Psyllid ID: psy2268

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTVS
cccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHccHHHHccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccEEEEEEEEcEEccccccEEEEEEEEEcccccccccEEEEEEEEEEEcccccccccEEEcccccccccccccEEEEEEEcccccEEEEcccEEEEEEEcccccccccccEEEEcccc
ccccHHHEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHccccccccccccccccccccccHHHHHHHHHccccHccccEccccccccccccccccccccccccccccccccccccEEEEEEcHHHHHccccccccccEEEEccccccccEEEEEEEEEEEEccccccccEEEEccccccccccccEEEEEEEcccccEEEccccEEEEEEEEHHHHHcccEEEEEEcccc
MGFNYYAVLGltrgasdydIKMAFRKKAIqynpernndvkSQAMFTLICEAYEVLSDKFRKAIYDQYgeenlkrgvvtplgyvppyeydrdtkrtfrnffgtespfadllnayrppkkqetsgdtatnlqgekgskqditlssnqQVHTVVVSLEELYRGCVKLltvpvqeidpcsvqlnfintsKIVHikikpglpehtvfkfpkepleystssevivitkdkphdvfwregadlhmkknvsltpqernqkyttRMFTVS
MGFNYYAVLgltrgasdydIKMAFRKKAiqynpernndvkSQAMFTLICEAYEVLSDKFRKAIYDQygeenlkrgvvtplgyvppyeYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQGEKgskqditlssnqQVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADlhmkknvsltpqernqkyttrmftvs
MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTVS
**FNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLN**********************************QVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADL*************************
MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEE*********************TKRTFRNFFGTE************************************************VSLEEL****************************KIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTV*
MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRP***********TNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTVS
*GFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQ**KGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTSSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q2KIT4337 DnaJ homolog subfamily B yes N/A 0.927 0.718 0.342 9e-33
Q5R8J8337 DnaJ homolog subfamily B yes N/A 0.927 0.718 0.338 7e-32
Q9UDY4337 DnaJ homolog subfamily B yes N/A 0.927 0.718 0.338 7e-32
Q9D832337 DnaJ homolog subfamily B yes N/A 0.927 0.718 0.330 1e-31
Q3MI00340 DnaJ homolog subfamily B no N/A 0.927 0.711 0.318 2e-31
P25685340 DnaJ homolog subfamily B no N/A 0.927 0.711 0.318 4e-30
Q9QYJ3340 DnaJ homolog subfamily B no N/A 0.923 0.708 0.324 5e-30
Q24133334 DnaJ protein homolog 1 OS yes N/A 0.869 0.679 0.327 2e-29
P59910316 DnaJ homolog subfamily B no N/A 0.888 0.734 0.32 4e-27
O89114348 DnaJ homolog subfamily B no N/A 0.919 0.689 0.311 9e-26
>sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 Back     alignment and function desciption
 Score =  140 bits (353), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 140/260 (53%), Gaps = 18/260 (6%)

Query: 1   MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFR 60
           MG +YY +LG+ +GASD DIK A+RK+A++++P++N   +++  F  + EAYEVLSD  +
Sbjct: 1   MGKDYYCILGIEKGASDEDIKKAYRKQALRFHPDKNKSPQAEERFKEVAEAYEVLSDPKK 60

Query: 61  KAIYDQYGEENLKRGVVTPLGYVPPYEY--DRDTKRTFRNFFGTESP----FADLLNAYR 114
           + IYDQ+GEE LK G     G    + Y    D   TF  FFG  +P    F   +   R
Sbjct: 61  REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGR 120

Query: 115 PPKKQETSGDT----ATNLQGEKGSKQDITLSSNQQ----VHTVVVSLEELYRGCVKLLT 166
              + E  GD       ++ G    +  +  S  +Q    +H + VSLEE+Y GC K + 
Sbjct: 121 DSDEMEVDGDPFGAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMK 180

