Psyllid ID: psy2803


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MVPQKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCII
cccHHHHHHHHHHHHcccccEEccccHHHHHHHHHHHHHHcccccccEEEEEEEHHHHccccccccccHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHEEEEEEcccccccccc
cccHHHHHHHHHHccccccHEEccccHHHHHHHHHHHHHHcccccccEEEEEEEEEHHcHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHEEEEEcHHcccccccc
MVPQKEMLISLVVHHIGlgaifeqgTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLmslhsspnlINFMTrlgfepkftesfgvfcpepqskfdlsLILRQSIIMVdlklfsqsdcii
MVPQKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIImvdlklfsqsdcii
MVPQKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCII
******MLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQ*****
***********VVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCII
MVPQKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCII
*VPQKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCII
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPQKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q03445 991 Glutamate receptor 1 OS=D yes N/A 0.460 0.065 0.742 2e-21
>sp|Q03445|GLK1_DROME Glutamate receptor 1 OS=Drosophila melanogaster GN=Glu-RI PE=2 SV=2 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (84%), Gaps = 1/66 (1%)

Query: 4  QKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADA 63
          Q++  +SL    I LGAIFEQGTD+VQSAFK+AML HN N ++RRFELQAYVDVINTADA
Sbjct: 29 QQQQTVSLT-EKIPLGAIFEQGTDDVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADA 87

Query: 64 FKLSRL 69
          FKLSRL
Sbjct: 88 FKLSRL 93




Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Drosophila melanogaster (taxid: 7227)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
307208275 286 Glutamate receptor 1 [Harpegnathos salta 0.375 0.185 0.905 9e-21
189241889 929 PREDICTED: similar to AGAP006027-PA [Tri 0.382 0.058 0.907 1e-20
350402901 924 PREDICTED: glutamate receptor 1-like [Bo 0.382 0.058 0.870 2e-20
340716839 924 PREDICTED: glutamate receptor 1-like [Bo 0.382 0.058 0.870 2e-20
380018371 1105 PREDICTED: LOW QUALITY PROTEIN: glutamat 0.382 0.048 0.851 4e-20
195337963 539 GM14793 [Drosophila sechellia] gi|194128 0.468 0.122 0.727 9e-20
195374740 1067 GJ12753 [Drosophila virilis] gi|19415331 0.382 0.050 0.888 1e-19
195173933 444 GL18426 [Drosophila persimilis] gi|19411 0.382 0.121 0.870 1e-19
17136702 991 glutamate receptor I [Drosophila melanog 0.460 0.065 0.742 2e-19
195125037 1068 GI12629 [Drosophila mojavensis] gi|19391 0.382 0.050 0.870 2e-19
>gi|307208275|gb|EFN85707.1| Glutamate receptor 1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  104 bits (260), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/53 (90%), Positives = 51/53 (96%)

Query: 17  GLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRL 69
           G GAIFEQGTDEVQSAFKFAML HNQNTTTR+FELQA+VDVINTADA+KLSRL
Sbjct: 214 GRGAIFEQGTDEVQSAFKFAMLNHNQNTTTRKFELQAFVDVINTADAYKLSRL 266




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189241889|ref|XP_968786.2| PREDICTED: similar to AGAP006027-PA [Tribolium castaneum] gi|270016489|gb|EFA12935.1| hypothetical protein TcasGA2_TC010481 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350402901|ref|XP_003486640.1| PREDICTED: glutamate receptor 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716839|ref|XP_003396900.1| PREDICTED: glutamate receptor 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380018371|ref|XP_003693103.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 1-like [Apis florea] Back     alignment and taxonomy information
>gi|195337963|ref|XP_002035595.1| GM14793 [Drosophila sechellia] gi|194128688|gb|EDW50731.1| GM14793 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195374740|ref|XP_002046161.1| GJ12753 [Drosophila virilis] gi|194153319|gb|EDW68503.1| GJ12753 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195173933|ref|XP_002027738.1| GL18426 [Drosophila persimilis] gi|194114700|gb|EDW36743.1| GL18426 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|17136702|ref|NP_476855.1| glutamate receptor I [Drosophila melanogaster] gi|68067727|sp|Q03445.2|GLK1_DROME RecName: Full=Glutamate receptor 1; AltName: Full=Glutamate receptor I; Short=dGLUR-I; AltName: Full=Kainate-selective glutamate receptor; Flags: Precursor gi|23094076|gb|AAF50652.2| glutamate receptor I [Drosophila melanogaster] gi|211938491|gb|ACJ13142.1| FI02103p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195125037|ref|XP_002006989.1| GI12629 [Drosophila mojavensis] gi|193918598|gb|EDW17465.1| GI12629 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
FB|FBgn0004619 991 GluRIA "Glutamate receptor IA" 0.460 0.065 0.742 7e-19
FB|FBgn0264000 1095 GluRIB "Glutamate receptor IB" 0.758 0.097 0.535 1e-18
UNIPROTKB|E9PJZ582 GRIA4 "Glutamate receptor 4" [ 0.368 0.634 0.333 0.00073
FB|FBgn0004619 GluRIA "Glutamate receptor IA" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 239 (89.2 bits), Expect = 7.0e-19, P = 7.0e-19
 Identities = 49/66 (74%), Positives = 56/66 (84%)

Query:     4 QKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADA 63
             Q++  +SL    I LGAIFEQGTD+VQSAFK+AML HN N ++RRFELQAYVDVINTADA
Sbjct:    29 QQQQTVSLT-EKIPLGAIFEQGTDDVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADA 87

Query:    64 FKLSRL 69
             FKLSRL
Sbjct:    88 FKLSRL 93




GO:0006812 "cation transport" evidence=IDA
GO:0004971 "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=IDA
GO:0005230 "extracellular ligand-gated ion channel activity" evidence=IDA
GO:0008328 "ionotropic glutamate receptor complex" evidence=IDA
GO:0005886 "plasma membrane" evidence=ISS
GO:0016021 "integral to membrane" evidence=NAS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA;NAS
FB|FBgn0264000 GluRIB "Glutamate receptor IB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E9PJZ5 GRIA4 "Glutamate receptor 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q03445GLK1_DROMENo assigned EC number0.74240.46090.0655yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
cd06380 382 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isole 5e-11
cd06368 324 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc 1e-06
cd06387 372 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine 0.001
cd06388 371 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine 0.001
>gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
 Score = 58.5 bits (142), Expect = 5e-11
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHN-QNTTTRRFELQAYVDVINTADAFKLSRL 69
          +G +F+   D+  SAF+FA+  HN    +T  F+L  +VD ++T+D+F L+  
Sbjct: 2  IGGLFDVDEDQEYSAFRFAISQHNTNPNSTAPFKLLPHVDNLDTSDSFALTNA 54


N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor, a member of the glutamate-receptor ion channels (iGluRs). AMPA receptors are the major mediators of excitatory synaptic transmission in the central nervous system. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current. Length = 382

>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107382 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
cd06387 372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 99.61
cd06389 370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 99.59
cd06388 371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 99.57
cd06390 364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 99.56
cd06377 382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 99.51
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 99.44
cd06391 400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 99.27
cd06380 382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 99.2
cd06394 333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 98.97
cd06381 363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 98.95
KOG1054|consensus 897 98.91
cd06393 384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 98.8
cd06351 328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 98.68
cd06383 368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 98.64
cd06379 377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 98.44
cd06382 327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 98.43
cd06368 324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 98.36
cd06367 362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 98.14
cd06370 404 PBP1_Speract_GC_like Ligand-binding domain of memb 96.55
cd06269 298 PBP1_glutamate_receptors_like Family C G-protein c 96.38
cd06366 350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 96.36
cd06375 458 PBP1_mGluR_groupII Ligand binding domain of the gr 96.24
cd06376 463 PBP1_mGluR_groupIII Ligand-binding domain of the g 96.24
PF01094 348 ANF_receptor: Receptor family ligand binding regio 96.14
cd06365 469 PBP1_Pheromone_receptor Ligand-binding domain of t 96.04
cd06372 391 PBP1_GC_G_like Ligand-binding domain of membrane g 95.64
cd06386 387 PBP1_NPR_C_like Ligand-binding domain of type C na 95.61
cd06378 362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 94.88
cd06362 452 PBP1_mGluR Ligand binding domain of the metabotrop 94.18
cd06373 396 PBP1_NPR_like Ligand binding domain of natriuretic 93.87
cd06371 382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 93.83
cd06352 389 PBP1_NPR_GC_like Ligand-binding domain of membrane 93.06
cd06385 405 PBP1_NPR_A Ligand-binding domain of type A natriur 92.67
cd06348 344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 92.15
PF13433 363 Peripla_BP_5: Periplasmic binding protein domain; 91.24
cd04509 299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 90.22
cd06340 347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 89.48
cd06364 510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 89.28
cd06347 334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 88.98
cd06330 346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 87.03
cd06331 333 PBP1_AmiC_like Type I periplasmic components of am 87.01
cd06374 472 PBP1_mGluR_groupI Ligand binding domain of the gro 86.88
cd06363 410 PBP1_Taste_receptor Ligand-binding domain of the T 86.82
cd06350 348 PBP1_GPCR_family_C_like Ligand-binding domain of m 86.33
cd06361 403 PBP1_GPC6A_like Ligand-binding domain of the promi 84.26
cd06345 344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 82.44
cd06342 334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 81.87
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
Probab=99.61  E-value=4.2e-16  Score=133.38  Aligned_cols=80  Identities=20%  Similarity=0.322  Sum_probs=68.9

Q ss_pred             eEeEEecCCChHHHHHHHHHHHHhhhccc-Ccc-eeEEEEEEeeCCCChhHHHHHHHHHH---HHHhcccCCC-------
Q psy2803          17 GLGAIFEQGTDEVQSAFKFAMLTHNQNTT-TRR-FELQAYVDVINTADAFKLSRLSIRKM---LVTNLMSLHS-------   84 (141)
Q Consensus        17 ~IGaIFd~~d~~~ElAFk~AI~~IN~~k~-l~~-f~L~p~I~~V~~~DSFeaSkkaC~ql---~~a~~~~~~~-------   84 (141)
                      .|||||+++++++|.||++||+++|++++ .++ ++|+|+|++++++|||++++++|+|+   ++|||||+++       
T Consensus         1 ~iG~iF~~~~~~~~~aF~~Av~~~N~~~~~~~~~~~l~~~i~~~~~~dsf~~~~~~C~l~~~GV~AIfGp~~~~s~~~v~   80 (372)
T cd06387           1 SIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLT   80 (372)
T ss_pred             CcceeecCCcHHHHHHHHHHHHHhcccccccccCeEEEEeeEEecCCChHHHHHHHHHHhhcccEEEEecCCHhHHHHHH
Confidence            38999999999999999999999999874 333 79999999999999999999999999   7888888654       


Q ss_pred             ----CCCcchhhhhcC
Q psy2803          85 ----SPNLINFMTRLG   96 (141)
Q Consensus        85 ----~~~~~~~~~~~~   96 (141)
                          ..++||...+..
T Consensus        81 s~c~~~~iP~i~~~~~   96 (372)
T cd06387          81 SFCGALHTSFITPSFP   96 (372)
T ss_pred             HhhccccCCeeeeCCC
Confidence                557888766543



N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs).

>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 2e-06
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 3e-06
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 5e-06
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score = 45.2 bits (106), Expect = 2e-06
 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 14 HHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSR 68
          + I +G +F +G D+  SAF+  M+  + +     F L  ++D +  A++F ++ 
Sbjct: 1  NSIQIGGLFPRGADQEYSAFRVGMVQFSTS----EFRLTPHIDNLEVANSFAVTN 51


>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 99.27
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 98.63
3qel_B 364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 98.6
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 98.57
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 98.43
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 98.22
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 98.17
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 98.12
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 97.93
3h5l_A 419 Putative branched-chain amino acid ABC transporter 96.34
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 96.0
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 95.98
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 95.87
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 94.49
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 94.46
3i45_A 387 Twin-arginine translocation pathway signal protei; 94.0
3n0x_A 374 Possible substrate binding protein of ABC transpo 93.97
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 93.25
4gnr_A 353 ABC transporter substrate-binding protein-branche 91.25
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 91.25
3ipc_A 356 ABC transporter, substrate binding protein (amino; 88.89
3lop_A 364 Substrate binding periplasmic protein; protein str 85.85
1usg_A 346 Leucine-specific binding protein; leucine-binding 85.35
3td9_A 366 Branched chain amino acid ABC transporter, peripl 83.59
3hut_A 358 Putative branched-chain amino acid ABC transporter 82.89
3lkb_A 392 Probable branched-chain amino acid ABC transporter 82.02
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 80.6
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
Probab=99.27  E-value=9.6e-12  Score=98.09  Aligned_cols=77  Identities=22%  Similarity=0.360  Sum_probs=68.4

Q ss_pred             cccceeeEeEEecCCChHHHHHHHHHHHHhhhcccC--cceeEEEEEEeeCCCChhHHHHHHHHHH---HHHhcccCCCC
Q psy2803          11 LVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTT--RRFELQAYVDVINTADAFKLSRLSIRKM---LVTNLMSLHSS   85 (141)
Q Consensus        11 ~~p~~I~IGaIFd~~d~~~ElAFk~AI~~IN~~k~l--~~f~L~p~I~~V~~~DSFeaSkkaC~ql---~~a~~~~~~~~   85 (141)
                      +.|..|+|||||+.+..+.+.||++||++||++...  ++++|.+.+...+.+|++.+.+++|+++   +.|++||..|.
T Consensus         1 a~P~~I~IG~lf~~~~~~~~~a~~~Av~~iN~~~~ilg~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~V~aiiG~~~S~   80 (389)
T 4gpa_A            1 AFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKR   80 (389)
T ss_dssp             -CCSEEEEEEEECTTCHHHHHHHHHHHHHHHTCSCTTTCSSEEEEEEEECSSCCHHHHHHHHHHHHHTTCSEEEECCCTT
T ss_pred             CCCCeEEEEEEEcCCChHHHHHHHHHHHHHHhCCCCCCCCEEEEEEEecCCCchHHHHHHHHHHHHhcCCEEEEeCCccH
Confidence            468999999999999999999999999999988653  4589999999999999999999999998   78999998876


Q ss_pred             CC
Q psy2803          86 PN   87 (141)
Q Consensus        86 ~~   87 (141)
                      .-
T Consensus        81 ~~   82 (389)
T 4gpa_A           81 SV   82 (389)
T ss_dssp             TH
T ss_pred             HH
Confidence            53



>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1ewka_ 477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 97.15
d1dp4a_ 425 Hormone binding domain of the atrial natriuretic p 96.74
d1jdpa_ 401 Hormone binding domain of the atrial natriuretic p 95.37
d1usga_ 346 Leucine-binding protein {Escherichia coli [TaxId: 90.15
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=97.15  E-value=0.00032  Score=56.43  Aligned_cols=44  Identities=11%  Similarity=-0.034  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHhhhccc-CcceeEEEEEEeeCCCChhHHHHHHHHHH
Q psy2803          30 QSAFKFAMLTHNQNTT-TRRFELQAYVDVINTADAFKLSRLSIRKM   74 (141)
Q Consensus        30 ElAFk~AI~~IN~~k~-l~~f~L~p~I~~V~~~DSFeaSkkaC~ql   74 (141)
                      -.|+.|||++||++.. +|+++|-++|..- -+++..+-+.+.+++
T Consensus        44 ~~Am~~Aie~IN~~~~lLPn~tLg~~i~Dt-c~~~~~a~~~~~~~i   88 (477)
T d1ewka_          44 VEAMFHTLDKINADPVLLPNITLGSEIRDS-CWHSSVALEQSIEFI   88 (477)
T ss_dssp             HHHHHHHHHHHHHCSSSSTTCCEEEEEEEC-TTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCCCCcCCCCEEEEEEEEc-CCChHHHHHHHHHHH
Confidence            4599999999999887 4569999988642 245555555555543



>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure