Psyllid ID: psy2029
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| 198437907 | 1014 | PREDICTED: similar to DNA helicase HEL30 | 0.536 | 0.072 | 0.480 | 7e-12 | |
| 449662379 | 886 | PREDICTED: helicase POLQ-like [Hydra mag | 0.456 | 0.071 | 0.555 | 8e-12 | |
| 443734649 | 820 | hypothetical protein CAPTEDRAFT_161173 [ | 0.739 | 0.124 | 0.405 | 1e-11 | |
| 256074218 | 923 | DNA polymerase theta [Schistosoma manson | 0.652 | 0.097 | 0.439 | 2e-11 | |
| 350645162 | 923 | DNA polymerase theta, putative [Schistos | 0.652 | 0.097 | 0.439 | 3e-11 | |
| 47210458 | 969 | unnamed protein product [Tetraodon nigro | 0.485 | 0.069 | 0.573 | 4e-11 | |
| 348532301 | 993 | PREDICTED: helicase POLQ [Oreochromis ni | 0.456 | 0.063 | 0.571 | 5e-11 | |
| 193659627 | 825 | PREDICTED: helicase POLQ-like isoform 1 | 0.768 | 0.128 | 0.378 | 7e-11 | |
| 410904054 | 1016 | PREDICTED: helicase POLQ-like [Takifugu | 0.485 | 0.065 | 0.544 | 2e-10 | |
| 432953220 | 932 | PREDICTED: helicase POLQ-like, partial [ | 0.456 | 0.067 | 0.523 | 2e-10 |
| >gi|198437907|ref|XP_002120889.1| PREDICTED: similar to DNA helicase HEL308 [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
Score = 75.5 bits (184), Expect = 7e-12, Method: Compositional matrix adjust.
Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 3/77 (3%)
Query: 62 FYLEGKCLEMI---QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHE 118
+ + KCL + + +N + S+PTSGGKTLV EILI +EL K+K A+F+LP++++V E
Sbjct: 257 YDWQHKCLTLDGVKEGRNLIYSLPTSGGKTLVAEILIFRELLCKKKDAVFVLPFVAIVQE 316
Query: 119 KYQSLAKAAEEFKFYLE 135
K QSLA+ A E F +E
Sbjct: 317 KIQSLAQFAVELGFLVE 333
|
Source: Ciona intestinalis Species: Ciona intestinalis Genus: Ciona Family: Cionidae Order: Enterogona Class: Ascidiacea Phylum: Chordata Superkingdom: Eukaryota |
| >gi|449662379|ref|XP_002160420.2| PREDICTED: helicase POLQ-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|443734649|gb|ELU18559.1| hypothetical protein CAPTEDRAFT_161173 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|256074218|ref|XP_002573423.1| DNA polymerase theta [Schistosoma mansoni] | Back alignment and taxonomy information |
|---|
| >gi|350645162|emb|CCD60104.1| DNA polymerase theta, putative [Schistosoma mansoni] | Back alignment and taxonomy information |
|---|
| >gi|47210458|emb|CAF94327.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|348532301|ref|XP_003453645.1| PREDICTED: helicase POLQ [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|193659627|ref|XP_001943294.1| PREDICTED: helicase POLQ-like isoform 1 [Acyrthosiphon pisum] gi|328698000|ref|XP_003240510.1| PREDICTED: helicase POLQ-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|410904054|ref|XP_003965508.1| PREDICTED: helicase POLQ-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|432953220|ref|XP_004085307.1| PREDICTED: helicase POLQ-like, partial [Oryzias latipes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| UNIPROTKB|J9P160 | 1072 | HELQ "Uncharacterized protein" | 0.811 | 0.104 | 0.346 | 6.1e-11 | |
| UNIPROTKB|E2RST3 | 1106 | HELQ "Uncharacterized protein" | 0.811 | 0.101 | 0.346 | 6.4e-11 | |
| MGI|MGI:2176740 | 1069 | Helq "helicase, POLQ-like" [Mu | 0.826 | 0.106 | 0.352 | 1.1e-11 | |
| WB|WBGene00021905 | 923 | helq-1 [Caenorhabditis elegans | 0.615 | 0.092 | 0.358 | 2.4e-11 | |
| UNIPROTKB|Q8TDG4 | 1101 | HELQ "Helicase POLQ-like" [Hom | 0.811 | 0.101 | 0.346 | 1.7e-10 | |
| ZFIN|ZDB-GENE-060503-421 | 1010 | helq "helicase, POLQ-like" [Da | 0.666 | 0.091 | 0.434 | 6.2e-12 | |
| UNIPROTKB|E9PSY5 | 805 | Helq "Protein Helq" [Rattus no | 0.826 | 0.141 | 0.352 | 7.5e-12 | |
| UNIPROTKB|E9PT19 | 879 | Helq "Protein Helq" [Rattus no | 0.826 | 0.129 | 0.352 | 8.5e-12 | |
| UNIPROTKB|F1RVE2 | 1103 | HELQ "Uncharacterized protein" | 0.826 | 0.103 | 0.360 | 1.9e-11 | |
| FB|FBgn0002899 | 1051 | mus301 "mutagen-sensitive 301" | 0.826 | 0.108 | 0.322 | 1.8e-11 |
| UNIPROTKB|J9P160 HELQ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 165 (63.1 bits), Expect = 6.1e-11, P = 6.1e-11
Identities = 43/124 (34%), Positives = 72/124 (58%)
Query: 22 EILIMKELKIKQK----SAIFILPYISL---VHEKYQSLAKAAEEFKFYLEGKCLEM--I 72
E L+ +E+ + +K S+ + P+ SL V + Y K E+ + + CL + +
Sbjct: 264 ETLLSEEINVAKKAIESSSDDLGPFYSLPTKVRDLYVQF-KGIEKL-YEWQHTCLTLNSV 321
Query: 73 QN-KNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAEEFK 131
Q KN + S+PTSGGKTLV EIL+++EL +++ + ILPY+++V EK L+ E
Sbjct: 322 QERKNLIYSLPTSGGKTLVAEILMLQELLCRRRDVLMILPYVAIVQEKISGLSSFGIELG 381
Query: 132 FYLE 135
F++E
Sbjct: 382 FFVE 385
|
|
| UNIPROTKB|E2RST3 HELQ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2176740 Helq "helicase, POLQ-like" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00021905 helq-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TDG4 HELQ "Helicase POLQ-like" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-421 helq "helicase, POLQ-like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSY5 Helq "Protein Helq" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PT19 Helq "Protein Helq" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RVE2 HELQ "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002899 mus301 "mutagen-sensitive 301" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 3e-09 | |
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 3e-09 | |
| PRK00254 | 720 | PRK00254, PRK00254, ski2-like helicase; Provisiona | 2e-07 | |
| PRK00254 | 720 | PRK00254, PRK00254, ski2-like helicase; Provisiona | 3e-07 | |
| PRK01172 | 674 | PRK01172, PRK01172, ski2-like helicase; Provisiona | 3e-07 | |
| PRK01172 | 674 | PRK01172, PRK01172, ski2-like helicase; Provisiona | 3e-07 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 5e-06 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 1e-05 | |
| PRK02362 | 737 | PRK02362, PRK02362, ski2-like helicase; Provisiona | 1e-04 | |
| PRK02362 | 737 | PRK02362, PRK02362, ski2-like helicase; Provisiona | 1e-04 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 0.004 |
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
Score = 53.5 bits (129), Expect = 3e-09
Identities = 17/55 (30%), Positives = 31/55 (56%)
Query: 4 NKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAE 58
++N ++S PT GKTL+ + I+ L ++I+P +L EKY+ ++ E
Sbjct: 47 DENVLISAPTGSGKTLIALLAILSTLLEGGGKVVYIVPLKALAEEKYEEFSRLEE 101
|
Length = 766 |
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.6 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.59 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.59 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.58 | |
| KOG0952|consensus | 1230 | 99.58 | ||
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.57 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.56 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.55 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.55 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.55 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.54 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.53 | |
| KOG0330|consensus | 476 | 99.53 | ||
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.53 | |
| PTZ00110 | 545 | helicase; Provisional | 99.52 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.51 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.51 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.49 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.49 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.48 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.46 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.44 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.43 | |
| KOG0952|consensus | 1230 | 99.4 | ||
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.38 | |
| KOG0348|consensus | 708 | 99.37 | ||
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.37 | |
| KOG0350|consensus | 620 | 99.37 | ||
| KOG0345|consensus | 567 | 99.35 | ||
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.35 | |
| KOG0338|consensus | 691 | 99.35 | ||
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.34 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.33 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.33 | |
| KOG0331|consensus | 519 | 99.32 | ||
| KOG0340|consensus | 442 | 99.31 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.3 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.3 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.29 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.29 | |
| PTZ00110 | 545 | helicase; Provisional | 99.29 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.29 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.29 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.28 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.28 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.27 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.27 | |
| KOG0330|consensus | 476 | 99.26 | ||
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.25 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.25 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.25 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.24 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.23 | |
| KOG0951|consensus | 1674 | 99.23 | ||
| KOG0348|consensus | 708 | 99.23 | ||
| KOG0354|consensus | 746 | 99.22 | ||
| KOG0350|consensus | 620 | 99.22 | ||
| KOG0343|consensus | 758 | 99.22 | ||
| KOG0346|consensus | 569 | 99.21 | ||
| KOG0342|consensus | 543 | 99.21 | ||
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.2 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.2 | |
| KOG0344|consensus | 593 | 99.2 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.19 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.19 | |
| KOG0343|consensus | 758 | 99.19 | ||
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.18 | |
| KOG0331|consensus | 519 | 99.18 | ||
| KOG0346|consensus | 569 | 99.17 | ||
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.17 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.16 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.15 | |
| KOG0335|consensus | 482 | 99.15 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.15 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.15 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.14 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.13 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.12 | |
| KOG0347|consensus | 731 | 99.11 | ||
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.11 | |
| KOG0345|consensus | 567 | 99.07 | ||
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.07 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.07 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.06 | |
| KOG0333|consensus | 673 | 99.06 | ||
| KOG0948|consensus | 1041 | 99.06 | ||
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.05 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.04 | |
| KOG0334|consensus | 997 | 99.03 | ||
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.02 | |
| KOG0950|consensus | 1008 | 99.0 | ||
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.0 | |
| KOG0342|consensus | 543 | 99.0 | ||
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 98.99 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.99 | |
| KOG0335|consensus | 482 | 98.99 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.99 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 98.99 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 98.98 | |
| KOG0344|consensus | 593 | 98.94 | ||
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 98.93 | |
| KOG0947|consensus | 1248 | 98.92 | ||
| KOG0354|consensus | 746 | 98.91 | ||
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 98.91 | |
| KOG0337|consensus | 529 | 98.91 | ||
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.9 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 98.9 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 98.9 | |
| KOG0951|consensus | 1674 | 98.88 | ||
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 98.88 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 98.87 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 98.87 | |
| KOG0947|consensus | 1248 | 98.87 | ||
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 98.86 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 98.85 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.84 | |
| KOG0340|consensus | 442 | 98.83 | ||
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.83 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 98.83 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 98.81 | |
| KOG0326|consensus | 459 | 98.81 | ||
| KOG0948|consensus | 1041 | 98.79 | ||
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 98.78 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.78 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.77 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 98.76 | |
| KOG0338|consensus | 691 | 98.76 | ||
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.75 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.75 | |
| KOG0328|consensus | 400 | 98.74 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.74 | |
| KOG4284|consensus | 980 | 98.73 | ||
| PRK13766 | 773 | Hef nuclease; Provisional | 98.73 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 98.72 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.71 | |
| KOG0334|consensus | 997 | 98.7 | ||
| KOG0341|consensus | 610 | 98.7 | ||
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 98.66 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.66 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 98.64 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.64 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.64 | |
| KOG0327|consensus | 397 | 98.62 | ||
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.61 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 98.61 | |
| KOG0347|consensus | 731 | 98.6 | ||
| KOG0339|consensus | 731 | 98.59 | ||
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.59 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.56 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.55 | |
| KOG0949|consensus | 1330 | 98.55 | ||
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.55 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 98.54 | |
| KOG0329|consensus | 387 | 98.54 | ||
| KOG0337|consensus | 529 | 98.54 | ||
| KOG0352|consensus | 641 | 98.53 | ||
| KOG0339|consensus | 731 | 98.51 | ||
| KOG0950|consensus | 1008 | 98.5 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 98.5 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.48 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.48 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.46 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.46 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.46 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.46 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 98.46 | |
| KOG0332|consensus | 477 | 98.44 | ||
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 98.43 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 98.41 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 98.4 | |
| KOG0336|consensus | 629 | 98.4 | ||
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 98.39 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.39 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.39 | |
| KOG0351|consensus | 941 | 98.38 | ||
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 98.38 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 98.37 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 98.33 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.33 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.32 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 98.3 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.29 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 98.29 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.29 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.29 | |
| KOG0341|consensus | 610 | 98.28 | ||
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 98.27 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.26 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 98.25 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.24 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 98.22 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 98.21 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 98.2 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.19 | |
| KOG0336|consensus | 629 | 98.18 | ||
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.17 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 98.14 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 98.13 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 98.12 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 98.11 | |
| KOG0352|consensus | 641 | 98.11 | ||
| KOG0333|consensus | 673 | 98.09 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 98.09 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 98.09 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 98.09 | |
| KOG0328|consensus | 400 | 98.08 | ||
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 98.05 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 98.01 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 98.0 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.98 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.96 | |
| KOG0332|consensus | 477 | 97.94 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.93 | |
| KOG0353|consensus | 695 | 97.93 | ||
| KOG0353|consensus | 695 | 97.93 | ||
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 97.91 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 97.9 | |
| KOG0949|consensus | 1330 | 97.87 | ||
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.87 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.83 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 97.82 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.81 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.8 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 97.79 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.79 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.79 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 97.75 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 97.73 | |
| KOG0327|consensus | 397 | 97.71 | ||
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 97.71 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 97.7 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.69 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.64 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.61 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 97.61 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.6 | |
| KOG0326|consensus | 459 | 97.59 | ||
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.56 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 97.56 | |
| KOG0351|consensus | 941 | 97.56 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 97.55 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.52 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.51 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 97.51 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 97.48 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.47 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 97.44 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.42 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.42 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.41 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 97.41 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 97.39 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 97.39 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 97.38 | |
| PRK08181 | 269 | transposase; Validated | 97.36 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.34 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.34 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.3 | |
| KOG4284|consensus | 980 | 97.29 | ||
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.29 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 97.29 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.29 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.28 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.28 | |
| KOG0329|consensus | 387 | 97.28 | ||
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.26 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 97.2 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.19 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.19 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.18 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 97.17 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.15 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.14 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.1 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.08 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.07 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.07 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.06 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 97.05 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.05 | |
| PRK06526 | 254 | transposase; Provisional | 97.05 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 97.04 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 97.04 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 97.01 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.01 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 97.0 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 96.99 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 96.98 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.95 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 96.9 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.9 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 96.86 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 96.85 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.84 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.83 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 96.82 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.82 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.8 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.8 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 96.78 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 96.72 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 96.72 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 96.71 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.71 | |
| KOG1802|consensus | 935 | 96.68 | ||
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.67 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.66 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.64 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 96.62 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.59 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.57 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.54 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 96.54 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 96.51 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.51 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.47 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 96.46 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 96.46 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.46 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 96.46 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 96.44 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.42 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.4 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 96.39 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.38 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 96.38 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.37 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.37 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.36 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.36 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.36 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 96.35 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.35 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 96.33 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 96.33 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.32 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.3 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.26 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.26 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.25 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 96.25 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.23 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 96.22 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 96.2 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.18 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 96.18 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.17 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.1 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.08 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 96.03 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.02 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.02 | |
| PLN02199 | 303 | shikimate kinase | 96.01 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.0 | |
| KOG0745|consensus | 564 | 95.97 | ||
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 95.97 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 95.96 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.93 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.92 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.92 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.91 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.87 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 95.87 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.86 | |
| PF02456 | 369 | Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR | 95.81 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 95.8 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 95.8 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 95.78 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.74 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.72 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.72 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 95.7 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 95.69 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.69 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 95.65 | |
| TIGR03744 | 893 | traC_PFL_4706 conjugative transfer ATPase, PFL_470 | 95.65 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 95.64 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 95.62 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.6 | |
| KOG1803|consensus | 649 | 95.59 | ||
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 95.57 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.57 | |
| PRK13764 | 602 | ATPase; Provisional | 95.55 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.53 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 95.52 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.5 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.5 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 95.48 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.47 | |
| TIGR02759 | 566 | TraD_Ftype type IV conjugative transfer system cou | 95.46 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.43 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 95.39 | |
| KOG4150|consensus | 1034 | 95.36 | ||
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 95.36 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 95.35 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 95.34 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.33 | |
| PHA02535 | 581 | P terminase ATPase subunit; Provisional | 95.32 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.31 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 95.31 | |
| KOG0953|consensus | 700 | 95.31 | ||
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 95.29 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 95.24 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.23 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.2 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 95.19 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 95.19 | |
| KOG1131|consensus | 755 | 95.16 | ||
| KOG1802|consensus | 935 | 95.15 | ||
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.14 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 95.11 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.09 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 95.08 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 95.08 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 95.05 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 95.0 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 94.99 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.95 | |
| KOG0953|consensus | 700 | 94.93 | ||
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 94.89 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 94.87 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.87 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.86 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 94.85 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 94.83 | |
| TIGR02746 | 797 | TraC-F-type type-IV secretion system protein TraC. | 94.79 | |
| KOG1123|consensus | 776 | 94.78 | ||
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 94.77 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.76 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 94.76 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 94.76 | |
| COG3451 | 796 | VirB4 Type IV secretory pathway, VirB4 components | 94.71 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 94.7 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 94.69 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 94.68 | |
| KOG0390|consensus | 776 | 94.68 | ||
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 94.66 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 94.65 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.65 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.64 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.58 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 94.57 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 94.55 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 94.55 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 94.55 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 94.54 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 94.54 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.53 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.51 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 94.51 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 94.48 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.46 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.45 | |
| PRK13700 | 732 | conjugal transfer protein TraD; Provisional | 94.45 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 94.44 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 94.43 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 94.42 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.4 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 94.38 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 94.38 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 94.37 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 94.34 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 94.28 | |
| PRK13891 | 852 | conjugal transfer protein TrbE; Provisional | 94.28 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.26 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 94.25 | |
| KOG2028|consensus | 554 | 94.21 | ||
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.15 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.15 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 94.14 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 94.14 | |
| PHA02244 | 383 | ATPase-like protein | 94.11 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 94.09 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 94.08 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 94.07 | |
| KOG1803|consensus | 649 | 94.05 | ||
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 94.04 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 94.04 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 94.04 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 93.99 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 93.99 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 93.98 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 93.94 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 93.94 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 93.94 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 93.92 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 93.92 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 93.91 | |
| PF13173 | 128 | AAA_14: AAA domain | 93.88 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 93.88 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 93.75 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 93.71 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 93.7 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 93.68 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 93.67 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 93.67 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 93.67 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 93.62 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 93.61 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 93.6 |
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
Probab=99.60 E-value=4.6e-15 Score=113.77 Aligned_cols=92 Identities=16% Similarity=0.091 Sum_probs=81.4
Q ss_pred hHHHHHHHHHHHHHhhhhhhhhHHHhhhhc-cceEEEeecCCCchHhHHHHHHHHHHh---------CCCeEEEEccchh
Q psy2029 45 LVHEKYQSLAKAAEEFKFYLEGKCLEMIQN-KNCVLSIPTSGGKTLVGEILIMKELKI---------KQKSAIFILPYIS 114 (138)
Q Consensus 45 L~~q~~~~l~~~~~~~~~~~Q~~~~~~~~~-~~~ii~~ptg~GKt~~~~~~~l~~~~~---------~~~~~~~i~P~~~ 114 (138)
|.....+.+.+.++..+.++|.+++|.+.+ +|+++.+|||+|||+++++++++.+.. .+.++++++|+++
T Consensus 15 l~~~l~~~l~~~g~~~pt~iQ~~aip~il~g~dvi~~ApTGsGKTla~llp~l~~l~~~~~~~~~~~~~~~~lil~Ptre 94 (423)
T PRK04837 15 LHPQVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKTMAFLTATFHYLLSHPAPEDRKVNQPRALIMAPTRE 94 (423)
T ss_pred CCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCcEEEECCCCchHHHHHHHHHHHHHHhcccccccccCCceEEEECCcHH
Confidence 456778888888899999999999998888 999999999999999999999998864 1357999999999
Q ss_pred HHHHHHHHHHHHhhhcCceeee
Q psy2029 115 LVHEKYQSLAKAAEEFKFYLEV 136 (138)
Q Consensus 115 l~~q~~~~~~~~~~~~~~~v~~ 136 (138)
|+.|+++.+..+....|+++..
T Consensus 95 La~Qi~~~~~~l~~~~~~~v~~ 116 (423)
T PRK04837 95 LAVQIHADAEPLAQATGLKLGL 116 (423)
T ss_pred HHHHHHHHHHHHhccCCceEEE
Confidence 9999999999999888887654
|
|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PHA02535 P terminase ATPase subunit; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02746 TraC-F-type type-IV secretion system protein TraC | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK13700 conjugal transfer protein TraD; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK13891 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 138 | ||||
| 2zj2_A | 720 | Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt | 9e-06 | ||
| 2p6r_A | 702 | Crystal Structure Of Superfamily 2 Helicase Hel308 | 3e-05 |
| >pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 | Back alignment and structure |
|
| >pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 3e-16 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 5e-16 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 5e-12 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 7e-12 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 6e-12 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 6e-12 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 9e-07 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 7e-06 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 2e-06 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 9e-06 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 2e-05 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 4e-05 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 3e-05 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 6e-04 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 9e-05 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 2e-04 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 2e-04 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 3e-04 |
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
Score = 73.2 bits (180), Expect = 3e-16
Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
Query: 67 KCLEMI--QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLA 124
+ ++ + +L+ PT GKTL+ E+ I+ L AI++ P +L +EKY +
Sbjct: 37 EAVKKGLLEGNRLLLTSPTGSGKTLIAEMGIISFLLKNGGKAIYVTPLRALTNEKYLTFK 96
Query: 125 KAAE 128
Sbjct: 97 DWEL 100
|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.64 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.63 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.63 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.6 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.59 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.59 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.59 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.58 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.58 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.58 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.56 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.56 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.55 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.55 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.55 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.54 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.53 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.52 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.5 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.49 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.49 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.48 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.47 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.46 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.46 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.45 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.44 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.44 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.43 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.43 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.43 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.41 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.41 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.39 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.39 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.38 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.38 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.38 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.37 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.35 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.35 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.35 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.34 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.33 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.31 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.29 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.29 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.28 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.28 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.28 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.27 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.27 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.27 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.26 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.25 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.25 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.25 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.24 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.24 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.23 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.23 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.22 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.21 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.21 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.21 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.2 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.19 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.19 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.19 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.19 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.17 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.17 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.17 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.16 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.15 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.14 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.14 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.13 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.13 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.12 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.12 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.12 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.11 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.11 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.11 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.1 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.1 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.1 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.1 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.1 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.09 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.09 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.09 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.08 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.08 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.07 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.07 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.07 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.06 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.06 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.05 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.05 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.04 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.04 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.03 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.03 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.02 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.01 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.0 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.0 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 98.99 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.99 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 98.99 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.98 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.97 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 98.96 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 98.95 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 98.94 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 98.94 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 98.94 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 98.94 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 98.93 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 98.92 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 98.92 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 98.91 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 98.88 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.87 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.84 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 98.83 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 98.79 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.78 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 98.77 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.76 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 98.73 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.72 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 98.72 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 98.71 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 98.7 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 98.66 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.65 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 98.62 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 98.59 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 98.54 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 98.51 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 98.43 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 98.39 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 98.39 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 98.36 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 98.35 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 98.35 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 98.32 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 98.23 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 98.18 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 98.12 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 98.03 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 97.91 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 97.81 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 97.58 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 97.55 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.49 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.45 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 97.35 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.23 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.19 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 97.18 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 97.04 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 96.92 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.92 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 96.86 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.85 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 96.81 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.8 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.76 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.75 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.74 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.73 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.73 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.73 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 96.62 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 96.62 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 96.6 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.58 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 96.56 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 96.56 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.52 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.48 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 96.44 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.31 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.3 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.25 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 96.17 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.14 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.11 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 96.11 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 96.08 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.08 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 96.01 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 95.98 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 95.98 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.98 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 95.93 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.93 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 95.93 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 95.91 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.85 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.83 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 95.83 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.8 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 95.8 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.77 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 95.74 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.7 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.64 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.6 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 95.59 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.54 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.53 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 95.45 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.35 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 95.27 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.22 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 95.22 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 95.21 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.12 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.12 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.02 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.01 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.0 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 94.99 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 94.9 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.88 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 94.86 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 94.85 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 94.82 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 94.77 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 94.77 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 94.72 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 94.67 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 94.65 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 94.64 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 94.51 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 94.49 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 94.43 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.42 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 94.42 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.41 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.37 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.31 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 94.3 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 94.3 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.28 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 94.27 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.26 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 94.24 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 94.19 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 94.17 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 94.17 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 94.15 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 94.14 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.11 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 94.06 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.04 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 94.03 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 94.03 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 93.99 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 93.98 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 93.87 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 93.81 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 93.79 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 93.77 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 93.71 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 93.71 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.69 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.69 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 93.66 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.64 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 93.59 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.55 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 93.47 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 93.47 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.43 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 93.35 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 93.35 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 93.34 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 93.34 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.34 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 93.31 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 93.3 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 93.26 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 93.26 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 93.22 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 93.21 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 93.17 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 93.1 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 93.07 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.07 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 93.07 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 93.04 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 93.03 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 93.02 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 93.01 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 93.01 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 92.99 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.99 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 92.95 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.93 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.9 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 92.9 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.9 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.88 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 92.86 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.85 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 92.8 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 92.77 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 92.74 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 92.7 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 92.63 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 92.61 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 92.6 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 92.56 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 92.54 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 92.51 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 92.49 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 92.46 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 92.39 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 92.36 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 92.34 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 92.26 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 92.24 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 92.19 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.18 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 92.14 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 92.14 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 92.13 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 92.12 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 92.12 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.12 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 92.09 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 92.0 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 91.99 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 91.9 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 91.9 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 91.89 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 91.87 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 91.77 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 91.76 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 91.76 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 91.73 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 91.68 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 91.67 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 91.6 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.59 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 91.56 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 91.42 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 91.4 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 91.34 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 91.29 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 91.28 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 91.27 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 91.23 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 91.23 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 91.19 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.12 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 91.11 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 91.1 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 91.08 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.08 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 91.01 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 90.96 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 90.91 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 90.9 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 90.81 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 90.79 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 90.79 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 90.74 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 90.71 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 90.71 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 90.71 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 90.71 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 90.68 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 90.66 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 90.61 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.57 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 90.56 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 90.54 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 90.52 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 90.5 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 90.44 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.35 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 90.2 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 90.18 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 90.15 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 90.14 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 90.08 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 89.84 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 89.74 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 89.72 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 89.71 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 89.7 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 89.68 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 89.62 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 89.59 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 89.49 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 89.43 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 89.43 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 89.37 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 89.3 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 89.28 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 89.24 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 89.2 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 89.2 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 89.2 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 89.17 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 89.12 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 89.12 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 89.05 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.04 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 89.01 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.95 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 88.94 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 88.88 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 88.82 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 88.81 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 88.74 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 88.68 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 88.62 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 88.62 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 88.61 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 88.53 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 88.44 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 88.43 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 88.4 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 88.39 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 88.35 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 88.33 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 88.22 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 88.18 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 88.16 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 88.15 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 88.13 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 88.12 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 88.11 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 88.09 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 88.08 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 88.0 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 87.93 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 87.92 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 87.91 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 87.85 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 87.81 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 87.81 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 87.79 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 87.69 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 87.68 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 87.66 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 87.63 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 87.62 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 87.61 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 87.6 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 87.55 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 87.53 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 87.5 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 87.42 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 87.42 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 87.36 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 87.35 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 87.34 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 87.32 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 87.27 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 87.25 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 87.2 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 87.18 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 87.18 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 87.17 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 87.16 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 87.03 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 87.01 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 86.98 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 86.98 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 86.97 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 86.97 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 86.97 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 86.92 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 86.88 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 86.77 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 86.75 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 86.73 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 86.71 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 86.64 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 86.6 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 86.53 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 86.36 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 86.3 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 86.26 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 86.15 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 86.14 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 85.98 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 85.96 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 85.92 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 85.91 |
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.64 E-value=7.1e-16 Score=108.77 Aligned_cols=92 Identities=24% Similarity=0.291 Sum_probs=79.3
Q ss_pred hHHHHHHHHHHHHHhhhhhhhhHHHhhhhc-cceEEEeecCCCchHhHHHHHHHHHHh---CCCeEEEEccchhHHHHHH
Q psy2029 45 LVHEKYQSLAKAAEEFKFYLEGKCLEMIQN-KNCVLSIPTSGGKTLVGEILIMKELKI---KQKSAIFILPYISLVHEKY 120 (138)
Q Consensus 45 L~~q~~~~l~~~~~~~~~~~Q~~~~~~~~~-~~~ii~~ptg~GKt~~~~~~~l~~~~~---~~~~~~~i~P~~~l~~q~~ 120 (138)
|.....+.+.+.++..++++|.++++.+.+ +++++.+|||+|||+++.+++++.+.. .+.+++|++|+++|+.|++
T Consensus 36 l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~~~~~l~~a~TGsGKT~~~~l~~l~~l~~~~~~~~~~lil~Pt~~L~~q~~ 115 (245)
T 3dkp_A 36 INSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIH 115 (245)
T ss_dssp CCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSCHHHHHHHHHHHHHCSCCSSSCCEEEECSSHHHHHHHH
T ss_pred CCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCCCcHHHHHHHHHHHHHhhcccCCceEEEEeCCHHHHHHHH
Confidence 345566777777788899999999988887 999999999999999999999998864 3568999999999999999
Q ss_pred HHHHHHhhhcCceeee
Q psy2029 121 QSLAKAAEEFKFYLEV 136 (138)
Q Consensus 121 ~~~~~~~~~~~~~v~~ 136 (138)
+++++++...++.+..
T Consensus 116 ~~~~~~~~~~~~~~~~ 131 (245)
T 3dkp_A 116 RELIKISEGTGFRIHM 131 (245)
T ss_dssp HHHHHHTTTSCCCEEC
T ss_pred HHHHHHhcccCceEEE
Confidence 9999998887776643
|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 138 | ||||
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 9e-05 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 2e-04 | |
| d1wp9a1 | 200 | c.37.1.19 (A:1-200) putative ATP-dependent RNA hel | 0.001 |
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: Dengue virus helicase species: Dengue virus type 2 [TaxId: 11060]
Score = 38.4 bits (88), Expect = 9e-05
Identities = 8/63 (12%), Positives = 25/63 (39%), Gaps = 1/63 (1%)
Query: 70 EMI-QNKNCVLSIPTSGGKTLVGEILIMKELKIKQKSAIFILPYISLVHEKYQSLAKAAE 128
++ + + ++ + GKT I++E + + + P + E ++L
Sbjct: 4 DIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPI 63
Query: 129 EFK 131
++
Sbjct: 64 RYQ 66
|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.66 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.63 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.63 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.6 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.56 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.56 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.55 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.54 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.54 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.53 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.49 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.44 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.43 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.4 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.39 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.37 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.37 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.34 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.33 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.33 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.3 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.25 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.25 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.17 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.17 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.15 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.08 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.04 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.02 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.98 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.98 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 98.95 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.95 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.94 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.88 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.88 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.83 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.83 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.73 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 97.85 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.56 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.52 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.47 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 97.43 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.42 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.32 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 97.24 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.08 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 97.07 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.76 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.72 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.72 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.59 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.58 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 96.53 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.38 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.36 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 96.32 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.29 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.17 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 96.1 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.05 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.0 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 95.99 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.91 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 95.91 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.9 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.81 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.81 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.78 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.74 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.73 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.72 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.58 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.53 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.52 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 95.44 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.42 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.38 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 95.29 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.27 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.18 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 95.18 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.17 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.14 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.08 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.02 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 94.92 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.88 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.74 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.73 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.7 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.69 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 94.67 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.62 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.62 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.58 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.57 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.5 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.49 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 94.39 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 94.3 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 94.28 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.24 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.23 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 94.08 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.82 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 93.78 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.74 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 93.62 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.54 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.47 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 93.42 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 93.3 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 93.28 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 93.24 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.08 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.0 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 92.98 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 92.96 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.89 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 92.84 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 92.74 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 92.66 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 92.58 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.54 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.5 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.37 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 92.3 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.18 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 92.05 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 91.89 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.84 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.81 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 91.74 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 91.66 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.65 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.65 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 91.55 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 91.53 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.5 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 91.48 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 91.42 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.32 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.27 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 91.26 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 91.26 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.1 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.05 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 90.94 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.88 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 90.86 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.57 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 90.53 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 90.5 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 90.44 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 90.42 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 90.39 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.26 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.1 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 90.09 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 90.08 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.07 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 90.07 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.02 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 89.99 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 89.88 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 89.57 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 89.56 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 89.14 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 89.09 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 88.97 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 88.97 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 88.95 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 88.91 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 88.89 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 88.73 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 88.6 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 88.53 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 88.45 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 88.09 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 87.89 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 87.56 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 87.46 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 87.0 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 86.96 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 86.9 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 86.89 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 86.77 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 86.73 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 86.61 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 86.52 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 86.51 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 86.37 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 86.34 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.28 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 86.25 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 85.78 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 85.67 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 85.44 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 85.19 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 85.14 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 85.06 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 84.81 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 84.75 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 84.7 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 84.51 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 84.5 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 84.43 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 84.31 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 84.15 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 83.99 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 83.96 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 83.78 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 83.68 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 83.56 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 83.37 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 83.23 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 83.12 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 83.0 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 83.0 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 82.97 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 82.62 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 82.36 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 82.22 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 82.08 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 82.06 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 81.72 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 81.55 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 81.51 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 81.5 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 81.48 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 81.42 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 81.27 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 81.12 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 80.92 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 80.88 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 80.47 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 80.24 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.15 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 80.12 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66 E-value=7.3e-17 Score=111.45 Aligned_cols=92 Identities=14% Similarity=0.194 Sum_probs=83.4
Q ss_pred hHHHHHHHHHHHHHhhhhhhhhHHHhhhhc-cceEEEeecCCCchHhHHHHHHHHHHh--CCCeEEEEccchhHHHHHHH
Q psy2029 45 LVHEKYQSLAKAAEEFKFYLEGKCLEMIQN-KNCVLSIPTSGGKTLVGEILIMKELKI--KQKSAIFILPYISLVHEKYQ 121 (138)
Q Consensus 45 L~~q~~~~l~~~~~~~~~~~Q~~~~~~~~~-~~~ii~~ptg~GKt~~~~~~~l~~~~~--~~~~~~~i~P~~~l~~q~~~ 121 (138)
|.....+.+.+.++..+.++|..++|.+.+ +|+++.+|||+|||+++.+++++.+.. .+.++++++|+++|+.|.++
T Consensus 24 L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~PtreLa~Qi~~ 103 (222)
T d2j0sa1 24 LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQK 103 (222)
T ss_dssp CCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECSSHHHHHHHHH
T ss_pred CCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecchHHHHHHHHH
Confidence 667888999999999999999999998888 999999999999999999999998865 35689999999999999999
Q ss_pred HHHHHhhhcCceeee
Q psy2029 122 SLAKAAEEFKFYLEV 136 (138)
Q Consensus 122 ~~~~~~~~~~~~v~~ 136 (138)
.++++....++++..
T Consensus 104 ~~~~l~~~~~i~~~~ 118 (222)
T d2j0sa1 104 GLLALGDYMNVQCHA 118 (222)
T ss_dssp HHHHHTTTTTCCEEE
T ss_pred HHHHHhCccceeEEE
Confidence 999999888877654
|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|