Query: 167 VPVQEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTS--SEVIVITKDK 224
           +  + ++P     ++    KI+ I+IK G  E T   FP+E  E  TS  ++++ + KDK
Sbjct: 181 ISRKRLNPDG--RSYRTEDKILTIEIKKGWKEGTKITFPREGDETPTSIPADIVFVIKDK 238

Query: 225 PHDVFWREGADLHMKKNVSL 244
            H  F R+G+++     +SL
Sbjct: 239 DHPKFKRDGSNIIYTAKISL 258
Probable chaperone.
Bos taurus (taxid: 9913)
>sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1 Back     alignment and function description
>sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 Back     alignment and function description
>sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 Back     alignment and function description
>sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=2 SV=3 Back     alignment and function description
>sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 Back     alignment and function description
>sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 Back     alignment and function description
>sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
322799628 380 hypothetical protein SINV_07937 [Solenop 0.877 0.602 0.396 5e-39
340725017 370 PREDICTED: LOW QUALITY PROTEIN: dnaJ hom 0.885 0.624 0.387 7e-39
380028213 370 PREDICTED: LOW QUALITY PROTEIN: dnaJ hom 0.885 0.624 0.379 3e-38
110764205 370 PREDICTED: dnaJ homolog subfamily B memb 0.885 0.624 0.375 1e-37
350422099 362 PREDICTED: dnaJ homolog subfamily B memb 0.885 0.638 0.375 3e-37
307203922 365 DnaJ-like protein subfamily B member 13 0.881 0.630 0.386 5e-37
357618078338 putative testis spermatogenesis apoptosi 0.873 0.674 0.400 1e-36
307172180 376 DnaJ-like protein subfamily B member 13 0.881 0.611 0.364 1e-36
170063046325 chaperone protein dnaJ 2 [Culex quinquef 0.881 0.707 0.351 4e-36
383854680 369 PREDICTED: dnaJ homolog subfamily B memb 0.881 0.623 0.386 4e-36
>gi|322799628|gb|EFZ20900.1| hypothetical protein SINV_07937 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 142/247 (57%), Gaps = 18/247 (7%)

Query: 2   GFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRK 61
           G +YY VL L     D +IK A+R+ A++YNPER  +  ++A+F L  EAY+VLSD  R+
Sbjct: 25  GVDYYKVLSLGSNCGDAEIKEAYRRCAVRYNPERQKNGGAEAIFALAAEAYDVLSDPLRR 84

Query: 62  AIYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQET 121
           A+YDQYGEE LK GV  P G+  PY Y  +  RTFR FF TE+P+ DLLN    P+    
Sbjct: 85  AVYDQYGEEGLKNGVPRPEGFAKPYVYHGEPMRTFREFFATENPYDDLLNILTEPQPL-- 142

Query: 122 SGDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVP--VQEIDPCSVQL 179
                  L+  +G  + I       + T+ ++L E++ G +K + +   V   D  S  L
Sbjct: 143 -------LEFPEG--RGIKRKEEPLIKTLFLTLSEVFFGGIKKMKIQKLVLVGDDKSTTL 193

Query: 180 NFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYSTS--SEVIVITKDKPHDVFWREGADLH 237
           +     KI+ I IKPG+P  T   FP+E  +  T   ++VI +T+D+PH+ F REG+DLH
Sbjct: 194 SM---EKILTIPIKPGIPAGTRIVFPEEGDQGPTKIPADVIFVTEDRPHETFRREGSDLH 250

Query: 238 MKKNVSL 244
              ++ L
Sbjct: 251 TTVDIFL 257

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340725017|ref|XP_003400871.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 13-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380028213|ref|XP_003697802.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 13-like [Apis florea] Back     alignment and taxonomy information
>gi|110764205|ref|XP_001123348.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350422099|ref|XP_003493056.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307203922|gb|EFN82829.1| DnaJ-like protein subfamily B member 13 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357618078|gb|EHJ71172.1| putative testis spermatogenesis apoptosis-related protein 6 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307172180|gb|EFN63705.1| DnaJ-like protein subfamily B member 13 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|170063046|ref|XP_001866933.1| chaperone protein dnaJ 2 [Culex quinquefasciatus] gi|167880819|gb|EDS44202.1| chaperone protein dnaJ 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383854680|ref|XP_003702848.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
ZFIN|ZDB-GENE-040801-192340 dnajb4 "DnaJ (Hsp40) homolog, 0.402 0.308 0.477 9.2e-36
UNIPROTKB|F1SCF5339 DNAJB1 "Uncharacterized protei 0.406 0.312 0.423 1.1e-34
UNIPROTKB|E2R9D7340 DNAJB1 "Uncharacterized protei 0.406 0.311 0.419 1.3e-34
UNIPROTKB|F1NKV0342 DNAJB4 "Uncharacterized protei 0.927 0.707 0.351 1.7e-34
UNIPROTKB|F1S9T0344 DNAJB4 "Uncharacterized protei 0.927 0.703 0.35 2.2e-34
UNIPROTKB|F1P9G0337 DNAJB4 "Uncharacterized protei 0.927 0.718 0.346 2.8e-34
UNIPROTKB|Q3MI00340 DNAJB1 "DnaJ homolog subfamily 0.406 0.311 0.410 3.9e-34
RGD|1304725 371 Dnajb1 "DnaJ (Hsp40) homolog, 0.406 0.285 0.419 5.1e-34
UNIPROTKB|E1BWR7345 DNAJB5 "Uncharacterized protei 0.406 0.307 0.444 7.1e-34
UNIPROTKB|Q2KIT4337 DNAJB4 "DnaJ homolog subfamily 0.927 0.718 0.342 7.4e-34
ZFIN|ZDB-GENE-040801-192 dnajb4 "DnaJ (Hsp40) homolog, subfamily B, member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 9.2e-36, Sum P(2) = 9.2e-36
 Identities = 52/109 (47%), Positives = 70/109 (64%)

Query:     1 MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFR 60
             MG +YY +LG+T+GASD DIK A+RK+A++++P++N    ++  F  + EAYEVLSD  +
Sbjct:     1 MGKDYYKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKK 60

Query:    61 KAIYDQYGEENLKRGVVT---PLGYVPPYEYDRDTKRTFRNFFGTESPF 106
             + IYDQYGEE LK G      P G    Y +  D   TF  FFG  SPF
Sbjct:    61 REIYDQYGEEGLKGGGGASDGPGGNFT-YTFHGDPHATFATFFGGASPF 108
GO:0006457 "protein folding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1SCF5 DNAJB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9D7 DNAJB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKV0 DNAJB4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9T0 DNAJB4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P9G0 DNAJB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MI00 DNAJB1 "DnaJ homolog subfamily B member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1304725 Dnajb1 "DnaJ (Hsp40) homolog, subfamily B, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWR7 DNAJB5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIT4 DNAJB4 "DnaJ homolog subfamily B member 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R8J8DNJB4_PONABNo assigned EC number0.33840.92720.7181yesN/A
Q9UDY4DNJB4_HUMANNo assigned EC number0.33840.92720.7181yesN/A
Q24133DNAJ1_DROMENo assigned EC number0.32720.86970.6796yesN/A
Q2KIT4DNJB4_BOVINNo assigned EC number0.34230.92720.7181yesN/A
Q9D832DNJB4_MOUSENo assigned EC number0.33070.92720.7181yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-27
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 8e-25
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 5e-22
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-19
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 5e-19
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 7e-19
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-18
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-17
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-17
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 7e-17
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-16
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 5e-16
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-16
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 6e-16
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 6e-16
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 7e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 9e-16
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-15
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-14
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-14
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-14
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 3e-14
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-14
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 4e-14
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 8e-14
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-13
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-13
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-13
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-12
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-12
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 5e-12
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-11
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-11
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 7e-11
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-10
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-09
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-08
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 4e-06
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 0.003
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  106 bits (268), Expect = 4e-27
 Identities = 67/301 (22%), Positives = 107/301 (35%), Gaps = 89/301 (29%)

Query: 4   NYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVK-SQAMFTLICEAYEVLSDKFRKA 62
           +YY +LG+++ AS+ +IK A+RK A +Y+P+RN   K ++  F  I EAYEVLSD  ++A
Sbjct: 5   DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRA 64

Query: 63  IYDQYGEENLKRGVVTPLGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETS 122
            YDQ+G    K G     G+     +  D    F +FFG            RP + +  +
Sbjct: 65  AYDQFGHAGFKAGGFGGFGFGG---FGGDFGDIFEDFFGGGGG-----GRRRPNRPRRGA 116

Query: 123 GDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGCVKLLTVPVQEI---------- 172
                          D+        + + ++LEE   G  K + V               
Sbjct: 117 ---------------DL-------RYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAK 154

Query: 173 -------------------------------------------DPCSV--QLNFINTSKI 187
                                                      DPC        +   K 
Sbjct: 155 PGTDPKTCPTCNGSGQVRTVQRTGFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKS 214

Query: 188 VHIKIKPGLPEHTVFKFPKEPLEYSTSSE---VIVITKDKPHDVFWREGADLHMKKNVSL 244
           + + I  G+ +    +   E            + V    KPH +F R+G DL+ +  +S 
Sbjct: 215 ISVNIPAGVDDGDRIRLSGEGEAGPNGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISF 274

Query: 245 T 245
           T
Sbjct: 275 T 275

Length = 371
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14288369 chaperone protein DnaJ; Provisional 100.0
PRK14296372 chaperone protein DnaJ; Provisional 100.0
PRK14285365 chaperone protein DnaJ; Provisional 100.0
PRK14286372 chaperone protein DnaJ; Provisional 100.0
PRK14278378 chaperone protein DnaJ; Provisional 100.0
PRK14279392 chaperone protein DnaJ; Provisional 100.0
PRK14284391 chaperone protein DnaJ; Provisional 100.0
PTZ00037 421 DnaJ_C chaperone protein; Provisional 100.0
PRK14276380 chaperone protein DnaJ; Provisional 100.0
PRK14280376 chaperone protein DnaJ; Provisional 100.0
PRK14298377 chaperone protein DnaJ; Provisional 100.0
PRK14287371 chaperone protein DnaJ; Provisional 100.0
PRK14291382 chaperone protein DnaJ; Provisional 100.0
PRK14295389 chaperone protein DnaJ; Provisional 100.0
PRK14297380 chaperone protein DnaJ; Provisional 100.0
PRK14294366 chaperone protein DnaJ; Provisional 100.0
PRK14277386 chaperone protein DnaJ; Provisional 100.0
PRK14301373 chaperone protein DnaJ; Provisional 100.0
PRK14281397 chaperone protein DnaJ; Provisional 100.0
PRK14282369 chaperone protein DnaJ; Provisional 100.0
PRK14299291 chaperone protein DnaJ; Provisional 100.0
PRK14290365 chaperone protein DnaJ; Provisional 100.0
PRK10767371 chaperone protein DnaJ; Provisional 100.0
PRK14300372 chaperone protein DnaJ; Provisional 100.0
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK14283378 chaperone protein DnaJ; Provisional 100.0
PRK14292371 chaperone protein DnaJ; Provisional 100.0
PRK10266306 curved DNA-binding protein CbpA; Provisional 100.0
PRK14289386 chaperone protein DnaJ; Provisional 100.0
PRK14293374 chaperone protein DnaJ; Provisional 100.0
KOG0712|consensus337 100.0
KOG0713|consensus336 100.0
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 100.0
KOG0715|consensus288 99.98
KOG0714|consensus306 99.94
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.86
KOG0716|consensus279 99.84
KOG0717|consensus 508 99.83
KOG0718|consensus 546 99.83
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.82
KOG0691|consensus296 99.81
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.78
KOG0624|consensus504 99.78
KOG0719|consensus264 99.78
PHA03102153 Small T antigen; Reviewed 99.73
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.71
KOG0721|consensus230 99.69
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.69
PRK01356166 hscB co-chaperone HscB; Provisional 99.57
KOG0722|consensus329 99.57
KOG0550|consensus486 99.54
PRK05014171 hscB co-chaperone HscB; Provisional 99.54
KOG0720|consensus490 99.49
PRK03578176 hscB co-chaperone HscB; Provisional 99.48
PRK00294173 hscB co-chaperone HscB; Provisional 99.48
PTZ00100116 DnaJ chaperone protein; Provisional 99.41
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.37
PRK14282369 chaperone protein DnaJ; Provisional 99.36
PHA02624 647 large T antigen; Provisional 99.31
PRK14294366 chaperone protein DnaJ; Provisional 99.3
PRK14290365 chaperone protein DnaJ; Provisional 99.3
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 99.29
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.28
PRK14285365 chaperone protein DnaJ; Provisional 99.27
PRK14298377 chaperone protein DnaJ; Provisional 99.26
PRK10767371 chaperone protein DnaJ; Provisional 99.26
PRK14299291 chaperone protein DnaJ; Provisional 99.26
PRK14284391 chaperone protein DnaJ; Provisional 99.23
PRK14287371 chaperone protein DnaJ; Provisional 99.21
PRK14301373 chaperone protein DnaJ; Provisional 99.2
PRK14288369 chaperone protein DnaJ; Provisional 99.2
PRK14300372 chaperone protein DnaJ; Provisional 99.18
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.18
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.17
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.17
PRK14279392 chaperone protein DnaJ; Provisional 99.16
PRK01773173 hscB co-chaperone HscB; Provisional 99.15
PRK14286372 chaperone protein DnaJ; Provisional 99.15
PRK14295389 chaperone protein DnaJ; Provisional 99.13
PRK14276380 chaperone protein DnaJ; Provisional 99.13
PRK14291382 chaperone protein DnaJ; Provisional 99.13
PRK14280376 chaperone protein DnaJ; Provisional 99.12
PRK14293374 chaperone protein DnaJ; Provisional 99.12
PRK14281397 chaperone protein DnaJ; Provisional 99.11
KOG1150|consensus250 99.09
PRK14297380 chaperone protein DnaJ; Provisional 99.08
PRK14278378 chaperone protein DnaJ; Provisional 99.08
PRK14292371 chaperone protein DnaJ; Provisional 99.07
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.07
PRK14277386 chaperone protein DnaJ; Provisional 99.07
PRK14296372 chaperone protein DnaJ; Provisional 99.05
PRK14283378 chaperone protein DnaJ; Provisional 99.02
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.01
PRK14289386 chaperone protein DnaJ; Provisional 98.98
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.95
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 98.92
KOG0568|consensus342 98.46
KOG1789|consensus 2235 98.39
KOG0723|consensus112 98.21
KOG0712|consensus337 97.62
KOG3192|consensus168 97.24
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 97.09
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.94
KOG0431|consensus453 95.12
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 93.27
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.08
PF1344662 RPT: A repeated domain in UCH-protein 86.79
KOG0724|consensus335 86.34
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 84.82
COG555288 Uncharacterized conserved protein [Function unknow 83.42
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-62  Score=439.91  Aligned_cols=230  Identities=27%  Similarity=0.429  Sum_probs=189.8

Q ss_pred             CCCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC-chhHHHHHHHHHHHHhhcchhhhhhhhhhccchhhccCCcCC
Q psy2268           1 MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNN-DVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTP   79 (261)
Q Consensus         1 ~~~d~y~~Lgv~~~a~~~eik~ayr~la~~~hPd~~~-~~~a~~~f~~i~~Ay~~L~d~~~r~~YD~~G~~~~~~~~~~~   79 (261)
                      |.+|||+||||+++||.+||||||||||++||||+|+ +++|+++|++|++||||||||+||++||+||++++++++.++
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg   81 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGG   81 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCC
Confidence            6789999999999999999999999999999999999 799999999999999999999999999999999987433222


Q ss_pred             CCCCCCCccCCCccccccccCCCCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCceEEEEEeehHhhhc
Q psy2268          80 LGYVPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYR  159 (261)
Q Consensus        80 ~~~~~~~~~~~~~~~~f~~~fg~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~di~~~l~vsl~e~~~  159 (261)
                      ++ .++  |.+++.+||++|||+..                   + +.+++..++++.|       +.+.|+|||+||+.
T Consensus        82 ~g-~~~--fgg~~~DIF~~~FgGg~-------------------~-~~~~~~~~~rG~D-------l~~~l~isleEa~~  131 (371)
T COG0484          82 FG-FGG--FGGDFGDIFEDFFGGGG-------------------G-GRRRPNRPRRGAD-------LRYNLEITLEEAVF  131 (371)
T ss_pred             CC-cCC--CCCCHHHHHHHhhcCCC-------------------c-ccCCCCCcccCCc-------eEEEEEeEhhhhcc
Confidence            11 111  22256777777775210                   1 1112223445666       99999999999999


Q ss_pred             CcEEEEEeEE--Ee--cCC--------------cee------------------------e----------e---eEEee
Q psy2268         160 GCVKLLTVPV--QE--IDP--------------CSV------------------------Q----------L---NFINT  184 (261)
Q Consensus       160 G~~~~i~~~~--~~--~~G--------------~~~------------------------~----------~---~~~~~  184 (261)
                      |++++|.+++  .|  |+|              |.+                        +          |   +++.+
T Consensus       132 G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC~tC~G~G~v~~~~~~g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~  211 (371)
T COG0484         132 GVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTGFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKK  211 (371)
T ss_pred             CceeeEecceeeECCcCCCCCCCCCCCCCcCCCCCCcCeEEEEEeeeEEEEEEECCCCccceeECCCCCCCCCCCCeEee
Confidence            9999999982  21  111              211                        0          1   37889


Q ss_pred             eEEEEEEecCCCCCCCEEEecCCCCCCCC---CCcEEEEEEeccCCCeEEeCCcEEEEeecCHHHHhcCCeEEEeeeec
Q psy2268         185 SKIVHIKIKPGLPEHTVFKFPKEPLEYST---SSEVIVITKDKPHDVFWREGADLHMKKNVSLTPQERNQKYTTRMFTV  260 (261)
Q Consensus       185 ~~~~~V~Ip~G~~~G~~i~~~g~G~~~~~---~GDl~v~i~v~~h~~f~R~g~DL~~~~~Isl~eAl~G~~~~i~tl~~  260 (261)
                      .++++|+||+|+.+|++||++|+|+++++   +|||||+|.|++|+.|.|+|+|||++++|++.+|+||++|.||||..
T Consensus       212 ~~~i~V~IPaGv~~g~~ir~~g~G~~g~~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g  290 (371)
T COG0484         212 KKSISVNIPAGVDDGDRIRLSGEGEAGPNGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDG  290 (371)
T ss_pred             eeEEEEECCCCCccCCEEEEecCcccCCCCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEEEEecCC
Confidence            99999999999999999999999999985   79999999999999999999999999999999999999999999864

>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG5552 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 4e-15
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-13
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 1e-11
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 6e-11
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-11
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 9e-11
3agz_A190 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 9e-11
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-10
2qld_A183 Human Hsp40 Hdj1 Length = 183 1e-10
3agx_A181 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 1e-10
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 3e-10
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 4e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 5e-10
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-09
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-09
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 7e-09
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-08
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 7e-08
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-07
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 6e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-06
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-06
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure 
Iteration: 1

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 54/72 (75%)
Query: 2  GFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRK 61
          G +YY  LGL RGASD +IK A+R++A++Y+P++N +  ++  F  I EAY+VLSD  ++
Sbjct: 2  GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKR 61
Query: 62 AIYDQYGEENLK 73
           I+D+YGEE LK
Sbjct: 62 EIFDRYGEEGLK 73
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 Back     alignment and structure
>pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 5e-29
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 1e-26
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 8e-26
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-25
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-24
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-24
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 7e-24
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 9e-24
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-23
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-23
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-23
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 5e-23
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-22
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-22
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 6e-22
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-21
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 5e-21
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 7e-20
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 1e-19
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 3e-19
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-19
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 8e-19
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 2e-18
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-17
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 6e-17
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 9e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 5e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-13
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-08
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-08
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 3e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 5e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 6e-07
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 7e-07
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 8e-07
2guz_A71 Mitochondrial import inner membrane translocase su 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
 Score =  104 bits (261), Expect = 5e-29
 Identities = 37/75 (49%), Positives = 55/75 (73%)

Query: 1  MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFR 60
          MG +YY  LGL RGASD +IK A+R++A++Y+P++N +  ++  F  I EAY+VLSD  +
Sbjct: 1  MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK 60

Query: 61 KAIYDQYGEENLKRG 75
          + I+D+YGEE LK  
Sbjct: 61 REIFDRYGEEGLKGS 75
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 100.0
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 99.96
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 99.96
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 99.96
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 99.95
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.93
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.92
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.9
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.89
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.89
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.89
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.89
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.88
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.88
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.88
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.87
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.87
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.87
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.87
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.84
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.83
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.82
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.81
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.78
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.77
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.77
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.76
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.75
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.73
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.73
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.72
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.71
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.7
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.7
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.69
2guz_A71 Mitochondrial import inner membrane translocase su 99.67
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.67
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.55
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.48
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 99.29
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 99.29
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 99.29
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 99.28
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.17
2guz_B65 Mitochondrial import inner membrane translocase su 98.92
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 98.79
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 92.76
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=2.1e-54  Score=388.44  Aligned_cols=225  Identities=22%  Similarity=0.299  Sum_probs=101.0

Q ss_pred             CCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHHHHhhcchhhhhhhhhhccchhhccCCcCCCCC
Q psy2268           3 FNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKRGVVTPLGY   82 (261)
Q Consensus         3 ~d~y~~Lgv~~~a~~~eik~ayr~la~~~hPd~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~YD~~G~~~~~~~~~~~~~~   82 (261)
                      +|||+||||+++|+.+|||+|||+||++||||+|+++.|+++|++|++||++|+||.+|+.||+|+......+..++.++
T Consensus        28 ~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~~~  107 (329)
T 3lz8_A           28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQRQT  107 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccccccc
Confidence            69999999999999999999999999999999999888999999999999999999999999999654221111000000


Q ss_pred             -CCCCccCCCccccccccCCCCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCceEEEEEeehHhhhcCc
Q psy2268          83 -VPPYEYDRDTKRTFRNFFGTESPFADLLNAYRPPKKQETSGDTATNLQGEKGSKQDITLSSNQQVHTVVVSLEELYRGC  161 (261)
Q Consensus        83 -~~~~~~~~~~~~~f~~~fg~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~di~~~l~vsl~e~~~G~  161 (261)
                       ..+|. ..++.++|++|||+.          +         .+  +++..+.+++|       +.++|.|||+|++.|+
T Consensus       108 ~~~~f~-~~~f~diF~~~Fg~~----------g---------~~--~~~~~~~~g~D-------l~~~l~vsleea~~G~  158 (329)
T 3lz8_A          108 HEQSYS-QQDFDDIFSSMFGQQ----------A---------HQ--RRRQHAARGHD-------LEIEVAVFLEETLAEQ  158 (329)
T ss_dssp             ---------------------------------------------------CCCCCC-------EEEEECCCTTGGGSCE
T ss_pred             ccCCcC-CCchhhhhHhhhcCc----------C---------CC--CCCCCcCCCCC-------EEEEEecchhhhhhcc
Confidence             00110 012233444444310          0         00  01111334455       9999999999999999


Q ss_pred             EEEEEeEE--EecCCceeeeeEEeeeEEEEEEecCCCCCCCEEEecCCCCCCCC---CCcEEEEEEeccCCCeEEeCCcE
Q psy2268         162 VKLLTVPV--QEIDPCSVQLNFINTSKIVHIKIKPGLPEHTVFKFPKEPLEYST---SSEVIVITKDKPHDVFWREGADL  236 (261)
Q Consensus       162 ~~~i~~~~--~~~~G~~~~~~~~~~~~~~~V~Ip~G~~~G~~i~~~g~G~~~~~---~GDl~v~i~v~~h~~f~R~g~DL  236 (261)
                      +++|.+.+  +|+.|..    .+.+.++++|+||||+++|++|||+|+|+++++   +|||||+|+|++|+.|+|+|+||
T Consensus       159 ~k~i~i~~~v~~g~G~v----~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F~R~G~DL  234 (329)
T 3lz8_A          159 TRTISYNLPVYNVFGMI----ESETPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNL  234 (329)
T ss_dssp             EEEEEEEEEECCSCC-C----CEEEEEEEEEEECTTCCTTCEEEESSCSCCC---CCCCCEEEEECCCCCSSCEEETTEE
T ss_pred             ceEEEEEEEeecCCeEE----EEecceEEEEeCCCCCCCCCEEEEcccccCCCCCCCCCcEEEEEEEecCCccEEcCCcE
Confidence            99999994  3334432    133467899999999999999999999999864   89999999999999999999999


Q ss_pred             EEEeecCHHHHhcCCeEEEeeeec
Q psy2268         237 HMKKNVSLTPQERNQKYTTRMFTV  260 (261)
Q Consensus       237 ~~~~~Isl~eAl~G~~~~i~tl~~  260 (261)
                      +++++|+|+|||||++++|+||..
T Consensus       235 ~~~~~Isl~eAllG~~v~VptLdG  258 (329)
T 3lz8_A          235 EIVLPLAPWEAALGAKVTVPTLKE  258 (329)
T ss_dssp             EEEEEECHHHHHHCEEEEECCSSS
T ss_pred             EEEEECCHHHHcCCCeEEEECCCC
Confidence            999999999999999999999974
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 261
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 9e-21
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-17
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 6e-16
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-12
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-12
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 5e-12
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 6e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-10
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 1e-06
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 81.3 bits (200), Expect = 9e-21
 Identities = 37/75 (49%), Positives = 55/75 (73%)

Query: 1  MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFR 60
          MG +YY  LGL RGASD +IK A+R++A++Y+P++N +  ++  F  I EAY+VLSD  +
Sbjct: 1  MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK 60

Query: 61 KAIYDQYGEENLKRG 75
          + I+D+YGEE LK  
Sbjct: 61 REIFDRYGEEGLKGS 75
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.93
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.86
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.85
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.81
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.79
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.77
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.76
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.73
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.49
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 99.44
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.41
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 98.39
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 95.99
d2b7ea156 Pre-mRNA-processing protein PRP40 {Baker's yeast ( 83.94
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=1.1e-26  Score=164.18  Aligned_cols=74  Identities=50%  Similarity=0.910  Sum_probs=71.4

Q ss_pred             CCCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHHHHhhcchhhhhhhhhhccchhhcc
Q psy2268           1 MGFNYYAVLGLTRGASDYDIKMAFRKKAIQYNPERNNDVKSQAMFTLICEAYEVLSDKFRKAIYDQYGEENLKR   74 (261)
Q Consensus         1 ~~~d~y~~Lgv~~~a~~~eik~ayr~la~~~hPd~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~YD~~G~~~~~~   74 (261)
                      |.+|||+||||+++||.++|++|||++++++|||+++++.+.++|+.|++||+||+||.+|+.||++|++++++
T Consensus         1 m~kdyY~iLgv~~~as~~eIk~ay~~l~~~~hPD~~~~~~~~~~~~~i~~Ay~vLsdp~~R~~YD~~g~~~~~g   74 (77)
T d1hdja_           1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKG   74 (77)
T ss_dssp             CCCCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGGGCCS
T ss_pred             CCCChHHHcCCCCCcCHHHHHHHHHHHHHHhccccccchhHHHHHHHHHHHHHHhcCHHHHHHHHhhhhhhhcC
Confidence            89999999999999999999999999999999999999889999999999999999999999999999998753
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure