Psyllid ID: psy2029


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MVQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVLE
ccccccEEEEccccccHHHHHHHHHcccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEcc
ccccccEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcHHHHcHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHHcccEEEEcc
mvqnkncvlsiptsggktLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIqnkncvlsiptsggktLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVLE
mvqnkncvlsiptsggktlVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVLE
MVQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVLE
******CVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEV**
MVQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVL*
MVQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVLE
***NKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEGKCLEMIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKFYLEVLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q2VPA6 1069 Helicase POLQ-like OS=Mus yes N/A 0.456 0.058 0.492 3e-11
Q8TDG4 1101 Helicase POLQ-like OS=Hom yes N/A 0.456 0.057 0.460 2e-09
O75417 2590 DNA polymerase theta OS=H no N/A 0.565 0.030 0.389 1e-08
Q5JGV6 1125 Putative ski2-type helica yes N/A 0.398 0.048 0.381 2e-05
Q58524 1195 Putative ski2-type helica yes N/A 0.434 0.050 0.369 4e-05
O73946 720 Putative ski2-type helica yes N/A 0.384 0.073 0.358 0.0001
Q97AI2 674 Putative ski2-type helica yes N/A 0.398 0.081 0.428 0.0002
>sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=2 SV=2 Back     alignment and function desciption
 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%)

Query: 3   QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFKF 62
           + KN + S+PTSGGKTLV EIL+++EL  +QK  + ILPY+++V EK  SL+    E  F
Sbjct: 310 ERKNLIYSLPTSGGKTLVAEILMLQELLCRQKDVLMILPYVAIVQEKISSLSSFGIELGF 369

Query: 63  YLE 65
           ++E
Sbjct: 370 FVE 372




DNA-dependent ATPase and 5' to 3' DNA helicase.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 Back     alignment and function description
>sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 Back     alignment and function description
>sp|Q5JGV6|HELS_PYRKO Putative ski2-type helicase OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1332 PE=3 SV=1 Back     alignment and function description
>sp|Q58524|HELS_METJA Putative ski2-type helicase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1124 PE=3 SV=1 Back     alignment and function description
>sp|O73946|HELS_PYRFU Putative ski2-type helicase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0677 PE=1 SV=1 Back     alignment and function description
>sp|Q97AI2|HELS_THEVO Putative ski2-type helicase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0828 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
198437907 1014 PREDICTED: similar to DNA helicase HEL30 0.536 0.072 0.480 7e-12
449662379 886 PREDICTED: helicase POLQ-like [Hydra mag 0.456 0.071 0.555 8e-12
443734649 820 hypothetical protein CAPTEDRAFT_161173 [ 0.739 0.124 0.405 1e-11
256074218 923 DNA polymerase theta [Schistosoma manson 0.652 0.097 0.439 2e-11
350645162 923 DNA polymerase theta, putative [Schistos 0.652 0.097 0.439 3e-11
47210458 969 unnamed protein product [Tetraodon nigro 0.485 0.069 0.573 4e-11
348532301 993 PREDICTED: helicase POLQ [Oreochromis ni 0.456 0.063 0.571 5e-11
193659627 825 PREDICTED: helicase POLQ-like isoform 1 0.768 0.128 0.378 7e-11
410904054 1016 PREDICTED: helicase POLQ-like [Takifugu 0.485 0.065 0.544 2e-10
432953220 932 PREDICTED: helicase POLQ-like, partial [ 0.456 0.067 0.523 2e-10
>gi|198437907|ref|XP_002120889.1| PREDICTED: similar to DNA helicase HEL308 [Ciona intestinalis] Back     alignment and taxonomy information
 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 3/77 (3%)

Query: 62  FYLEGKCLEMI---QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHE 118
           +  + KCL +    + +N + S+PTSGGKTLV EILI +EL  K+K A+F+LP++++V E
Sbjct: 257 YDWQHKCLTLDGVKEGRNLIYSLPTSGGKTLVAEILIFRELLCKKKDAVFVLPFVAIVQE 316

Query: 119 KYQSLAKAAEEFKFYLE 135
           K QSLA+ A E  F +E
Sbjct: 317 KIQSLAQFAVELGFLVE 333




Source: Ciona intestinalis

Species: Ciona intestinalis

Genus: Ciona

Family: Cionidae

Order: Enterogona

Class: Ascidiacea

Phylum: Chordata

Superkingdom: Eukaryota

>gi|449662379|ref|XP_002160420.2| PREDICTED: helicase POLQ-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|443734649|gb|ELU18559.1| hypothetical protein CAPTEDRAFT_161173 [Capitella teleta] Back     alignment and taxonomy information
>gi|256074218|ref|XP_002573423.1| DNA polymerase theta [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|350645162|emb|CCD60104.1| DNA polymerase theta, putative [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|47210458|emb|CAF94327.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|348532301|ref|XP_003453645.1| PREDICTED: helicase POLQ [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|193659627|ref|XP_001943294.1| PREDICTED: helicase POLQ-like isoform 1 [Acyrthosiphon pisum] gi|328698000|ref|XP_003240510.1| PREDICTED: helicase POLQ-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|410904054|ref|XP_003965508.1| PREDICTED: helicase POLQ-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|432953220|ref|XP_004085307.1| PREDICTED: helicase POLQ-like, partial [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
UNIPROTKB|J9P160 1072 HELQ "Uncharacterized protein" 0.811 0.104 0.346 6.1e-11
UNIPROTKB|E2RST3 1106 HELQ "Uncharacterized protein" 0.811 0.101 0.346 6.4e-11
MGI|MGI:2176740 1069 Helq "helicase, POLQ-like" [Mu 0.826 0.106 0.352 1.1e-11
WB|WBGene00021905 923 helq-1 [Caenorhabditis elegans 0.615 0.092 0.358 2.4e-11
UNIPROTKB|Q8TDG4 1101 HELQ "Helicase POLQ-like" [Hom 0.811 0.101 0.346 1.7e-10
ZFIN|ZDB-GENE-060503-421 1010 helq "helicase, POLQ-like" [Da 0.666 0.091 0.434 6.2e-12
UNIPROTKB|E9PSY5 805 Helq "Protein Helq" [Rattus no 0.826 0.141 0.352 7.5e-12
UNIPROTKB|E9PT19 879 Helq "Protein Helq" [Rattus no 0.826 0.129 0.352 8.5e-12
UNIPROTKB|F1RVE2 1103 HELQ "Uncharacterized protein" 0.826 0.103 0.360 1.9e-11
FB|FBgn0002899 1051 mus301 "mutagen-sensitive 301" 0.826 0.108 0.322 1.8e-11
UNIPROTKB|J9P160 HELQ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 6.1e-11, P = 6.1e-11
 Identities = 43/124 (34%), Positives = 72/124 (58%)

Query:    22 EILIMKELKIKQK----SAIFILPYISL---VHEKYQSLAKAAEEFKFYLEGKCLEM--I 72
             E L+ +E+ + +K    S+  + P+ SL   V + Y    K  E+  +  +  CL +  +
Sbjct:   264 ETLLSEEINVAKKAIESSSDDLGPFYSLPTKVRDLYVQF-KGIEKL-YEWQHTCLTLNSV 321

Query:    73 QN-KNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFK 131
             Q  KN + S+PTSGGKTLV EIL+++EL  +++  + ILPY+++V EK   L+    E  
Sbjct:   322 QERKNLIYSLPTSGGKTLVAEILMLQELLCRRRDVLMILPYVAIVQEKISGLSSFGIELG 381

Query:   132 FYLE 135
             F++E
Sbjct:   382 FFVE 385


GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|E2RST3 HELQ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2176740 Helq "helicase, POLQ-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00021905 helq-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDG4 HELQ "Helicase POLQ-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-421 helq "helicase, POLQ-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSY5 Helq "Protein Helq" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT19 Helq "Protein Helq" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVE2 HELQ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0002899 mus301 "mutagen-sensitive 301" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 3e-09
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 3e-09
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 2e-07
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 3e-07
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 3e-07
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 3e-07
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 5e-06
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-05
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 1e-04
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 1e-04
COG1111 542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 0.004
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
 Score = 53.5 bits (129), Expect = 3e-09
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 4   NKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAE 58
           ++N ++S PT  GKTL+  + I+  L       ++I+P  +L  EKY+  ++  E
Sbjct: 47  DENVLISAPTGSGKTLIALLAILSTLLEGGGKVVYIVPLKALAEEKYEEFSRLEE 101


Length = 766

>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.6
COG1204 766 Superfamily II helicase [General function predicti 99.59
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.59
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.58
KOG0952|consensus 1230 99.58
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.57
PRK02362 737 ski2-like helicase; Provisional 99.56
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.55
PRK00254 720 ski2-like helicase; Provisional 99.55
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.55
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.54
COG1204 766 Superfamily II helicase [General function predicti 99.53
KOG0330|consensus 476 99.53
COG1205 851 Distinct helicase family with a unique C-terminal 99.53
PTZ00110 545 helicase; Provisional 99.52
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.51
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.51
PTZ00424 401 helicase 45; Provisional 99.49
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.49
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.48
PRK01172 674 ski2-like helicase; Provisional 99.46
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.44
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.43
KOG0952|consensus 1230 99.4
COG1202 830 Superfamily II helicase, archaea-specific [General 99.38
KOG0348|consensus 708 99.37
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.37
KOG0350|consensus 620 99.37
KOG0345|consensus 567 99.35
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.35
KOG0338|consensus 691 99.35
PRK13767 876 ATP-dependent helicase; Provisional 99.34
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.33
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.33
KOG0331|consensus 519 99.32
KOG0340|consensus 442 99.31
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.3
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.3
PRK13767 876 ATP-dependent helicase; Provisional 99.29
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.29
PTZ00110 545 helicase; Provisional 99.29
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.29
PRK02362 737 ski2-like helicase; Provisional 99.29
PRK00254 720 ski2-like helicase; Provisional 99.28
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.28
PRK09401 1176 reverse gyrase; Reviewed 99.27
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.27
KOG0330|consensus 476 99.26
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.25
COG1205 851 Distinct helicase family with a unique C-terminal 99.25
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.25
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.24
PTZ00424 401 helicase 45; Provisional 99.23
KOG0951|consensus 1674 99.23
KOG0348|consensus 708 99.23
KOG0354|consensus 746 99.22
KOG0350|consensus 620 99.22
KOG0343|consensus 758 99.22
KOG0346|consensus 569 99.21
KOG0342|consensus 543 99.21
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.2
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.2
KOG0344|consensus 593 99.2
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.19
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.19
KOG0343|consensus 758 99.19
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.18
KOG0331|consensus 519 99.18
KOG0346|consensus 569 99.17
PRK01172 674 ski2-like helicase; Provisional 99.17
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.16
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.15
KOG0335|consensus 482 99.15
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.15
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.15
PRK14701 1638 reverse gyrase; Provisional 99.14
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.13
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.12
KOG0347|consensus 731 99.11
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.11
KOG0345|consensus 567 99.07
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.07
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.07
PRK10689 1147 transcription-repair coupling factor; Provisional 99.06
KOG0333|consensus 673 99.06
KOG0948|consensus 1041 99.06
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.05
PRK09401 1176 reverse gyrase; Reviewed 99.04
KOG0334|consensus 997 99.03
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.02
KOG0950|consensus 1008 99.0
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.0
KOG0342|consensus 543 99.0
COG1202 830 Superfamily II helicase, archaea-specific [General 98.99
PHA02558 501 uvsW UvsW helicase; Provisional 98.99
KOG0335|consensus 482 98.99
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.99
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.99
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.98
KOG0344|consensus 593 98.94
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 98.93
KOG0947|consensus 1248 98.92
KOG0354|consensus 746 98.91
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.91
KOG0337|consensus 529 98.91
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.9
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.9
PRK14701 1638 reverse gyrase; Provisional 98.9
KOG0951|consensus 1674 98.88
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.88
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.87
PRK13766 773 Hef nuclease; Provisional 98.87
KOG0947|consensus 1248 98.87
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.86
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 98.85
PHA02558 501 uvsW UvsW helicase; Provisional 98.84
KOG0340|consensus 442 98.83
PRK10689 1147 transcription-repair coupling factor; Provisional 98.83
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.83
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.81
KOG0326|consensus 459 98.81
KOG0948|consensus 1041 98.79
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.78
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.78
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.77
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.76
KOG0338|consensus 691 98.76
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.75
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.75
KOG0328|consensus 400 98.74
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.74
KOG4284|consensus 980 98.73
PRK13766 773 Hef nuclease; Provisional 98.73
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.72
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.71
KOG0334|consensus 997 98.7
KOG0341|consensus 610 98.7
PRK05580 679 primosome assembly protein PriA; Validated 98.66
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.66
PRK05580 679 primosome assembly protein PriA; Validated 98.64
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 98.64
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 98.64
KOG0327|consensus 397 98.62
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.61
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.61
KOG0347|consensus 731 98.6
KOG0339|consensus 731 98.59
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.59
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.56
smart00487 201 DEXDc DEAD-like helicases superfamily. 98.55
KOG0949|consensus 1330 98.55
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 98.55
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 98.54
KOG0329|consensus 387 98.54
KOG0337|consensus 529 98.54
KOG0352|consensus 641 98.53
KOG0339|consensus 731 98.51
KOG0950|consensus 1008 98.5
PRK09694 878 helicase Cas3; Provisional 98.5
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 98.48
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.48
smart00487201 DEXDc DEAD-like helicases superfamily. 98.46
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 98.46
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 98.46
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.46
PRK09694 878 helicase Cas3; Provisional 98.46
KOG0332|consensus 477 98.44
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.43
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.41
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.4
KOG0336|consensus 629 98.4
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.39
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.39
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.39
KOG0351|consensus 941 98.38
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.38
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.37
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.33
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.33
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.32
PHA02653 675 RNA helicase NPH-II; Provisional 98.3
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.29
PHA02653 675 RNA helicase NPH-II; Provisional 98.29
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.29
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.29
KOG0341|consensus 610 98.28
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.27
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.26
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 98.25
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.24
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.22
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 98.21
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.2
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.19
KOG0336|consensus 629 98.18
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.17
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.14
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.13
PF1324576 AAA_19: Part of AAA domain 98.12
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.11
KOG0352|consensus 641 98.11
KOG0333|consensus 673 98.09
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.09
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.09
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.09
KOG0328|consensus 400 98.08
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.05
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 98.01
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 98.0
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.98
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.96
KOG0332|consensus 477 97.94
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.93
KOG0353|consensus 695 97.93
KOG0353|consensus 695 97.93
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.91
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.9
KOG0949|consensus 1330 97.87
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 97.87
COG4096 875 HsdR Type I site-specific restriction-modification 97.83
PRK04328249 hypothetical protein; Provisional 97.82
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.81
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.8
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.79
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.79
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.79
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.75
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 97.73
KOG0327|consensus 397 97.71
PRK12904 830 preprotein translocase subunit SecA; Reviewed 97.71
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.7
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.69
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.64
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.61
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.61
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.6
KOG0326|consensus 459 97.59
PF1324576 AAA_19: Part of AAA domain 97.56
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.56
KOG0351|consensus 941 97.56
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 97.55
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.52
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.51
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 97.51
PRK06835329 DNA replication protein DnaC; Validated 97.48
cd01394218 radB RadB. The archaeal protein radB shares simila 97.47
PF07517 266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.44
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.42
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.42
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.41
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 97.41
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.39
PRK15483 986 type III restriction-modification system StyLTI en 97.39
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.38
PRK08181269 transposase; Validated 97.36
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.34
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.34
PRK08116268 hypothetical protein; Validated 97.3
KOG4284|consensus 980 97.29
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.29
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.29
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.29
PRK09302 509 circadian clock protein KaiC; Reviewed 97.28
COG4096 875 HsdR Type I site-specific restriction-modification 97.28
KOG0329|consensus 387 97.28
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.26
TIGR00665434 DnaB replicative DNA helicase. This model describe 97.2
PRK06921266 hypothetical protein; Provisional 97.19
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.19
PRK06067234 flagellar accessory protein FlaH; Validated 97.18
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.17
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.15
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 97.14
PRK09354 349 recA recombinase A; Provisional 97.1
PRK09302 509 circadian clock protein KaiC; Reviewed 97.08
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.07
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 97.07
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.06
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.05
PRK05973237 replicative DNA helicase; Provisional 97.05
PRK06526254 transposase; Provisional 97.05
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.04
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 97.04
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.01
PRK12377248 putative replication protein; Provisional 97.01
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.0
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 96.99
PRK08760476 replicative DNA helicase; Provisional 96.98
PRK10867 433 signal recognition particle protein; Provisional 96.95
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.9
PRK14873 665 primosome assembly protein PriA; Provisional 96.9
PRK05748448 replicative DNA helicase; Provisional 96.86
PRK15483 986 type III restriction-modification system StyLTI en 96.85
PRK11823 446 DNA repair protein RadA; Provisional 96.84
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 96.83
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.82
PRK10536262 hypothetical protein; Provisional 96.82
PRK09183259 transposase/IS protein; Provisional 96.8
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.8
PHA02542 473 41 41 helicase; Provisional 96.78
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.72
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 96.72
PF12846 304 AAA_10: AAA-like domain 96.71
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.71
KOG1802|consensus 935 96.68
smart00382148 AAA ATPases associated with a variety of cellular 96.67
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 96.66
TIGR00959 428 ffh signal recognition particle protein. This mode 96.64
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 96.62
PRK08727233 hypothetical protein; Validated 96.59
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.57
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.54
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 96.54
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 96.51
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.51
PTZ00035337 Rad51 protein; Provisional 96.47
PRK07773 886 replicative DNA helicase; Validated 96.46
PRK08506 472 replicative DNA helicase; Provisional 96.46
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.46
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.46
PRK05636505 replicative DNA helicase; Provisional 96.44
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.42
PRK07952244 DNA replication protein DnaC; Validated 96.4
COG4889 1518 Predicted helicase [General function prediction on 96.39
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.38
CHL00122 870 secA preprotein translocase subunit SecA; Validate 96.38
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.37
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 96.37
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 96.36
PRK08939306 primosomal protein DnaI; Reviewed 96.36
PRK13851344 type IV secretion system protein VirB11; Provision 96.36
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.35
PLN03186342 DNA repair protein RAD51 homolog; Provisional 96.35
PRK05595444 replicative DNA helicase; Provisional 96.33
PRK07004460 replicative DNA helicase; Provisional 96.33
PRK08084235 DNA replication initiation factor; Provisional 96.32
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.3
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.26
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.26
cd00983 325 recA RecA is a bacterial enzyme which has roles in 96.25
PRK09165 497 replicative DNA helicase; Provisional 96.25
PRK05642234 DNA replication initiation factor; Validated 96.23
PRK04914 956 ATP-dependent helicase HepA; Validated 96.22
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.2
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.18
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 96.18
PRK14873 665 primosome assembly protein PriA; Provisional 96.17
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.1
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 96.08
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 96.03
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.02
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.02
PLN02199303 shikimate kinase 96.01
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.0
KOG0745|consensus 564 95.97
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 95.97
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 95.96
PRK13833323 conjugal transfer protein TrbB; Provisional 95.93
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.92
COG2256 436 MGS1 ATPase related to the helicase subunit of the 95.92
PRK06893229 DNA replication initiation factor; Validated 95.91
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.87
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 95.87
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.86
PF02456 369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 95.81
COG3587 985 Restriction endonuclease [Defense mechanisms] 95.8
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 95.8
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 95.78
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.74
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.72
PRK14974336 cell division protein FtsY; Provisional 95.72
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 95.7
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.69
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.69
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 95.65
TIGR03744 893 traC_PFL_4706 conjugative transfer ATPase, PFL_470 95.65
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.64
PRK06321472 replicative DNA helicase; Provisional 95.62
PRK04296190 thymidine kinase; Provisional 95.6
KOG1803|consensus 649 95.59
PF1355562 AAA_29: P-loop containing region of AAA domain 95.57
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.57
PRK13764 602 ATPase; Provisional 95.55
PRK14087 450 dnaA chromosomal replication initiation protein; P 95.53
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 95.52
PRK10436 462 hypothetical protein; Provisional 95.5
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.5
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 95.48
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.47
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 95.46
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.43
PRK11054 684 helD DNA helicase IV; Provisional 95.39
KOG4150|consensus 1034 95.36
PF12340 229 DUF3638: Protein of unknown function (DUF3638); In 95.36
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 95.35
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 95.34
cd03115173 SRP The signal recognition particle (SRP) mediates 95.33
PHA02535 581 P terminase ATPase subunit; Provisional 95.32
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.31
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 95.31
KOG0953|consensus 700 95.31
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.29
PRK08006471 replicative DNA helicase; Provisional 95.24
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.23
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.2
COG0610 962 Type I site-specific restriction-modification syst 95.19
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.19
KOG1131|consensus 755 95.16
KOG1802|consensus 935 95.15
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.14
PRK00131175 aroK shikimate kinase; Reviewed 95.11
PRK12422 445 chromosomal replication initiation protein; Provis 95.09
PRK06749428 replicative DNA helicase; Provisional 95.08
PRK10536 262 hypothetical protein; Provisional 95.08
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 95.05
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 95.0
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 94.99
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.95
KOG0953|consensus 700 94.93
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 94.89
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.87
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.87
PRK00149 450 dnaA chromosomal replication initiation protein; R 94.86
PRK11054 684 helD DNA helicase IV; Provisional 94.85
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 94.83
TIGR02746 797 TraC-F-type type-IV secretion system protein TraC. 94.79
KOG1123|consensus 776 94.78
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.77
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.76
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 94.76
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 94.76
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components 94.71
COG3587 985 Restriction endonuclease [Defense mechanisms] 94.7
PLN02165 334 adenylate isopentenyltransferase 94.69
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 94.68
KOG0390|consensus 776 94.68
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 94.66
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 94.65
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 94.65
TIGR00064272 ftsY signal recognition particle-docking protein F 94.64
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.58
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 94.57
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 94.55
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.55
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.55
PF12846 304 AAA_10: AAA-like domain 94.54
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 94.54
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.53
PF00004132 AAA: ATPase family associated with various cellula 94.51
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 94.51
PRK10416318 signal recognition particle-docking protein FtsY; 94.48
PRK14088 440 dnaA chromosomal replication initiation protein; P 94.46
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.45
PRK13700 732 conjugal transfer protein TraD; Provisional 94.45
COG0593 408 DnaA ATPase involved in DNA replication initiation 94.44
CHL00181287 cbbX CbbX; Provisional 94.43
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 94.42
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.4
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 94.38
PRK13850 670 type IV secretion system protein VirD4; Provisiona 94.38
PRK00300205 gmk guanylate kinase; Provisional 94.37
TIGR02533 486 type_II_gspE general secretory pathway protein E. 94.34
PRK13897 606 type IV secretion system component VirD4; Provisio 94.28
PRK13891 852 conjugal transfer protein TrbE; Provisional 94.28
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.26
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 94.25
KOG2028|consensus 554 94.21
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.15
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.15
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.14
PHA00729226 NTP-binding motif containing protein 94.14
PHA02244 383 ATPase-like protein 94.11
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 94.09
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 94.08
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.07
KOG1803|consensus 649 94.05
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.04
PRK13873 811 conjugal transfer ATPase TrbE; Provisional 94.04
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 94.04
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 93.99
PRK14086 617 dnaA chromosomal replication initiation protein; P 93.99
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 93.98
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 93.94
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 93.94
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 93.94
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.92
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 93.92
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 93.91
PF13173128 AAA_14: AAA domain 93.88
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.88
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.75
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 93.71
PF09439181 SRPRB: Signal recognition particle receptor beta s 93.7
COG3973 747 Superfamily I DNA and RNA helicases [General funct 93.68
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 93.67
PHA03333 752 putative ATPase subunit of terminase; Provisional 93.67
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.67
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.62
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 93.61
PRK13897 606 type IV secretion system component VirD4; Provisio 93.6
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
Probab=99.60  E-value=4.6e-15  Score=113.77  Aligned_cols=92  Identities=16%  Similarity=0.091  Sum_probs=81.4

Q ss_pred             hHHHHHHHHHHHHHhhhhhhhhHHHhhhhc-cceEEEeecCCCchHhHHHHHHHHHHh---------CCCeEEEEccchh
Q psy2029          45 LVHEKYQSLAKAAEEFKFYLEGKCLEMIQN-KNCVLSIPTSGGKTLVGEILIMKELKI---------KQKSAIFILPYIS  114 (138)
Q Consensus        45 L~~q~~~~l~~~~~~~~~~~Q~~~~~~~~~-~~~ii~~ptg~GKt~~~~~~~l~~~~~---------~~~~~~~i~P~~~  114 (138)
                      |.....+.+.+.++..+.++|.+++|.+.+ +|+++.+|||+|||+++++++++.+..         .+.++++++|+++
T Consensus        15 l~~~l~~~l~~~g~~~pt~iQ~~aip~il~g~dvi~~ApTGsGKTla~llp~l~~l~~~~~~~~~~~~~~~~lil~Ptre   94 (423)
T PRK04837         15 LHPQVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKTMAFLTATFHYLLSHPAPEDRKVNQPRALIMAPTRE   94 (423)
T ss_pred             CCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCcEEEECCCCchHHHHHHHHHHHHHHhcccccccccCCceEEEECCcHH
Confidence            456778888888899999999999998888 999999999999999999999998864         1357999999999


Q ss_pred             HHHHHHHHHHHHhhhcCceeee
Q psy2029         115 LVHEKYQSLAKAAEEFKFYLEV  136 (138)
Q Consensus       115 l~~q~~~~~~~~~~~~~~~v~~  136 (138)
                      |+.|+++.+..+....|+++..
T Consensus        95 La~Qi~~~~~~l~~~~~~~v~~  116 (423)
T PRK04837         95 LAVQIHADAEPLAQATGLKLGL  116 (423)
T ss_pred             HHHHHHHHHHHHhccCCceEEE
Confidence            9999999999999888887654



>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 9e-06
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 3e-05
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 9e-06, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 35/53 (66%) Query: 71 MIQNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSL 123 +++ KN ++SIPT+ GKTL+ EI ++ + + A++I+P +L EK+Q Sbjct: 36 ILEGKNALISIPTASGKTLIAEIAMVHRILTQGGKAVYIVPLKALAEEKFQEF 88
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-16
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 5e-16
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 5e-12
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 7e-12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-12
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 9e-07
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 7e-06
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 2e-06
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 9e-06
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-05
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 4e-05
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 3e-05
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 6e-04
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 9e-05
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 2e-04
3b6e_A216 Interferon-induced helicase C domain-containing P; 2e-04
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-04
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
 Score = 73.2 bits (180), Expect = 3e-16
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 67  KCLEMI--QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLA 124
           + ++    +    +L+ PT  GKTL+ E+ I+  L      AI++ P  +L +EKY +  
Sbjct: 37  EAVKKGLLEGNRLLLTSPTGSGKTLIAEMGIISFLLKNGGKAIYVTPLRALTNEKYLTFK 96

Query: 125 KAAE 128
               
Sbjct: 97  DWEL 100


>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.64
3ly5_A 262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.63
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.63
3ber_A 249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.6
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.59
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 99.59
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.59
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.58
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.58
2oxc_A 230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.58
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.56
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 99.56
3bor_A 237 Human initiation factor 4A-II; translation initiat 99.55
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.55
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.55
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.54
3fmo_B 300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.53
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.52
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.5
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.49
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.49
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.48
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.47
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.46
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.46
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.45
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.44
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.44
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.43
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.43
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.43
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.41
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.41
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.39
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.39
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.38
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.38
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.38
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.37
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.35
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.35
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.35
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.34
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.33
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.31
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.29
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.29
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.28
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.28
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.28
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.27
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.27
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.27
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.26
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.25
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.25
3bor_A237 Human initiation factor 4A-II; translation initiat 99.25
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.24
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.24
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.23
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.23
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.22
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.21
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.21
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.21
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.2
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.19
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.19
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.19
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.19
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.17
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.17
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.17
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.16
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.15
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.14
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.14
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.13
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.13
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.12
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.12
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.12
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.11
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.11
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.11
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.1
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.1
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.1
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.1
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.1
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.09
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.09
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.09
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.08
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.08
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.07
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.07
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.07
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.06
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.06
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.05
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.05
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.04
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.04
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.03
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.03
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.02
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.01
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.0
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.99
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.99
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.99
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.98
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.97
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.96
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.95
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.94
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.94
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.94
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.94
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.93
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.92
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.92
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.91
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.88
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.87
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.84
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.83
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.79
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.78
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.77
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.76
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.73
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.72
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.72
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.71
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.7
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.66
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.65
3h1t_A 590 Type I site-specific restriction-modification syst 98.62
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.59
3h1t_A 590 Type I site-specific restriction-modification syst 98.54
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.51
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.43
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.39
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.39
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.36
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.35
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.35
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.32
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.23
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.18
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.12
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.03
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.91
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 97.81
3jux_A 822 Protein translocase subunit SECA; protein transloc 97.58
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.55
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.49
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.45
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 97.35
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.23
2z43_A324 DNA repair and recombination protein RADA; archaea 97.19
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.18
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.04
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.92
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.92
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.86
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.85
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.81
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.8
2r6a_A 454 DNAB helicase, replicative helicase; replication, 96.76
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.75
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.74
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.73
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.73
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.73
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.62
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 96.62
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.6
3io5_A 333 Recombination and repair protein; storage dimer, i 96.58
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.56
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.56
2qgz_A308 Helicase loader, putative primosome component; str 96.52
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.48
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.44
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.31
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.3
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.25
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 96.17
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.14
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.11
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.11
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.08
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.08
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.01
2o0j_A 385 Terminase, DNA packaging protein GP17; nucleotide- 95.98
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.98
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 95.98
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 95.93
3bos_A242 Putative DNA replication factor; P-loop containing 95.93
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 95.93
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.91
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.85
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.83
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.83
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 95.8
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.8
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.77
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.74
3co5_A143 Putative two-component system transcriptional RES 95.7
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.64
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.6
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.59
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 95.54
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.53
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.45
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.35
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.27
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.22
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 95.22
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 95.21
2eyu_A 261 Twitching motility protein PILT; pilus retraction 95.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.12
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.02
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.01
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.0
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.99
1p9r_A 418 General secretion pathway protein E; bacterial typ 94.9
1u94_A 356 RECA protein, recombinase A; homologous recombinat 94.88
2ewv_A 372 Twitching motility protein PILT; pilus retraction 94.86
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.85
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 94.82
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 94.77
3bs4_A 260 Uncharacterized protein PH0321; structural genomic 94.77
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 94.72
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.67
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.65
1xp8_A 366 RECA protein, recombinase A; recombination, radior 94.64
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 94.51
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.49
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.43
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.42
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 94.42
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 94.41
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.37
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.31
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.3
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.3
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 94.28
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.27
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 94.26
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.24
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 94.19
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.17
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.17
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.15
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.14
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.11
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 94.06
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.04
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 94.03
2xxa_A 433 Signal recognition particle protein; protein trans 94.03
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.99
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.98
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.87
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 93.81
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.79
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 93.77
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 93.71
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.71
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 93.69
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 93.69
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.66
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.64
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 93.59
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.55
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 93.47
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.47
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.43
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 93.35
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.35
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.34
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 93.34
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 93.34
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.31
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 93.3
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.26
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.26
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 93.22
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 93.21
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.17
2r44_A 331 Uncharacterized protein; putative ATPase, structur 93.1
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 93.07
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.07
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.07
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.04
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.03
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.02
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.01
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.01
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 92.99
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 92.99
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.95
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.93
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.9
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.9
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.9
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.88
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.86
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 92.85
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 92.8
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 92.77
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.74
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.7
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.63
2r62_A268 Cell division protease FTSH homolog; ATPase domain 92.61
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.6
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 92.56
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 92.54
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 92.51
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.49
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 92.46
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.39
3pvs_A 447 Replication-associated recombination protein A; ma 92.36
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 92.34
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.26
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.24
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 92.19
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.18
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.14
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 92.14
1tue_A212 Replication protein E1; helicase, replication, E1E 92.13
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.12
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.12
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 92.12
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 92.09
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.0
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.99
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.9
2og2_A359 Putative signal recognition particle receptor; nuc 91.9
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.89
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 91.87
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.77
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 91.76
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 91.76
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 91.73
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 91.68
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.67
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 91.6
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 91.59
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 91.56
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 91.42
1xjc_A169 MOBB protein homolog; structural genomics, midwest 91.4
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.34
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 91.29
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.28
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 91.27
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.23
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.23
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 91.19
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.12
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.11
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 91.1
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 91.08
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 91.08
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 91.01
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 90.96
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.91
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.9
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 90.81
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 90.79
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 90.79
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 90.74
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 90.71
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.71
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 90.71
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 90.71
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 90.68
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 90.66
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 90.61
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 90.57
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 90.56
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 90.54
3kta_A182 Chromosome segregation protein SMC; structural mai 90.52
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 90.5
1via_A175 Shikimate kinase; structural genomics, transferase 90.44
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 90.35
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 90.2
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 90.18
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 90.15
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 90.14
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 90.08
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 89.84
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 89.74
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 89.72
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 89.71
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 89.7
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.68
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.62
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 89.59
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.49
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 89.43
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 89.43
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 89.37
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 89.3
2chq_A 319 Replication factor C small subunit; DNA-binding pr 89.28
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 89.24
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 89.2
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 89.2
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 89.2
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 89.17
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 89.12
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 89.12
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 89.05
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 89.04
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 89.01
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 88.95
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 88.94
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 88.88
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 88.82
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 88.81
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 88.74
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.68
3tlx_A243 Adenylate kinase 2; structural genomics, structura 88.62
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 88.62
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.61
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 88.53
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 88.44
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 88.43
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 88.4
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 88.39
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 88.35
2qgz_A308 Helicase loader, putative primosome component; str 88.33
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 88.22
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 88.18
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 88.16
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 88.15
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 88.13
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 88.12
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.11
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 88.09
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 88.08
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 88.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 87.93
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 87.92
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.91
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 87.85
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 87.81
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 87.81
2vli_A183 Antibiotic resistance protein; transferase, tunica 87.79
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 87.69
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 87.68
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 87.66
2r6a_A 454 DNAB helicase, replicative helicase; replication, 87.63
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 87.62
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 87.61
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 87.6
2ghi_A260 Transport protein; multidrug resistance protein, M 87.55
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 87.53
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 87.5
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 87.42
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 87.42
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 87.36
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.35
1g3q_A 237 MIND ATPase, cell division inhibitor; alpha-beta-a 87.34
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 87.32
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 87.27
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.25
1g6h_A257 High-affinity branched-chain amino acid transport 87.2
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 87.18
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 87.18
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.17
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 87.16
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 87.03
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.01
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 86.98
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 86.98
1sgw_A214 Putative ABC transporter; structural genomics, P p 86.97
3bos_A 242 Putative DNA replication factor; P-loop containing 86.97
1ji0_A240 ABC transporter; ATP binding protein, structural g 86.97
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 86.92
1hyq_A 263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 86.88
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 86.77
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 86.75
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 86.73
3nwn_A 359 Kinesin-like protein KIF9; motor domain, ADP, stru 86.71
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 86.64
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.6
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 86.53
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 86.36
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 86.3
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 86.26
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 86.15
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 86.14
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 85.98
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 85.96
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.92
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 85.91
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
Probab=99.64  E-value=7.1e-16  Score=108.77  Aligned_cols=92  Identities=24%  Similarity=0.291  Sum_probs=79.3

Q ss_pred             hHHHHHHHHHHHHHhhhhhhhhHHHhhhhc-cceEEEeecCCCchHhHHHHHHHHHHh---CCCeEEEEccchhHHHHHH
Q psy2029          45 LVHEKYQSLAKAAEEFKFYLEGKCLEMIQN-KNCVLSIPTSGGKTLVGEILIMKELKI---KQKSAIFILPYISLVHEKY  120 (138)
Q Consensus        45 L~~q~~~~l~~~~~~~~~~~Q~~~~~~~~~-~~~ii~~ptg~GKt~~~~~~~l~~~~~---~~~~~~~i~P~~~l~~q~~  120 (138)
                      |.....+.+.+.++..++++|.++++.+.+ +++++.+|||+|||+++.+++++.+..   .+.+++|++|+++|+.|++
T Consensus        36 l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~~~~~l~~a~TGsGKT~~~~l~~l~~l~~~~~~~~~~lil~Pt~~L~~q~~  115 (245)
T 3dkp_A           36 INSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIH  115 (245)
T ss_dssp             CCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSCHHHHHHHHHHHHHCSCCSSSCCEEEECSSHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCCCcHHHHHHHHHHHHHhhcccCCceEEEEeCCHHHHHHHH
Confidence            345566777777788899999999988887 999999999999999999999998864   3568999999999999999


Q ss_pred             HHHHHHhhhcCceeee
Q psy2029         121 QSLAKAAEEFKFYLEV  136 (138)
Q Consensus       121 ~~~~~~~~~~~~~v~~  136 (138)
                      +++++++...++.+..
T Consensus       116 ~~~~~~~~~~~~~~~~  131 (245)
T 3dkp_A          116 RELIKISEGTGFRIHM  131 (245)
T ss_dssp             HHHHHHTTTSCCCEEC
T ss_pred             HHHHHHhcccCceEEE
Confidence            9999998887776643



>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 9e-05
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-04
d1wp9a1 200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.001
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]
 Score = 38.4 bits (88), Expect = 9e-05
 Identities = 8/63 (12%), Positives = 25/63 (39%), Gaps = 1/63 (1%)

Query: 70  EMI-QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAE 128
           ++  + +  ++ +    GKT      I++E   +    + + P   +  E  ++L     
Sbjct: 4   DIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPI 63

Query: 129 EFK 131
            ++
Sbjct: 64  RYQ 66


>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d2j0sa1 222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.66
d2g9na1 218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.63
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 99.63
d1t6na_ 207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.6
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.56
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.56
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.55
d1hv8a1 208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.54
d1wrba1 238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.54
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.53
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.49
d1oywa2 206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.44
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.43
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.4
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.39
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.39
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.37
d1s2ma1 206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.37
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.34
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.33
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.33
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.3
d1q0ua_ 209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.25
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.25
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.17
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.17
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.15
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.08
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.04
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.02
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.98
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.98
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.95
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.95
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.94
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.88
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.88
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.83
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.83
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.73
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.85
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.56
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 97.52
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.47
d1tf5a3 273 Translocation ATPase SecA, nucleotide-binding doma 97.43
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.42
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.32
d1nkta3 288 Translocation ATPase SecA, nucleotide-binding doma 97.24
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 97.08
d1z63a1 230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.07
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.76
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.72
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.72
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.59
d1okkd2207 GTPase domain of the signal recognition particle r 96.58
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.53
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.38
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.36
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.32
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.29
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.17
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 96.1
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.05
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.0
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 95.99
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.91
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 95.91
d1vmaa2213 GTPase domain of the signal recognition particle r 95.9
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.81
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.81
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.78
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.74
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.72
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.58
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.53
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 95.52
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 95.44
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.38
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.29
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.27
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.18
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.18
d2qy9a2211 GTPase domain of the signal recognition particle r 95.17
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.14
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 95.08
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.02
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.92
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.88
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.74
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.73
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.7
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.69
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 94.67
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.62
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.62
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.58
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.57
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.5
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.49
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.39
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.3
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.28
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.24
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.23
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.08
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.82
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.78
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.74
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.62
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.54
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.47
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.42
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.3
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.28
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.24
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.08
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.0
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.98
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.96
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.89
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.84
d1svma_362 Papillomavirus large T antigen helicase domain {Si 92.74
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.66
d1ls1a2 207 GTPase domain of the signal sequence recognition p 92.58
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 92.54
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 92.5
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.37
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.3
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.18
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.05
d1vmaa2 213 GTPase domain of the signal recognition particle r 91.89
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.84
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.81
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.74
d2qy9a2 211 GTPase domain of the signal recognition particle r 91.66
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.65
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.65
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.55
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.53
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 91.5
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 91.48
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.42
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 91.32
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.27
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.26
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.26
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.1
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.05
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.94
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.88
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.86
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.57
d1j8yf2 211 GTPase domain of the signal sequence recognition p 90.53
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 90.5
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 90.44
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.42
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.39
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.26
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.1
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.09
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.08
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 90.07
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.07
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 90.02
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.99
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.88
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.57
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 89.56
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 89.14
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 89.09
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.97
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 88.97
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 88.95
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 88.91
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 88.89
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.73
d2awna2232 Maltose transport protein MalK, N-terminal domain 88.6
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 88.53
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 88.45
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 88.09
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 87.89
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.56
d1okkd2 207 GTPase domain of the signal recognition particle r 87.46
d1kaga_ 169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 87.0
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 86.96
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 86.9
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 86.89
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 86.77
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 86.73
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 86.61
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 86.52
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.51
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 86.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.34
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 86.28
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.25
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 85.78
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 85.67
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 85.44
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.19
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 85.14
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.06
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 84.81
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 84.75
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 84.7
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.51
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 84.5
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 84.43
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.31
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 84.15
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.99
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 83.96
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 83.78
d1tuea_205 Replication protein E1 helicase domain {Human papi 83.68
d1np6a_ 170 Molybdopterin-guanine dinucleotide biosynthesis pr 83.56
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.37
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 83.23
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 83.12
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 83.0
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 82.97
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 82.62
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 82.36
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.22
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.08
d1xpua3 289 Transcription termination factor Rho, ATPase domai 82.06
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 81.72
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 81.55
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 81.51
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 81.5
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 81.48
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 81.42
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.27
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 81.12
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 80.92
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 80.88
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 80.47
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 80.24
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.15
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 80.12
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=7.3e-17  Score=111.45  Aligned_cols=92  Identities=14%  Similarity=0.194  Sum_probs=83.4

Q ss_pred             hHHHHHHHHHHHHHhhhhhhhhHHHhhhhc-cceEEEeecCCCchHhHHHHHHHHHHh--CCCeEEEEccchhHHHHHHH
Q psy2029          45 LVHEKYQSLAKAAEEFKFYLEGKCLEMIQN-KNCVLSIPTSGGKTLVGEILIMKELKI--KQKSAIFILPYISLVHEKYQ  121 (138)
Q Consensus        45 L~~q~~~~l~~~~~~~~~~~Q~~~~~~~~~-~~~ii~~ptg~GKt~~~~~~~l~~~~~--~~~~~~~i~P~~~l~~q~~~  121 (138)
                      |.....+.+.+.++..+.++|..++|.+.+ +|+++.+|||+|||+++.+++++.+..  .+.++++++|+++|+.|.++
T Consensus        24 L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~PtreLa~Qi~~  103 (222)
T d2j0sa1          24 LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQK  103 (222)
T ss_dssp             CCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECSSHHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecchHHHHHHHHH
Confidence            667888999999999999999999998888 999999999999999999999998865  35689999999999999999


Q ss_pred             HHHHHhhhcCceeee
Q psy2029         122 SLAKAAEEFKFYLEV  136 (138)
Q Consensus       122 ~~~~~~~~~~~~v~~  136 (138)
                      .++++....++++..
T Consensus       104 ~~~~l~~~~~i~~~~  118 (222)
T d2j0sa1         104 GLLALGDYMNVQCHA  118 (222)
T ss_dssp             HHHHHTTTTTCCEEE
T ss_pred             HHHHHhCccceeEEE
Confidence            999999888877654



>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure