.89 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.89 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.89 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.89 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.89 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.89 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.89 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.89 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.88 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.88 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.88 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.88 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.88 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.88 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.88 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.88 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.88 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.88 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.88 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.88 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.88 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.88 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.88 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.88 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.88 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.88 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.88 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.88 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.88 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.88 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.88 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.87 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.87 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.87 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.87 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.87 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.87 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.87 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.87 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.87 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.87 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.87 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.87 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.87 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.87 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.87 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.87 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.87 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.87 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.87 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.87 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.87 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.87 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.87 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.87 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.87 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.87 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.87 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.87 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.87 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.87 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.87 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.87 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.87 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.87 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.87 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.87 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.87 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.87 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.87 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.87 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.87 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.87 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.87 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.87 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.87 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.87 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.87 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.87 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.87 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.87 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.86 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.86 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.86 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.86 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.86 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.86 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.86 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.86 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.86 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.86 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.86 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.86 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.86 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.86 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.86 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.86 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.86 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.86 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.86 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.86 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.86 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.86 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.86 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.86 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.86 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.86 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.86 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.86 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.86 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.86 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.86 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.86 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.86 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.86 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.86 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.86 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.85 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.85 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.85 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.85 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.85 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.85 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.85 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.85 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.85 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.85 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.85 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.85 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.85 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.85 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.85 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.85 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.85 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.85 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.85 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.85 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.85 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.85 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.85 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.85 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.85 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.85 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.85 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.85 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.85 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.84 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.84 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.84 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.84 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.84 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.84 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.84 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.84 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.84 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.84 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.84 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.84 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.84 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.84 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.84 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.84 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.84 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.84 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.84 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.84 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.84 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.83 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.83 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.83 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.83 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.83 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.83 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.83 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.82 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.82 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.82 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.82 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.82 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.82 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.82 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.82 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.82 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.81 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.81 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.81 | |
| KOG0927|consensus | 614 | 99.81 | ||
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.81 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.81 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.8 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.8 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.8 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.8 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.8 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.8 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.8 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.8 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.79 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.79 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.79 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.78 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.78 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.78 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.78 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.78 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.78 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.78 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.77 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.77 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 99.77 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.76 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.76 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.75 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 99.75 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.75 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.75 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.74 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.74 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.74 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.74 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.73 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.73 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.73 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.72 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.71 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.7 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.7 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.7 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.69 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.69 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.68 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.68 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.68 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.67 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.65 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.65 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.64 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.64 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.63 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.63 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.63 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.63 | |
| KOG0062|consensus | 582 | 99.63 | ||
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.62 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.61 | |
| KOG0059|consensus | 885 | 99.59 | ||
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.56 | |
| KOG0062|consensus | 582 | 99.56 | ||
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.56 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.55 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.55 | |
| KOG0061|consensus | 613 | 99.54 | ||
| KOG0927|consensus | 614 | 99.5 | ||
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.5 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.49 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.48 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.46 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.46 | |
| KOG0066|consensus | 807 | 99.45 | ||
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.45 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.44 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.44 | |
| KOG0066|consensus | 807 | 99.42 | ||
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.42 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.42 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.42 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.42 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.39 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 99.37 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 99.37 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.34 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.34 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.33 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.33 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.33 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.33 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.32 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.32 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.32 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.32 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.31 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.31 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.31 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.3 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.3 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.3 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.3 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.3 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.29 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 99.29 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.29 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.29 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.29 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.28 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.28 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.28 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.28 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.27 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.27 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.27 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.27 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.27 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.27 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.27 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.26 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.26 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.26 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.25 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.25 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.25 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.25 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.25 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.25 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.25 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.25 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.25 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.25 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.24 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.24 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.24 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.24 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.24 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.24 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.24 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.24 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.24 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.24 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.23 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.23 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.23 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.23 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.23 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.23 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 99.23 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.23 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.22 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.22 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.22 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.22 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.22 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.22 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.22 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.22 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.21 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.21 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.21 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.21 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.21 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.21 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.19 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.19 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.19 | |
| KOG0063|consensus | 592 | 99.19 | ||
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.19 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.19 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.19 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.19 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.18 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.18 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.18 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.18 |
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-40 Score=323.54 Aligned_cols=198 Identities=25% Similarity=0.409 Sum_probs=176.3
Q ss_pred HHhhcccCcccccCCeeeccCHHHHHHHHHHHHhccCCCEEEEecCCCCCCHHHHHHHHHHHHHHhcCc-eEEEEecCcc
Q psy18009 43 RAILKNISFTVPAGKTLALLSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASR-TTIIVAHRLS 121 (277)
Q Consensus 43 ~~vL~~l~l~i~~~~~v~~LSgGqrQrv~IAral~~~p~ilILDEPTa~LD~~~~~~l~~~l~~l~~~~-tiIiIsH~l~ 121 (277)
+++|+.+++.+.++.+|+.||+||||+|+||||+..++++||||||||+|+..+.+.||+++++|+++| ++|+|||+|+
T Consensus 127 ~~~l~~lg~~~~~~~~v~~LsiaqrQ~VeIArAl~~~arllIlDEPTaaLt~~E~~~Lf~~ir~Lk~~Gv~ii~ISHrl~ 206 (500)
T COG1129 127 RELLARLGLDIDPDTLVGDLSIAQRQMVEIARALSFDARVLILDEPTAALTVKETERLFDLIRRLKAQGVAIIYISHRLD 206 (500)
T ss_pred HHHHHHcCCCCChhhhhhhCCHHHHHHHHHHHHHhcCCCEEEEcCCcccCCHHHHHHHHHHHHHHHhCCCEEEEEcCcHH
Confidence 568999999888999999999999999999999999999999999999999999999999999999765 7888999999
Q ss_pred hhcc-CceEEEeeCcEEEEecCc-e--------------------e------------eeh-------------------
Q psy18009 122 TIIH-ADEILVMHAGEIVERGSL-F--------------------V------------SLL------------------- 148 (277)
Q Consensus 122 ev~~-~Drv~vL~dG~iv~~g~~-~--------------------~------------~~~------------------- 148 (277)
|++. ||||+|||||+.+...+. . . .+.
T Consensus 207 Ei~~i~DritVlRDG~~v~~~~~~~~~~~~~lv~~MvGr~~~~~~~~~~~~~~~~~~l~v~~l~~~~~~~dvSf~vr~GE 286 (500)
T COG1129 207 EVFEIADRITVLRDGRVVGTRPTAAETSEDELVRLMVGRELEDLFPEPPEEGIGEPVLEVRNLSGGGKVRDVSFTVRAGE 286 (500)
T ss_pred HHHHhcCEEEEEeCCEEeeecccccCCCHHHHHHHhhCcchhhhcccccccCCCCcEEEEecCCCCCceeCceeEEeCCc
Confidence 9997 999999999999854331 0 0 000
Q ss_pred ---hcCCCCCchhHHHHHHhccccCceeEEEECCEeccCCc-HHHHhcceEEEcCC----------chhhHHhHHHHhh-
Q psy18009 149 ---QVGQSGAGKSTIIRLLFRFYDVESGDIFIDNQNIKTVS-QASLRQAIGVVPQD----------TVLFNNSIKAIQK- 213 (277)
Q Consensus 149 ---~~G~~GsGkttL~~~l~Gl~~~~~G~i~~~g~~~~~~~-~~~~~~~i~~vpqd----------~~~~n~~~~~~~~- 213 (277)
..|+.|||||+++++|||+.++.+|+|.++|+++...+ .+++++||+|||+| ++..|++++.++.
T Consensus 287 IlGiaGLvGaGRTEl~~~lfG~~~~~~G~i~l~G~~v~~~sp~~Ai~~Gi~~v~EDRk~~Gl~l~~sI~~Ni~l~~l~~~ 366 (500)
T COG1129 287 ILGIAGLVGAGRTELARALFGARPASSGEILLDGKPVRIRSPRDAIKAGIAYVPEDRKSEGLVLDMSIAENITLASLRRF 366 (500)
T ss_pred EEEEeccccCCHHHHHHHHhCCCcCCCceEEECCEEccCCCHHHHHHcCCEeCCcccccCcCcCCCcHHHheehHhhhhh
Confidence 02678999999999999999999999999999999877 56789999999999 6899999996643
Q ss_pred ---cccChHHHHHHHHHHHHhcCCCCCCcc
Q psy18009 214 ---NFVDMENMFDLLQETCDVIDIPQAPML 240 (277)
Q Consensus 214 ---~~~~~~~~~~~~~~~~~~l~I~~~~~~ 240 (277)
.|++.++|++.+++|+++|+||+++..
T Consensus 367 ~~~~~i~~~~e~~~~~~~~~~l~Ik~~s~~ 396 (500)
T COG1129 367 SRRGLIDRRKERALAERYIRRLRIKTPSPE 396 (500)
T ss_pred ccccccChHHHHHHHHHHHHhcCcccCCcc
Confidence 279999999999999999999999875
|
|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >KOG0056|consensus | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG0057|consensus | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0059|consensus | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >KOG0061|consensus | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0063|consensus | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 277 | ||||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 2e-28 | ||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 3e-19 | ||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 1e-13 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 5e-23 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 1e-10 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 2e-04 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 6e-23 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 3e-10 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 4e-04 | ||
| 3b5x_A | 582 | Crystal Structure Of Msba From Vibrio Cholerae Leng | 1e-22 | ||
| 3b5x_A | 582 | Crystal Structure Of Msba From Vibrio Cholerae Leng | 1e-09 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 7e-22 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 3e-10 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 7e-22 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 3e-10 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 9e-22 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 2e-20 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 5e-10 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 1e-21 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 3e-09 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 1e-21 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 3e-09 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 1e-21 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 3e-09 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 1e-21 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 7e-09 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 1e-21 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 2e-09 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 2e-21 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 3e-13 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 4e-04 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 2e-21 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 3e-09 | ||
| 2ghi_A | 260 | Crystal Structure Of Plasmodium Yoelii Multidrug Re | 4e-21 | ||
| 2ghi_A | 260 | Crystal Structure Of Plasmodium Yoelii Multidrug Re | 2e-14 | ||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 8e-21 | ||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 2e-09 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 2e-20 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 3e-09 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 2e-20 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 3e-09 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 4e-19 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 4e-08 | ||
| 3qf4_B | 598 | Crystal Structure Of A Heterodimeric Abc Transporte | 1e-18 | ||
| 3qf4_B | 598 | Crystal Structure Of A Heterodimeric Abc Transporte | 2e-13 | ||
| 3qf4_B | 598 | Crystal Structure Of A Heterodimeric Abc Transporte | 3e-05 | ||
| 3qf4_A | 587 | Crystal Structure Of A Heterodimeric Abc Transporte | 3e-14 | ||
| 3qf4_A | 587 | Crystal Structure Of A Heterodimeric Abc Transporte | 8e-09 | ||
| 2ixf_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 1e-12 | ||
| 2ixe_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 2e-11 | ||
| 1jj7_A | 260 | Crystal Structure Of The C-Terminal Atpase Domain O | 1e-10 | ||
| 2it1_A | 362 | Structure Of Ph0203 Protein From Pyrococcus Horikos | 5e-10 | ||
| 2onk_A | 240 | Abc Transporter Modbc In Complex With Its Binding P | 5e-10 | ||
| 1z47_A | 355 | Structure Of The Atpase Subunit Cysa Of The Putativ | 8e-10 | ||
| 2ixg_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 1e-09 | ||
| 1f3o_A | 235 | Crystal Structure Of Mj0796 Atp-Binding Cassette Le | 1e-09 | ||
| 3d31_A | 348 | Modbc From Methanosarcina Acetivorans Length = 348 | 2e-09 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 3e-09 | ||
| 1b0u_A | 262 | Atp-Binding Subunit Of The Histidine Permease From | 3e-09 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 3e-09 | ||
| 2olj_A | 263 | Abc Protein Artp In Complex With AdpMG2+ Length = 2 | 4e-09 | ||
| 3c41_J | 242 | Abc Protein Artp In Complex With Amp-PnpMG2+ Length | 4e-09 | ||
| 3dhw_C | 343 | Crystal Structure Of Methionine Importer Metni Leng | 4e-09 | ||
| 3tui_C | 366 | Inward Facing Conformations Of The Metni Methionine | 1e-08 | ||
| 1q12_A | 381 | Crystal Structure Of The Atp-bound E. Coli Malk Len | 1e-08 | ||
| 1q1b_A | 381 | Crystal Structure Of E. Coli Malk In The Nucleotide | 1e-08 | ||
| 2pzg_A | 241 | Minimal Human Cftr First Nucleotide Binding Domain | 1e-08 | ||
| 1xmi_A | 291 | Crystal Structure Of Human F508a Nbd1 Domain With A | 1e-08 | ||
| 2pze_A | 229 | Minimal Human Cftr First Nucleotide Binding Domain | 1e-08 | ||
| 2bbt_A | 290 | Human Deltaf508 Nbd1 With Two Solublizing Mutations | 1e-08 | ||
| 2pzf_A | 228 | Minimal Human Cftr First Nucleotide Binding Domain | 1e-08 | ||
| 2bbs_A | 290 | Human Deltaf508 Nbd1 With Three Solubilizing Mutati | 1e-08 | ||
| 4hlu_A | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 2e-08 | ||
| 2yz2_A | 266 | Crystal Structure Of The Abc Transporter In The Cob | 2e-08 | ||
| 2cbz_A | 237 | Structure Of The Human Multidrug Resistance Protein | 2e-08 | ||
| 1g29_1 | 372 | Malk Length = 372 | 2e-08 | ||
| 2r6g_A | 381 | The Crystal Structure Of The E. Coli Maltose Transp | 3e-08 | ||
| 3tuj_C | 366 | Inward Facing Conformations Of The Metni Methionine | 3e-08 | ||
| 1v43_A | 372 | Crystal Structure Of Atpase Subunit Of Abc Sugar Tr | 3e-08 | ||
| 1vci_A | 373 | Crystal Structure Of The Atp-binding Cassette Of Mu | 4e-08 | ||
| 1q3h_A | 286 | Mouse Cftr Nbd1 With Amp.Pnp Length = 286 | 5e-08 | ||
| 1r0z_A | 286 | Phosphorylated Cystic Fibrosis Transmembrane Conduc | 5e-08 | ||
| 3si7_A | 285 | The Crystal Structure Of The Nbd1 Domain Of The Mou | 5e-08 | ||
| 1xf9_A | 283 | Structure Of Nbd1 From Murine Cftr- F508s Mutant Le | 6e-08 | ||
| 1xfa_A | 283 | Structure Of Nbd1 From Murine Cftr- F508r Mutant Le | 6e-08 | ||
| 1oxs_C | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 7e-08 | ||
| 4fwi_B | 334 | Crystal Structure Of The Nucleotide-binding Domain | 4e-07 | ||
| 1oxx_K | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 4e-07 | ||
| 2bbo_A | 291 | Human Nbd1 With Phe508 Length = 291 | 5e-07 | ||
| 1xmj_A | 290 | Crystal Structure Of Human Deltaf508 Human Nbd1 Dom | 5e-07 | ||
| 2d62_A | 375 | Crystal Structure Of Multiple Sugar Binding Transpo | 7e-07 | ||
| 3bk7_A | 607 | Structure Of The Complete Abce1RNAASE-L Inhibitor P | 1e-06 | ||
| 3j15_B | 593 | Model Of Ribosome-Bound Archaeal Pelota And Abce1 L | 1e-06 | ||
| 2yyz_A | 359 | Crystal Structure Of Sugar Abc Transporter, Atp-Bin | 2e-06 | ||
| 2d3w_A | 248 | Crystal Structure Of Escherichia Coli Sufc, An Atpa | 2e-06 | ||
| 2zu0_C | 267 | Crystal Structure Of Sufc-Sufd Complex Involved In | 3e-06 | ||
| 1yqt_A | 538 | Rnase-L Inhibitor Length = 538 | 4e-06 | ||
| 3gd7_A | 390 | Crystal Structure Of Human Nbd2 Complexed With N6- | 5e-06 | ||
| 3gd7_A | 390 | Crystal Structure Of Human Nbd2 Complexed With N6- | 8e-05 | ||
| 4hlu_D | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 1e-05 | ||
| 3gfo_A | 275 | Structure Of Cbio1 From Clostridium Perfringens: Pa | 1e-05 | ||
| 2ihy_A | 279 | Structure Of The Staphylococcus Aureus Putative Atp | 1e-05 | ||
| 3ozx_A | 538 | Crystal Structure Of Abce1 Of Sulfolubus Solfataric | 2e-05 | ||
| 2pcj_A | 224 | Crystal Structure Of Abc Transporter (Aq_297) From | 3e-05 | ||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 3e-05 | ||
| 4g1u_C | 266 | X-Ray Structure Of The Bacterial Heme Transporter H | 4e-05 | ||
| 1g6h_A | 257 | Crystal Structure Of The Adp Conformation Of Mj1267 | 9e-05 | ||
| 1g9x_A | 257 | Characterization Of The Twinning Structure Of Mj126 | 9e-05 | ||
| 3pih_A | 916 | T. Maritima Uvra In Complex With Fluorescein-Modifi | 2e-04 | ||
| 1l7v_C | 249 | Bacterial Abc Transporter Involved In B12 Uptake Le | 4e-04 | ||
| 2nq2_C | 253 | An Inward-Facing Conformation Of A Putative Metal-C | 4e-04 | ||
| 3zqj_A | 993 | Mycobacterium Tuberculosis Uvra Length = 993 | 7e-04 | ||
| 3fvq_A | 359 | Crystal Structure Of The Nucleotide Binding Domain | 9e-04 |
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
|
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 | Back alignment and structure |
| >pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 | Back alignment and structure |
| >pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 | Back alignment and structure |
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
| >pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 | Back alignment and structure |
| >pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 | Back alignment and structure |
| >pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 | Back alignment and structure |
| >pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 | Back alignment and structure |
| >pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 | Back alignment and structure |
| >pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 | Back alignment and structure |
| >pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 | Back alignment and structure |
| >pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 | Back alignment and structure |
| >pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 | Back alignment and structure |
| >pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 | Back alignment and structure |
| >pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 | Back alignment and structure |
| >pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 | Back alignment and structure |
| >pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 | Back alignment and structure |
| >pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 | Back alignment and structure |
| >pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 | Back alignment and structure |
| >pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 | Back alignment and structure |
| >pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 | Back alignment and structure |
| >pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 | Back alignment and structure |
| >pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 | Back alignment and structure |
| >pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 | Back alignment and structure |
| >pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 | Back alignment and structure |
| >pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 | Back alignment and structure |
| >pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 | Back alignment and structure |
| >pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 | Back alignment and structure |
| >pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 | Back alignment and structure |
| >pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 | Back alignment and structure |
| >pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 | Back alignment and structure |
| >pdb|1G29|1 Chain 1, Malk Length = 372 | Back alignment and structure |
| >pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 | Back alignment and structure |
| >pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 | Back alignment and structure |
| >pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 | Back alignment and structure |
| >pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 | Back alignment and structure |
| >pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 | Back alignment and structure |
| >pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 | Back alignment and structure |
| >pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 | Back alignment and structure |
| >pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 | Back alignment and structure |
| >pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 | Back alignment and structure |
| >pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 | Back alignment and structure |
| >pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 | Back alignment and structure |
| >pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 | Back alignment and structure |
| >pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 | Back alignment and structure |
| >pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 | Back alignment and structure |
| >pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 | Back alignment and structure |
| >pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 | Back alignment and structure |
| >pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 | Back alignment and structure |
| >pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 | Back alignment and structure |
| >pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 | Back alignment and structure |
| >pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 | Back alignment and structure |
| >pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 | Back alignment and structure |
| >pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 | Back alignment and structure |
| >pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 | Back alignment and structure |
| >pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 | Back alignment and structure |
| >pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 | Back alignment and structure |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
| >pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 | Back alignment and structure |
| >pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|3PIH|A Chain A, T. Maritima Uvra In Complex With Fluorescein-Modified Dna Length = 916 | Back alignment and structure |
| >pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 | Back alignment and structure |
| >pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 | Back alignment and structure |
| >pdb|3ZQJ|A Chain A, Mycobacterium Tuberculosis Uvra Length = 993 | Back alignment and structure |
| >pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 277 | |||
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 1e-51 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 7e-34 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 2e-26 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 2e-23 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-51 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-32 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-12 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 2e-11 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 4e-47 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 3e-29 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 2e-10 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 5e-09 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 7e-47 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 2e-28 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 4e-10 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 4e-09 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 1e-42 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 4e-25 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-11 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 9e-11 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 1e-42 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-25 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 1e-11 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-11 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 2e-42 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 1e-22 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 2e-09 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 3e-08 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 4e-42 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 9e-25 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 4e-14 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 2e-13 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 5e-41 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-40 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 1e-21 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-21 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 1e-08 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 3e-08 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 5e-08 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 1e-07 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 1e-40 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 2e-23 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 2e-10 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 9e-10 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 3e-34 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 8e-22 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 6e-11 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 7e-11 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 2e-30 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 2e-17 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 2e-08 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 2e-08 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 1e-27 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 9e-16 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 5e-19 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 6e-17 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 1e-06 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 8e-19 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 6e-07 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 8e-04 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 6e-18 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 8e-18 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 2e-04 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 2e-04 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 8e-18 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 9e-08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 8e-18 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 1e-17 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 1e-04 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 2e-17 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 7e-17 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 2e-04 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 2e-17 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 3e-17 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 5e-05 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 7e-17 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 1e-05 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 8e-17 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 7e-06 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 1e-04 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 1e-16 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 2e-06 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 1e-16 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 4e-16 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 5e-16 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 1e-04 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 1e-15 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 2e-04 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 2e-04 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 2e-15 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 1e-06 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 4e-15 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 3e-05 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 8e-15 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 3e-06 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 1e-04 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 4e-14 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 3e-06 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 8e-14 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 1e-05 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 3e-13 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 4e-13 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 6e-06 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 7e-13 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 6e-08 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 2e-12 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 2e-05 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 1e-10 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 3e-08 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 2e-10 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 6e-04 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 2e-08 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 3e-08 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 4e-08 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 5e-08 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 1e-07 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 1e-07 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 4e-07 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 4e-06 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 4e-04 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 8e-06 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 1e-05 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 4e-05 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 5e-05 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 6e-05 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 2e-04 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
Score = 170 bits (432), Expect = 1e-51
Identities = 60/81 (74%), Positives = 72/81 (88%)
Query: 62 LSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLS 121
LSGGEKQRVAIART+LKAP I+LLDEATSALDT ER IQ++L +VCA+RTTI+VAHRLS
Sbjct: 191 LSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIVVAHRLS 250
Query: 122 TIIHADEILVMHAGEIVERGS 142
T+++AD+ILV+ G IVERG
Sbjct: 251 TVVNADQILVIKDGCIVERGR 271
|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Length = 173 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 277 | |||
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 100.0 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 100.0 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.97 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.96 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.96 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.96 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.96 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.95 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.95 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.95 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.95 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.94 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.94 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.94 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.94 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.94 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.93 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.93 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.93 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.93 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.92 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.92 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.92 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.92 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.91 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.91 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.91 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.91 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.91 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.91 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.91 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.91 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.91 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.91 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.91 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.91 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.9 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.9 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.9 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.9 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.9 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.9 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.9 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.9 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.9 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.9 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.9 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.9 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.89 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.89 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.89 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.89 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.89 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.89 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.88 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.84 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.84 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.84 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.84 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.84 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.83 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.82 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.82 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.81 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.81 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.78 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.78 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.77 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.77 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.74 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 99.7 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.7 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.66 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.63 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.62 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.51 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 99.51 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.51 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.48 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 99.48 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.44 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.41 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.41 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.41 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.41 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.4 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.38 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.37 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.36 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.35 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.35 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.34 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.34 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.31 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.29 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.28 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.28 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.28 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.28 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.27 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.26 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.25 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.25 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.25 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 99.2 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.2 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 99.19 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 99.19 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.17 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.17 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.16 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.16 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.16 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.13 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.12 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.1 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.04 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.04 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.02 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.02 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.01 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 99.01 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 98.99 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 98.99 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.96 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.94 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 98.92 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.91 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.86 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.85 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 98.78 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 98.77 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 98.7 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.69 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.65 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 98.64 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 98.59 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 98.57 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 98.52 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.52 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.42 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 98.41 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.4 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 98.36 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.36 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 98.35 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 98.28 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 98.28 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 98.23 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 98.22 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.17 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 98.1 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 98.09 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.98 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.97 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.96 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 97.93 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.92 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.91 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.91 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.89 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 97.89 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.81 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.79 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.76 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.75 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.74 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 97.7 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.69 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.68 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.63 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.58 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.58 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.51 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.48 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 97.45 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.45 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.43 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.43 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.42 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.42 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.41 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.4 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.4 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.36 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.36 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 97.34 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.33 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.33 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 97.29 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 97.23 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.17 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.14 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.11 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.04 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.04 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.0 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.99 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.92 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.87 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.83 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.75 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.72 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.7 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 96.69 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.66 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.66 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.66 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.63 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 96.62 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.59 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 96.59 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.57 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.55 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.55 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.52 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 96.51 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.48 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.46 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 96.46 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.41 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.4 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.39 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.38 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.37 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 96.32 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.21 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 96.2 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.14 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.12 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.11 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.08 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.96 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.93 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.91 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.85 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 95.84 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.81 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.73 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.58 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.55 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 95.47 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.41 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.31 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 95.28 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.21 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.21 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.2 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 95.16 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 95.03 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.98 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.95 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 94.89 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 94.82 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 94.81 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.73 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.69 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.69 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.62 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 94.39 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.37 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 94.27 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 94.16 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 94.09 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 94.06 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 94.03 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 94.02 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.98 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 93.96 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 93.95 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 93.89 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 93.87 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 93.71 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 93.55 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 93.49 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 93.37 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 93.36 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 93.35 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 93.07 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 92.89 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 92.75 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 92.68 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 92.68 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 92.46 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 92.46 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 92.46 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 92.34 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 92.13 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 92.05 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.96 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 91.79 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 91.69 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 91.69 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 91.56 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 91.18 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 91.18 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 91.12 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 91.05 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 90.75 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.75 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 90.39 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 90.03 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 90.02 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 89.77 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 89.72 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 89.57 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 89.48 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 89.41 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 89.1 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 88.66 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 88.62 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.47 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 88.38 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 88.04 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 87.94 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 87.68 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 87.65 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 87.34 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 87.27 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 87.25 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 87.18 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 86.94 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 86.91 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 86.58 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 86.52 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 86.41 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 86.29 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 86.27 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 86.09 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 86.04 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 85.76 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 85.67 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 85.34 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 85.2 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 85.2 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 85.1 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 84.97 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 84.64 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 84.57 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 84.42 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 84.3 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 84.18 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 84.17 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 84.13 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 84.07 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 84.06 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 83.76 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 83.48 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 83.15 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 83.03 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 82.97 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 82.79 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 82.77 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 82.68 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 82.19 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 82.17 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 81.93 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 81.91 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 81.88 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 81.88 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 81.8 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 81.52 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 81.45 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 81.37 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 81.35 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 81.29 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 81.13 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 81.1 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 80.93 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 80.85 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 80.76 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 80.72 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 80.72 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 80.55 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 80.49 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 80.47 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 80.17 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 80.14 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 80.11 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 80.1 |
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
Probab=100.00 E-value=8e-34 Score=304.94 Aligned_cols=140 Identities=44% Similarity=0.682 Sum_probs=123.9
Q ss_pred ccHHHhhcccccccCCCCC-ccccccCceEEEeeeeeeeCc--hHHhhcccCcccccCCeeec-----------------
Q psy18009 2 ENMFDLLQETCDVIDIPQA-PMLCVAQGAVEFRNVSFSYTP--ERAILKNISFTVPAGKTLAL----------------- 61 (277)
Q Consensus 2 ~~i~~~~~~~~~~~~~~~~-~~~~~~~g~i~~~nvsf~Y~~--~~~vL~~l~l~i~~~~~v~~----------------- 61 (277)
+|+++++++++++++.+.. ....+..|.|+|+||+|+|+. +..+|++++|++.+|+.++.
T Consensus 387 ~ri~~~l~~~~~~~~~~~~~~~~~~~~g~I~~~nvsF~Y~~~~~~~vL~~isl~i~~G~~vaivG~sGsGKSTll~ll~~ 466 (1321)
T 4f4c_A 387 SGIYEVLDRKPVIDSSSKAGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLR 466 (1321)
T ss_dssp HHHHHHTTTSCCSSCSSSCCCCCCCCCCCEEEEEEEECCSSSTTSCSEEEEEEEECTTCEEEEEECSSSCHHHHHHHHTT
T ss_pred HHHHHHHcCCccccccccccccCCCCCCcEEEEEeeeeCCCCCCCceeeceEEeecCCcEEEEEecCCCcHHHHHHHhcc
Confidence 6899999998886654332 233445788999999999974 45799999999999998864
Q ss_pred --------------------------------------------------------------------------------
Q psy18009 62 -------------------------------------------------------------------------------- 61 (277)
Q Consensus 62 -------------------------------------------------------------------------------- 61 (277)
T Consensus 467 ~~~~~~G~I~idG~~i~~~~~~~lr~~i~~v~Q~~~Lf~~TI~eNI~~g~~~~~~~~v~~a~~~a~l~~~i~~lp~G~~T 546 (1321)
T 4f4c_A 467 YYDVLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNT 546 (1321)
T ss_dssp SSCCSEEEEEETTEETTTSCHHHHHHHEEEECSSCCCCSEEHHHHHHTTCTTCCHHHHHHHHHHTTCHHHHHHSTTTTSS
T ss_pred ccccccCcccCCCccchhccHHHHhhcccccCCcceeeCCchhHHHhhhcccchHHHHHHHHHHccchhHHHcCCCCCcc
Confidence
Q ss_pred --------cCHHHHHHHHHHHHhccCCCEEEEecCCCCCCHHHHHHHHHHHHHHhcCceEEEEecCcchhccCceEEEee
Q psy18009 62 --------LSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLSTIIHADEILVMH 133 (277)
Q Consensus 62 --------LSgGqrQrv~IAral~~~p~ilILDEPTa~LD~~~~~~l~~~l~~l~~~~tiIiIsH~l~ev~~~Drv~vL~ 133 (277)
||||||||++||||++++|+|||||||||+||+++...+.+.|+++.+++|+|+||||++.+..||+|+||+
T Consensus 547 ~vGe~G~~LSGGQkQRiaiARAl~~~~~IliLDE~tSaLD~~te~~i~~~l~~~~~~~T~iiiaHrls~i~~aD~Iivl~ 626 (1321)
T 4f4c_A 547 LVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTTIIIAHRLSTIRNADLIISCK 626 (1321)
T ss_dssp EESSSSCCCCHHHHHHHHHHHHHTTCCSEEEEESTTTTSCTTTHHHHHHHHHHHHTTSEEEEECSCTTTTTTCSEEEEEE
T ss_pred EecCCCCCCCHHHHHHHHHHHHHccCCCEEEEecccccCCHHHHHHHHHHHHHHhCCCEEEEEcccHHHHHhCCEEEEee
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcEEEEec
Q psy18009 134 AGEIVERG 141 (277)
Q Consensus 134 dG~iv~~g 141 (277)
+|++++.|
T Consensus 627 ~G~ive~G 634 (1321)
T 4f4c_A 627 NGQVVEVG 634 (1321)
T ss_dssp TTEEEEEE
T ss_pred CCeeeccC
Confidence 99998443
|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 277 | ||||
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 2e-35 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 3e-13 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 4e-08 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 3e-07 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 1e-33 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 9e-17 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 8e-10 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 5e-09 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 5e-31 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 1e-16 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 9e-09 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 1e-07 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 4e-30 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 2e-15 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 2e-07 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 1e-06 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 2e-28 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 7e-12 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 4e-06 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 4e-05 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 1e-27 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 3e-17 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 2e-08 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 8e-08 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 3e-23 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 4e-09 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 2e-18 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 7e-09 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 6e-04 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 1e-17 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 4e-07 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 1e-17 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 7e-06 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 9e-04 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 1e-17 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 7e-09 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 0.002 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 2e-17 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 1e-08 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 4e-17 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 0.004 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 6e-17 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 7e-10 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 3e-04 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 7e-15 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 2e-07 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 2e-05 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 4e-04 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 2e-14 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 2e-07 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 9e-05 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 0.001 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 3e-14 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 5e-07 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 2e-04 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 0.004 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 6e-11 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 2e-07 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 3e-04 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 1e-10 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 1e-06 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 0.002 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-10 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 3e-10 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 2e-09 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 4e-10 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 4e-09 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 9e-08 |
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Multidrug resistance ABC transporter MsbA, C-terminal domain species: Salmonella typhimurium [TaxId: 90371]
Score = 125 bits (316), Expect = 2e-35
Identities = 49/81 (60%), Positives = 68/81 (83%)
Query: 62 LSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLS 121
LSGG++QR+AIAR LL+ I++LDEATSALDT++ER IQ+AL+ + +RT++++AHRLS
Sbjct: 153 LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS 212
Query: 122 TIIHADEILVMHAGEIVERGS 142
TI ADEI+V+ G IVERG+
Sbjct: 213 TIEQADEIVVVEDGIIVERGT 233
|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 277 | |||
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.97 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.97 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.97 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.97 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.97 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.96 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.96 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.96 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.95 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.95 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.95 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.95 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.95 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.95 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.95 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.95 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.93 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.93 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.91 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.85 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.6 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.33 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.33 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.31 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.31 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.3 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.3 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.29 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.28 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.28 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.27 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.27 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.26 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.26 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.24 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.21 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.17 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.17 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.17 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.91 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 98.88 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 98.87 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 98.63 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 98.44 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.25 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.84 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.36 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 94.79 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.46 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 92.44 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.02 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 91.99 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.99 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.77 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 91.55 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 91.24 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 91.21 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.89 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.89 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 90.8 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 90.7 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 90.56 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 90.52 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.07 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 89.7 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 89.14 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 89.03 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 88.93 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 88.75 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 88.07 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 88.01 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 87.94 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 87.91 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 86.93 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 86.91 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 86.47 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 86.33 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 86.19 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 85.98 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 85.96 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 85.78 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 85.47 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 85.42 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 85.41 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 85.19 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 85.06 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 84.7 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 84.6 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 84.55 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 84.54 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 84.5 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 84.35 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 84.25 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 84.25 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 84.19 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 83.88 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 83.48 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 83.42 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 83.38 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 83.32 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 83.28 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 82.88 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 82.78 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 82.52 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 82.22 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.09 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 82.06 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 81.83 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 81.8 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 81.76 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 81.62 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 81.48 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 81.45 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 81.1 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 80.88 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 80.85 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 80.79 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 80.56 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 80.47 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 80.47 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 80.07 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 80.01 |
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Multidrug resistance ABC transporter MsbA, C-terminal domain species: Salmonella typhimurium [TaxId: 90371]
Probab=99.97 E-value=3.7e-31 Score=236.88 Aligned_cols=87 Identities=57% Similarity=0.817 Sum_probs=82.2
Q ss_pred cCHHHHHHHHHHHHhccCCCEEEEecCCCCCCHHHHHHHHHHHHHHhcCceEEEEecCcchhccCceEEEeeCcEEEEec
Q psy18009 62 LSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLSTIIHADEILVMHAGEIVERG 141 (277)
Q Consensus 62 LSgGqrQrv~IAral~~~p~ilILDEPTa~LD~~~~~~l~~~l~~l~~~~tiIiIsH~l~ev~~~Drv~vL~dG~iv~~g 141 (277)
|||||||||+|||||+++|+|||||||||+||+.+...+++.|+++.++.|+|+|||+++.+..||||+||++|++++.|
T Consensus 153 LSGGqkQRvaiARal~~~p~ililDEpts~LD~~~~~~i~~~l~~l~~~~Tvi~itH~l~~~~~~D~v~vl~~G~Iv~~G 232 (253)
T d3b60a1 153 LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERG 232 (253)
T ss_dssp SCHHHHHHHHHHHHHHHCCSEEEEETTTSSCCHHHHHHHHHHHHHHHTTSEEEEECSCGGGTTTCSEEEEEETTEEEEEE
T ss_pred cCHHHHHHHHHHHHHhcCCCEEEeccccccCCHHHHHHHHHHHHHhccCCEEEEEECCHHHHHhCCEEEEEECCEEEEEC
Confidence 89999999999999999999999999999999999999999999998888999999999988779999999999999999
Q ss_pred Cceeeeh
Q psy18009 142 SLFVSLL 148 (277)
Q Consensus 142 ~~~~~~~ 148 (277)
++...+.
T Consensus 233 ~~~eLl~ 239 (253)
T d3b60a1 233 THSELLA 239 (253)
T ss_dssp CHHHHHH
T ss_pred CHHHHHh
Confidence 9865443
|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|