Psyllid ID: psy2181

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MKVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPPPSPAHLALPHNPGSVTPISRDDAKEHESTSDINSEPNSSADEDSQMRLRLKRKLQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKGLVQQSARQVWFSNRRAKWRREEKLRNQRRGSTGSVNSANTTTSTTALDHVPPTSQSPPPSSRLPLNPGGFNPSSMYSSIPQPAGMDSYNPSCLQQAAREHHHHSSYSYMFHDSLHSLQSAYQRAAPAAHSSPHPHPAHPGSSPYGTSNSVNGPPTSTGT
cccccHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MKVSSINRVLRNLAAQKEQQasahnqtseTVYDKLRmfngqpgwawypgstpppspahlalphnpgsvtpisrddakehestsdinsepnssadeDSQMRLRLKRKLQRNRTSFTNEQIDSLEKEFerthypdvfaRERLadkiglpearIQVSSINRVLRNLAAQKEQQasahnqtseTVYDKLRmfngqpgwawypgstptpspahlalphnpgsvtpisrddakeferthypdvfarerladkiglpearIQVSSINRVLRNLAAQKEQQasahnqtseTVYDKLRmfngqpgwawypgstptpspahlalphnpgsvtpisrddakGLVQQSARQVWFSNRRAKWRREEKLrnqrrgstgsvnsantttsttaldhvpptsqspppssrlplnpggfnpssmyssipqpagmdsynpsclQQAArehhhhssysymfhdSLHSLQSAYQraapaahssphphpahpgsspygtsnsvngpptstgt
MKVSSINRVLRNLAAqkeqqasahnqtseTVYDKLRMFNGQPGWAWYPGSTPPPSPAHLALPHNPGSVTPISRDDAKEHestsdinsepnssadedsqMRLRLKRklqrnrtsftneqidslekeferthypDVFARERLADKIGLPEARIQVSSINRVLRNLAAQkeqqasahnqtsetVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQkeqqasahnqtsetVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKGLVQQSArqvwfsnrrakwrreeklrnqrrgstgsvnsantttsttaldhvpptsqspppssrLPLNPGGFNPSSMYSSIPQPAGMDSYNPSCLQQAAREHHHHSSYSYMFHDSLHSLQSAYQRAAPAAHSSPHPHPAhpgsspygtsnsvngpptstgt
MKVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTpppspahlalphnpGSVTPISRDDAKEHESTSDINSEPNSSADEDSQMrlrlkrklQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKGLVQQSARQVWFSNRRAKWRREEKLRNQRRgstgsvnsantttsttaLDHVpptsqspppssrlplnpGGFNPSSMYSSIPQPAGMDSYNPSCLQQAAREhhhhssysyMFHDSLHSLQSAYQRaapaahssphphpahpgsspYGTSNSVNGPPTSTGT
******************************VYDKLRMFNGQPGWAWY*********************************************************************************THYPDVFARERLADKIGLPEARIQVSSINRVLR*******************VYDKLRMFNGQPGWAWYP**********************************HYPDVFARERLADKIGLPEARIQVSSINRVLR*******************VYDKLRMFNGQPGWAWYP**************************************VWF****************************************************************************************************************************************************
MKVSSINRVLRN***************************GQPGWAWY*****************************************************************SFTNEQIDSLEKEFERTHYPDVFARERL****************************************************GWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHN********************************************************************************************************************************************************************************************************************
MKVSSINRVLRNLA**************ETVYDKLRMFNGQPGWAWYPGSTPPPSPAHLALPHNPGSVTPIS**************************MRLRLKRKLQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLA**************ETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLA**************ETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKGLVQQSARQVWFSNRRAKWRREE***************ANTTTSTTAL**************RLPLNPGGFNPSSMYSSIPQPAGMDSYNPSC***********SSYSYMFHDSLHSLQS****************************************
*****IN***RNLAAQK************TVYDKLRMFNGQPGWAWYPGSTPP********************************************************NRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKE*************YDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSV******************************************R**R*LAAQKEQQASAHNQTSETVYDKLRMFNG*********************PHNPGSVTPISRDDAKGLVQQSARQVWFSNRRAKWRREEKLR*************************PPTSQSPPPSSRLPLNPGGFNPSSMYSSIPQPAGMDSYNPSCLQQAAREHHHHSSYSYMFHDSLHSLQSAYQRAAPAAHSSPHP*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPPPSPAHLALPHNPGSVTPISRDDAKEHESTSDINSEPNSSADEDSQMRLRLKRKLQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDDAKGLVQQSARQVWFSNRRAKWRREEKLRNQRRGSTGSVNSANTTTSTTALDHVPPTSQSPPPSSRLPLNPGGFNPSSMYSSIPQPAGMDSYNPSCLQQAAREHHHHSSYSYMFHDSLHSLQSAYQRAAPAAHSSPHPHPAHPGSSPYGTSNSVNGPPTSTGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query490 2.2.26 [Sep-21-2011]
P47238416 Paired box protein Pax-6 N/A N/A 0.279 0.329 0.565 5e-39
O73917437 Paired box protein Pax-6 N/A N/A 0.279 0.313 0.559 6e-38
P63016422 Paired box protein Pax-6 yes N/A 0.279 0.324 0.552 8e-38
Q1LZF1422 Paired box protein Pax-6 yes N/A 0.279 0.324 0.552 1e-37
P63015422 Paired box protein Pax-6 yes N/A 0.279 0.324 0.552 1e-37
P26367422 Paired box protein Pax-6 yes N/A 0.279 0.324 0.552 1e-37
P55864422 Paired box protein Pax-6 N/A N/A 0.279 0.324 0.565 3e-37
P26630437 Paired box protein Pax-6 yes N/A 0.279 0.313 0.546 4e-37
O18381857 Paired box protein Pax-6 no N/A 0.163 0.093 0.694 1e-25
P47237216 Paired box protein Pax-6 no N/A 0.124 0.282 0.852 1e-22
>sp|P47238|PAX6_COTJA Paired box protein Pax-6 OS=Coturnix coturnix japonica GN=PAX6 PE=2 SV=1 Back     alignment and function desciption
 Score =  162 bits (410), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 108/161 (67%), Gaps = 24/161 (14%)

Query: 3   VSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPG-WA----WYPGSTPPPSPA 57
           VSSINRVLRNLA++K+Q  +      + +YDKLRM NGQ G W     WYPG++ P  PA
Sbjct: 120 VSSINRVLRNLASEKQQMGA------DGMYDKLRMLNGQTGTWGTRPGWYPGTSVPGQPA 173

Query: 58  HLALPHNPGSVTPISRDDAKEHESTSDINSEPNSSADEDSQMRLRLKRKLQRNRTSFTNE 117
               P   G             E+T+ I+S  N    +++QMRL+LKRKLQRNRTSFT E
Sbjct: 174 QDGCPQQEGG-----------GENTNSISS--NGEDSDEAQMRLQLKRKLQRNRTSFTQE 220

Query: 118 QIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINR 158
           QI++LEKEFERTHYPDVFARERLA KI LPEARIQV   NR
Sbjct: 221 QIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNR 261
May be a transcription factor with important functions in eye and nasal development.
Coturnix coturnix japonica (taxid: 93934)
>sp|O73917|PAX6_ORYLA Paired box protein Pax-6 OS=Oryzias latipes GN=pax6 PE=2 SV=1 Back     alignment and function description
>sp|P63016|PAX6_RAT Paired box protein Pax-6 OS=Rattus norvegicus GN=Pax6 PE=2 SV=1 Back     alignment and function description
>sp|Q1LZF1|PAX6_BOVIN Paired box protein Pax-6 OS=Bos taurus GN=PAX6 PE=2 SV=1 Back     alignment and function description
>sp|P63015|PAX6_MOUSE Paired box protein Pax-6 OS=Mus musculus GN=Pax6 PE=1 SV=1 Back     alignment and function description
>sp|P26367|PAX6_HUMAN Paired box protein Pax-6 OS=Homo sapiens GN=PAX6 PE=1 SV=2 Back     alignment and function description
>sp|P55864|PAX6_XENLA Paired box protein Pax-6 OS=Xenopus laevis GN=pax6 PE=2 SV=1 Back     alignment and function description
>sp|P26630|PAX6_DANRE Paired box protein Pax-6 OS=Danio rerio GN=pax6a PE=2 SV=1 Back     alignment and function description
>sp|O18381|PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster GN=ey PE=2 SV=3 Back     alignment and function description
>sp|P47237|PAX6_CHICK Paired box protein Pax-6 (Fragment) OS=Gallus gallus GN=PAX6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
270006382524 twin of eyeless [Tribolium castaneum] 0.306 0.286 0.754 1e-57
242006165509 Paired box protein Pax-6, putative [Pedi 0.304 0.292 0.698 3e-53
321464778473 twin of eyeless [Daphnia pulex] 0.312 0.323 0.695 3e-51
195064095545 GH23963 [Drosophila grimshawi] gi|193892 0.306 0.275 0.691 1e-50
195402191549 GJ13300 [Drosophila virilis] gi|19415590 0.306 0.273 0.691 2e-50
195134022569 GI14042 [Drosophila mojavensis] gi|19391 0.306 0.263 0.685 8e-50
383210367213 twin of eyeless, partial [Gryllus bimacu 0.277 0.638 0.725 1e-49
195564338342 GD24416 [Drosophila simulans] gi|1942016 0.302 0.432 0.670 1e-48
194913445543 GG16402 [Drosophila erecta] gi|190647914 0.408 0.368 0.550 2e-48
45549245543 twin of eyeless, isoform A [Drosophila m 0.346 0.313 0.606 2e-48
>gi|270006382|gb|EFA02830.1| twin of eyeless [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 135/163 (82%), Gaps = 13/163 (7%)

Query: 3   VSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQ-PGWAWYPGSTPPPSPAHLAL 61
           VSSINRVLRNLA+QKEQQASA N   E+VYDKLRMFNGQ PGWAWYPG+   P+  HL L
Sbjct: 207 VSSINRVLRNLASQKEQQASAQN---ESVYDKLRMFNGQTPGWAWYPGT---PTAPHLGL 260

Query: 62  PHNPGSVTP-ISRDDAKE-----HESTSDINSEPNSSADEDSQMRLRLKRKLQRNRTSFT 115
           P  P ++T  I+RDD ++     HE+TSD NSE NSS DEDSQ+RLRLKRKLQRNRTSFT
Sbjct: 261 PPAPAALTTQIARDDLQKRADAMHENTSDGNSEHNSSGDEDSQLRLRLKRKLQRNRTSFT 320

Query: 116 NEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINR 158
           NEQIDSLEKEFERTHYPDVFARERLA+KIGLPEARIQV   NR
Sbjct: 321 NEQIDSLEKEFERTHYPDVFARERLAEKIGLPEARIQVWFSNR 363

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242006165|ref|XP_002423925.1| Paired box protein Pax-6, putative [Pediculus humanus corporis] gi|212507188|gb|EEB11187.1| Paired box protein Pax-6, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321464778|gb|EFX75784.1| twin of eyeless [Daphnia pulex] Back     alignment and taxonomy information
>gi|195064095|ref|XP_001996496.1| GH23963 [Drosophila grimshawi] gi|193892042|gb|EDV90908.1| GH23963 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195402191|ref|XP_002059690.1| GJ13300 [Drosophila virilis] gi|194155904|gb|EDW71088.1| GJ13300 [Drosophila virilis] gi|263359635|gb|ACY70471.1| hypothetical protein DVIR88_6g0008 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195134022|ref|XP_002011437.1| GI14042 [Drosophila mojavensis] gi|193912060|gb|EDW10927.1| GI14042 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|383210367|dbj|BAM08280.1| twin of eyeless, partial [Gryllus bimaculatus] Back     alignment and taxonomy information
>gi|195564338|ref|XP_002105777.1| GD24416 [Drosophila simulans] gi|194201653|gb|EDX15229.1| GD24416 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194913445|ref|XP_001982698.1| GG16402 [Drosophila erecta] gi|190647914|gb|EDV45217.1| GG16402 [Drosophila erecta] Back     alignment and taxonomy information
>gi|45549245|ref|NP_524638.3| twin of eyeless, isoform A [Drosophila melanogaster] gi|15291285|gb|AAK92911.1| GH14454p [Drosophila melanogaster] gi|45444822|gb|AAF59395.4| twin of eyeless, isoform A [Drosophila melanogaster] gi|220942324|gb|ACL83705.1| toy-PA [synthetic construct] gi|220952546|gb|ACL88816.1| toy-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
FB|FBgn0019650543 toy "twin of eyeless" [Drosoph 0.418 0.377 0.502 2.9e-50
ZFIN|ZDB-GENE-001031-1437 pax6b "paired box gene 6b" [Da 0.320 0.359 0.464 3e-31
FB|FBgn0005558857 ey "eyeless" [Drosophila melan 0.173 0.099 0.611 1e-30
RGD|3258422 Pax6 "paired box 6" [Rattus no 0.320 0.372 0.464 3.4e-29
UNIPROTKB|Q1LZF1422 PAX6 "Paired box protein Pax-6 0.320 0.372 0.464 5.6e-29
UNIPROTKB|G3V3Q9377 PAX6 "Paired box protein Pax-6 0.320 0.416 0.464 5.6e-29
UNIPROTKB|P26367422 PAX6 "Paired box protein Pax-6 0.320 0.372 0.464 5.6e-29
UNIPROTKB|F2Z5M7422 PAX6 "Uncharacterized protein" 0.320 0.372 0.464 5.6e-29
MGI|MGI:97490422 Pax6 "paired box gene 6" [Mus 0.320 0.372 0.464 5.6e-29
UNIPROTKB|F1NF66422 PAX6 "Paired box protein Pax-6 0.320 0.372 0.464 7.1e-29
FB|FBgn0019650 toy "twin of eyeless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 461 (167.3 bits), Expect = 2.9e-50, Sum P(2) = 2.9e-50
 Identities = 118/235 (50%), Positives = 139/235 (59%)

Query:     3 VSSINRVLRNLAAQKEQQASAHNQTSETVYDKLRMFNGQPG-WAWYPGSTXXXXXXXXXX 61
             VSSINRVLRNLA+QKEQQA   N   E+VY+KLRMFNGQ G WAWYP +T          
Sbjct:   145 VSSINRVLRNLASQKEQQAQQQN---ESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPA 201

Query:    62 XXXXGSVTPIS----RDDAKE--------------HESTSDINSEPNSSADEDSQMXXXX 103
                  S   +S    RDD ++              H+STSD NSE NSS DEDSQM    
Sbjct:   202 ASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRL 261

Query:   104 XXXXQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNL 163
                 QRNRTSF+NEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQV   NR  +  
Sbjct:   262 KRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAK-- 319

Query:   164 AAQKEQQASAHNQTSETVYDKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSV 218
               ++E++     ++++TV D     +G+   A  P  T   S    +    PG V
Sbjct:   320 -WRREEKMRTQRRSADTV-DG----SGRTSTANNPSGTTASSSVATSNNSTPGIV 368
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS
GO:0005634 "nucleus" evidence=IEA;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=NAS
GO:0035214 "eye-antennal disc development" evidence=IMP
GO:0048749 "compound eye development" evidence=TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0016319 "mushroom body development" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
GO:0010628 "positive regulation of gene expression" evidence=IMP
GO:0008056 "ocellus development" evidence=IGI;IMP
ZFIN|ZDB-GENE-001031-1 pax6b "paired box gene 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0005558 ey "eyeless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|3258 Pax6 "paired box 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZF1 PAX6 "Paired box protein Pax-6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3V3Q9 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P26367 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5M7 PAX6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97490 Pax6 "paired box gene 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NF66 PAX6 "Paired box protein Pax-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-16
smart0038957 smart00389, HOX, Homeodomain 1e-13
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-13
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-07
smart0038957 smart00389, HOX, Homeodomain 1e-05
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-05
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 5e-04
pfam0004657 pfam00046, Homeobox, Homeobox domain 9e-04
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 72.1 bits (178), Expect = 4e-16
 Identities = 24/45 (53%), Positives = 32/45 (71%)

Query: 109 RNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQV 153
           R RT+FT EQ++ LEKEFE+  YP    RE LA K+GL E +++V
Sbjct: 2   RKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKV 46

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 490
KOG0490|consensus235 99.74
KOG0484|consensus125 99.69
KOG0488|consensus309 99.62
KOG0484|consensus125 99.61
KOG0842|consensus307 99.6
KOG0494|consensus332 99.59
KOG2251|consensus228 99.59
KOG0489|consensus261 99.59
KOG0489|consensus261 99.53
KOG0848|consensus317 99.52
KOG0843|consensus197 99.5
KOG0487|consensus308 99.5
KOG0487|consensus308 99.49
KOG0850|consensus245 99.48
KOG0485|consensus268 99.45
KOG2251|consensus228 99.44
KOG0850|consensus245 99.43
KOG0842|consensus307 99.43
KOG0492|consensus246 99.43
KOG0494|consensus332 99.42
KOG0843|consensus197 99.42
KOG0849|consensus354 99.41
KOG0848|consensus317 99.39
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.39
KOG0488|consensus309 99.38
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.35
KOG0493|consensus342 99.34
KOG0486|consensus351 99.33
KOG0844|consensus408 99.31
KOG0492|consensus246 99.31
KOG0490|consensus235 99.3
KOG0491|consensus194 99.25
KOG0485|consensus268 99.25
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.22
KOG0486|consensus351 99.19
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.18
KOG0493|consensus342 99.16
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.16
COG5576156 Homeodomain-containing transcription factor [Trans 99.13
KOG4577|consensus383 99.11
KOG4577|consensus383 99.11
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.1
KOG0844|consensus408 99.1
KOG0483|consensus198 99.05
KOG3802|consensus398 98.99
KOG0491|consensus194 98.99
KOG3802|consensus398 98.98
KOG0847|consensus288 98.96
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.91
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.89
KOG0483|consensus198 98.81
COG5576156 Homeodomain-containing transcription factor [Trans 98.8
KOG0849|consensus354 98.75
KOG0847|consensus288 98.65
KOG1168|consensus385 98.42
KOG3862|consensus327 98.22
KOG0775|consensus304 98.14
KOG1168|consensus385 98.08
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.89
KOG0774|consensus334 97.76
KOG0775|consensus304 97.66
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.61
KOG0774|consensus334 97.53
KOG2252|consensus558 97.28
KOG1146|consensus 1406 96.76
KOG2252|consensus558 96.58
KOG1146|consensus 1406 96.35
KOG3623|consensus1007 95.67
KOG0773|consensus342 95.13
KOG3623|consensus 1007 94.15
KOG0773|consensus342 93.86
KOG3755|consensus769 91.81
KOG3517|consensus334 91.33
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 90.84
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 85.29
>KOG0490|consensus Back     alignment and domain information 
Probab=99.74  E-value=2.6e-18  Score=166.70  Aligned_cols=154  Identities=26%  Similarity=0.259  Sum_probs=115.5

Q ss_pred             hhcccCCCCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHcCCCCCceeEechhhhhhHHHHHHHHHHhhccCcchhhh
Q psy2181         103 LKRKLQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQKEQQASAHNQTSETVY  182 (490)
Q Consensus       103 ~~rK~rR~RT~FT~~Ql~~LE~~Fer~~yP~~~~ReeLA~~lgLs~~qVqvWFqNRR~k~kr~~k~~~~~~~~~~~~~~~  182 (490)
                      .+.+++|.|+.|+..|+++||+.|+..+|||.+.|+.||..+++++..|+|||||||+++++..+.-..       ..+.
T Consensus        56 ~~~~~rr~rt~~~~~ql~~ler~f~~~h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~~~~~~~~-------~~~~  128 (235)
T KOG0490|consen   56 FKFSKRCARCKFTISQLDELERAFEKVHLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRKEERPLPE-------GENL  128 (235)
T ss_pred             hhccccccCCCCCcCHHHHHHHhhcCCCcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhhhhccccc-------cccC
Confidence            357788999999999999999999999999999999999999999999999999999999987641000       0000


Q ss_pred             hhhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCChhh----HHHHHhhCCCCHHHHHHHHHHcCCCcceeeeee
Q psy2181         183 DKLRMFNGQPGWAWYPGSTPTPSPAHLALPHNPGSVTPISRDD----AKEFERTHYPDVFARERLADKIGLPEARIQVSS  258 (490)
Q Consensus       183 ~k~~~~~g~pgwpwyp~s~~~~~p~~~~~~~~rr~rT~ft~eq----e~~F~~n~yp~~~~re~LA~~l~L~e~qVqvWF  258 (490)
                      ..   ..... ...   ...............++.|+.|...+    +..|..++||+...+++|+..+++++..|++||
T Consensus       129 ~~---~~~~~-~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~l~~~~~~~~~~~q~~~  201 (235)
T KOG0490|consen  129 PD---LSGTA-PPS---ASRDKLDKGPSNKKPRRPRTTFTENQLEVLETVFRATPKPDADDREQLAEETGLSERVIQVWF  201 (235)
T ss_pred             CC---CCCCC-Ccc---ccccccccCCCccccCCCccccccchhHhhhhcccCCCCCchhhHHHHHHhcCCChhhhhhhc
Confidence            00   00000 000   00001111122345667788888754    667999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHH
Q psy2181         259 INRVLRNLAAQK  270 (490)
Q Consensus       259 qNRR~k~kk~~k  270 (490)
                      +|+|.+.++...
T Consensus       202 ~~~~~~~~~~~~  213 (235)
T KOG0490|consen  202 QNRRAKLRKHKR  213 (235)
T ss_pred             ccHHHHHHhhcc
Confidence            999999987554

>KOG0484|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG3862|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3755|consensus Back     alignment and domain information
>KOG3517|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 8e-18
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 5e-10
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 3e-06
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-12
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-07
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-12
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-07
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 4e-11
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 3e-05
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 5e-11
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 3e-05
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 8e-11
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-07
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 6e-10
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 2e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 1e-09
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-04
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 4e-07
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 4e-06
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 4e-05
1giq_A413 Crystal Structure Of The Enzymatic Componet Of Iota 3e-04
4gy2_A418 Crystal Structure Of Apo-ia-actin Complex Length = 3e-04
4h0y_A418 Crystal Structure Of Nad+-ia(e380s)-actin Complex L 3e-04
4h0v_A418 Crystal Structure Of Nad+-ia(e378s)-actin Complex L 3e-04
4h0x_A418 Crystal Structure Of Nad+-ia(e380a)-actin Complex L 3e-04
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 88.2 bits (217), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%)
Query: 108 QRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINR 158
           QRNRTSFT EQI++LEKEFERTHYPDVFARERLA KI LPEARIQV   NR
Sbjct: 8   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNR 58
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|1GIQ|A Chain A, Crystal Structure Of The Enzymatic Componet Of Iota-Toxin From Clostridium Perfringens With Nadh Length = 413 Back     alignment and structure
>pdb|4GY2|A Chain A, Crystal Structure Of Apo-ia-actin Complex Length = 418 Back     alignment and structure
>pdb|4H0Y|A Chain A, Crystal Structure Of Nad+-ia(e380s)-actin Complex Length = 418 Back     alignment and structure
>pdb|4H0V|A Chain A, Crystal Structure Of Nad+-ia(e378s)-actin Complex Length = 418 Back     alignment and structure
>pdb|4H0X|A Chain A, Crystal Structure Of Nad+-ia(e380a)-actin Complex Length = 418 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 9e-28
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-13
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-24
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 7e-13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-08
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-24
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 9e-13
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-23
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 4e-12
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-07
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 7e-23
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 5e-13
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-07
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-22
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 8e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 8e-07
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-22
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-13
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-07
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-22
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-06
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-21
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-11
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-05
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-19
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-05
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-18
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-10
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-18
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-09
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 7e-18
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-08
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-16
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-08
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-04
3d1n_I151 POU domain, class 6, transcription factor 1; prote 6e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 9e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 6e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 7e-08
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 8e-04
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-04
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-12
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 8e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 9e-12
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 8e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-11
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-04
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 9e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 9e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-04
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-10
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 5e-10
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-09
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 9e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 7e-05
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-07
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 6e-07
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-06
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-06
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-06
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-06
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 3e-06
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 4e-06
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 7e-06
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 8e-06
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-05
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 8e-05
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  104 bits (262), Expect = 9e-28
 Identities = 34/67 (50%), Positives = 47/67 (70%)

Query: 92  SADEDSQMRLRLKRKLQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARI 151
            +D +S+  + LKRK +R+RT+F+  Q+D LE+ FERT YPD++ RE LA +  L EARI
Sbjct: 3   ISDCESEPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARI 62

Query: 152 QVSSINR 158
           QV   NR
Sbjct: 63  QVWFQNR 69
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.66
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.64
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.64
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.63
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.63
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.63
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.62
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.62
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.62
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.62
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.61
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.61
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.61
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.61
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.61
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.61
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.6
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.6
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.6
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.6
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.6
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.6
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.59
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.59
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.59
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.59
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.59
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.59
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.59
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.59
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.59
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.58
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.58
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.57
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.57
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.57
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.56
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.56
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.56
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.56
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.55
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.55
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.55
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.54
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.54
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.52
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.52
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.51
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.51
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.51
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.51
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.5
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.49
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.49
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.49
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.49
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.48
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.48
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.48
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.48
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.47
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.47
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.47
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.47
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.47
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.46
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.46
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.46
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.46
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.46
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.46
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.46
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.46
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.46
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.45
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.45
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.45
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.45
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.45
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.45
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.45
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.45
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.45
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.45
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.45
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.44
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.44
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.44
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.43
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.43
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.43
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.43
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.43
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.42
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.42
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.42
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.41
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.41
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.41
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.41
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.41
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.41
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.41
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.41
2e19_A64 Transcription factor 8; homeobox domain, structura 99.4
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.4
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.4
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.39
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.39
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.39
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.39
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.38
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.38
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.36
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.36
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.35
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.34
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.34
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.34
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.33
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.33
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.33
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.33
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.31
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.31
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.3
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.3
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.28
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.27
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.27
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.27
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.26
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.26
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.26
2e19_A64 Transcription factor 8; homeobox domain, structura 99.25
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.25
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.25
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.23
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.22
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.22
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.22
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.21
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.18
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.17
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.16
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.05
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.05
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.04
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.94
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.92
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.91
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.83
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.8
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.68
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.03
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.02
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
Probab=99.66  E-value=3.9e-17  Score=134.03  Aligned_cols=66  Identities=50%  Similarity=0.740  Sum_probs=59.4

Q ss_pred             hhhcccCCCCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHcCCCCCceeEechhhhhhHHHHHH
Q psy2181         102 RLKRKLQRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQK  167 (490)
Q Consensus       102 ~~~rK~rR~RT~FT~~Ql~~LE~~Fer~~yP~~~~ReeLA~~lgLs~~qVqvWFqNRR~k~kr~~k  167 (490)
                      ..+++.+|.|+.|+.+|+.+||..|+.++||+..++++||..+||++.+|+|||||||+|+|+...
T Consensus        13 ~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~rk~~~   78 (81)
T 1fjl_A           13 ALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHT   78 (81)
T ss_dssp             ----CCCCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccCCCCCCCCCCCHHHHHHHHHHHHHcCCCCHHHHHHHHHHHCcCHHHHHHHHHHHhhhhhhhcc
Confidence            345778889999999999999999999999999999999999999999999999999999998654
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 490
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-15
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 9e-08
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-07
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-13
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-05
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 9e-06
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 8e-04
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 5e-13
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-04
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 5e-05
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 0.001
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 8e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-04
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 9e-13
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-04
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-04
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-12
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-04
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 9e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 5e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 6e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 0.001
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 7e-12
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 0.001
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 0.001
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-11
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-04
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 9e-05
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-11
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-04
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 0.003
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 0.001
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 0.003
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 5e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 8e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 8e-11
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 0.001
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-10
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-04
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 0.002
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 7e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-04
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-09
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-05
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-09
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 0.001
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-04
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-09
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-04
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 5e-09
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-04
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 8e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-07
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 0.004
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-04
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-07
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-06
d6paxa265 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [Ta 1e-05
d6paxa265 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [Ta 1e-05
d6paxa265 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [Ta 0.002
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 0.001
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.3 bits (167), Expect = 2e-15
 Identities = 44/63 (69%), Positives = 49/63 (77%)

Query: 108 QRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLAAQK 167
           QRNRTSFT EQI++LEKEFERTHYPDVFARERLA KI LPEARIQV   NR  +    +K
Sbjct: 2   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 61

Query: 168 EQQ 170
            + 
Sbjct: 62  LRN 64
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.69
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.69
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.68
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.68
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.68
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.67
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.67
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.67
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.66
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.65
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.64
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.63
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.63
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.63
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.62
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.59
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.58
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.57
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.57
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.57
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.56
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.56
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.56
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.56
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.56
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.55
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.55
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.54
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.52
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.52
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.51
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.51
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.51
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.5
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.49
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.48
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.48
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.48
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.45
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.41
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.41
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.41
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.41
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.39
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.38
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.38
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.36
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.35
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.34
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.32
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.3
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.28
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.28
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.27
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.23
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.19
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.18
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.18
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.17
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.12
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.0
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.0
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Msx-1 homeodomain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.69  E-value=3.5e-18  Score=130.29  Aligned_cols=57  Identities=25%  Similarity=0.460  Sum_probs=54.9

Q ss_pred             CCCCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHcCCCCCceeEechhhhhhHHH
Q psy2181         108 QRNRTSFTNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVSSINRVLRNLA  164 (490)
Q Consensus       108 rR~RT~FT~~Ql~~LE~~Fer~~yP~~~~ReeLA~~lgLs~~qVqvWFqNRR~k~kr  164 (490)
                      ||.|+.||.+|+++||..|+.++||+..++++||..|||++.+|+|||||||+|+|+
T Consensus         1 rr~Rt~ft~~Ql~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~~WFqNrR~k~kr   57 (58)
T d1ig7a_           1 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKR   57 (58)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhheeecCcchHhHhcc
Confidence            467899999999999999999999999999999999999999999999999999986
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure