Psyllid ID: psy2803
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 141 | ||||||
| 307208275 | 286 | Glutamate receptor 1 [Harpegnathos salta | 0.375 | 0.185 | 0.905 | 9e-21 | |
| 189241889 | 929 | PREDICTED: similar to AGAP006027-PA [Tri | 0.382 | 0.058 | 0.907 | 1e-20 | |
| 350402901 | 924 | PREDICTED: glutamate receptor 1-like [Bo | 0.382 | 0.058 | 0.870 | 2e-20 | |
| 340716839 | 924 | PREDICTED: glutamate receptor 1-like [Bo | 0.382 | 0.058 | 0.870 | 2e-20 | |
| 380018371 | 1105 | PREDICTED: LOW QUALITY PROTEIN: glutamat | 0.382 | 0.048 | 0.851 | 4e-20 | |
| 195337963 | 539 | GM14793 [Drosophila sechellia] gi|194128 | 0.468 | 0.122 | 0.727 | 9e-20 | |
| 195374740 | 1067 | GJ12753 [Drosophila virilis] gi|19415331 | 0.382 | 0.050 | 0.888 | 1e-19 | |
| 195173933 | 444 | GL18426 [Drosophila persimilis] gi|19411 | 0.382 | 0.121 | 0.870 | 1e-19 | |
| 17136702 | 991 | glutamate receptor I [Drosophila melanog | 0.460 | 0.065 | 0.742 | 2e-19 | |
| 195125037 | 1068 | GI12629 [Drosophila mojavensis] gi|19391 | 0.382 | 0.050 | 0.870 | 2e-19 |
| >gi|307208275|gb|EFN85707.1| Glutamate receptor 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 104 bits (260), Expect = 9e-21, Method: Compositional matrix adjust.
Identities = 48/53 (90%), Positives = 51/53 (96%)
Query: 17 GLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSRL 69
G GAIFEQGTDEVQSAFKFAML HNQNTTTR+FELQA+VDVINTADA+KLSRL
Sbjct: 214 GRGAIFEQGTDEVQSAFKFAMLNHNQNTTTRKFELQAFVDVINTADAYKLSRL 266
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189241889|ref|XP_968786.2| PREDICTED: similar to AGAP006027-PA [Tribolium castaneum] gi|270016489|gb|EFA12935.1| hypothetical protein TcasGA2_TC010481 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350402901|ref|XP_003486640.1| PREDICTED: glutamate receptor 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340716839|ref|XP_003396900.1| PREDICTED: glutamate receptor 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380018371|ref|XP_003693103.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|195337963|ref|XP_002035595.1| GM14793 [Drosophila sechellia] gi|194128688|gb|EDW50731.1| GM14793 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195374740|ref|XP_002046161.1| GJ12753 [Drosophila virilis] gi|194153319|gb|EDW68503.1| GJ12753 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195173933|ref|XP_002027738.1| GL18426 [Drosophila persimilis] gi|194114700|gb|EDW36743.1| GL18426 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|17136702|ref|NP_476855.1| glutamate receptor I [Drosophila melanogaster] gi|68067727|sp|Q03445.2|GLK1_DROME RecName: Full=Glutamate receptor 1; AltName: Full=Glutamate receptor I; Short=dGLUR-I; AltName: Full=Kainate-selective glutamate receptor; Flags: Precursor gi|23094076|gb|AAF50652.2| glutamate receptor I [Drosophila melanogaster] gi|211938491|gb|ACJ13142.1| FI02103p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195125037|ref|XP_002006989.1| GI12629 [Drosophila mojavensis] gi|193918598|gb|EDW17465.1| GI12629 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 141 | ||||||
| FB|FBgn0004619 | 991 | GluRIA "Glutamate receptor IA" | 0.460 | 0.065 | 0.742 | 7e-19 | |
| FB|FBgn0264000 | 1095 | GluRIB "Glutamate receptor IB" | 0.758 | 0.097 | 0.535 | 1e-18 | |
| UNIPROTKB|E9PJZ5 | 82 | GRIA4 "Glutamate receptor 4" [ | 0.368 | 0.634 | 0.333 | 0.00073 |
| FB|FBgn0004619 GluRIA "Glutamate receptor IA" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 239 (89.2 bits), Expect = 7.0e-19, P = 7.0e-19
Identities = 49/66 (74%), Positives = 56/66 (84%)
Query: 4 QKEMLISLVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADA 63
Q++ +SL I LGAIFEQGTD+VQSAFK+AML HN N ++RRFELQAYVDVINTADA
Sbjct: 29 QQQQTVSLT-EKIPLGAIFEQGTDDVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADA 87
Query: 64 FKLSRL 69
FKLSRL
Sbjct: 88 FKLSRL 93
|
|
| FB|FBgn0264000 GluRIB "Glutamate receptor IB" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PJZ5 GRIA4 "Glutamate receptor 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 141 | |||
| cd06380 | 382 | cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isole | 5e-11 | |
| cd06368 | 324 | cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc | 1e-06 | |
| cd06387 | 372 | cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine | 0.001 | |
| cd06388 | 371 | cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine | 0.001 |
| >gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor | Back alignment and domain information |
|---|
Score = 58.5 bits (142), Expect = 5e-11
Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
Query: 18 LGAIFEQGTDEVQSAFKFAMLTHN-QNTTTRRFELQAYVDVINTADAFKLSRL 69
+G +F+ D+ SAF+FA+ HN +T F+L +VD ++T+D+F L+
Sbjct: 2 IGGLFDVDEDQEYSAFRFAISQHNTNPNSTAPFKLLPHVDNLDTSDSFALTNA 54
|
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor, a member of the glutamate-receptor ion channels (iGluRs). AMPA receptors are the major mediators of excitatory synaptic transmission in the central nervous system. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current. Length = 382 |
| >gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >gnl|CDD|107382 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| cd06387 | 372 | PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin | 99.61 | |
| cd06389 | 370 | PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin | 99.59 | |
| cd06388 | 371 | PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin | 99.57 | |
| cd06390 | 364 | PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin | 99.56 | |
| cd06377 | 382 | PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ | 99.51 | |
| cd06392 | 400 | PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v | 99.44 | |
| cd06391 | 400 | PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v | 99.27 | |
| cd06380 | 382 | PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali | 99.2 | |
| cd06394 | 333 | PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu | 98.97 | |
| cd06381 | 363 | PBP1_iGluR_delta_like N-terminal leucine/isoleucin | 98.95 | |
| KOG1054|consensus | 897 | 98.91 | ||
| cd06393 | 384 | PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol | 98.8 | |
| cd06351 | 328 | PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc | 98.68 | |
| cd06383 | 368 | PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine | 98.64 | |
| cd06379 | 377 | PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ | 98.44 | |
| cd06382 | 327 | PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v | 98.43 | |
| cd06368 | 324 | PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu | 98.36 | |
| cd06367 | 362 | PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali | 98.14 | |
| cd06370 | 404 | PBP1_Speract_GC_like Ligand-binding domain of memb | 96.55 | |
| cd06269 | 298 | PBP1_glutamate_receptors_like Family C G-protein c | 96.38 | |
| cd06366 | 350 | PBP1_GABAb_receptor Ligand-binding domain of GABAb | 96.36 | |
| cd06375 | 458 | PBP1_mGluR_groupII Ligand binding domain of the gr | 96.24 | |
| cd06376 | 463 | PBP1_mGluR_groupIII Ligand-binding domain of the g | 96.24 | |
| PF01094 | 348 | ANF_receptor: Receptor family ligand binding regio | 96.14 | |
| cd06365 | 469 | PBP1_Pheromone_receptor Ligand-binding domain of t | 96.04 | |
| cd06372 | 391 | PBP1_GC_G_like Ligand-binding domain of membrane g | 95.64 | |
| cd06386 | 387 | PBP1_NPR_C_like Ligand-binding domain of type C na | 95.61 | |
| cd06378 | 362 | PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ | 94.88 | |
| cd06362 | 452 | PBP1_mGluR Ligand binding domain of the metabotrop | 94.18 | |
| cd06373 | 396 | PBP1_NPR_like Ligand binding domain of natriuretic | 93.87 | |
| cd06371 | 382 | PBP1_sensory_GC_DEF_like Ligand-binding domain of | 93.83 | |
| cd06352 | 389 | PBP1_NPR_GC_like Ligand-binding domain of membrane | 93.06 | |
| cd06385 | 405 | PBP1_NPR_A Ligand-binding domain of type A natriur | 92.67 | |
| cd06348 | 344 | PBP1_ABC_ligand_binding_like_13 Type I periplasmic | 92.15 | |
| PF13433 | 363 | Peripla_BP_5: Periplasmic binding protein domain; | 91.24 | |
| cd04509 | 299 | PBP1_ABC_transporter_GCPR_C_like Family C of G-pro | 90.22 | |
| cd06340 | 347 | PBP1_ABC_ligand_binding_like_6 Type I periplasmic | 89.48 | |
| cd06364 | 510 | PBP1_CaSR Ligand-binding domain of the CaSR calciu | 89.28 | |
| cd06347 | 334 | PBP1_ABC_ligand_binding_like_12 Type I periplasmic | 88.98 | |
| cd06330 | 346 | PBP1_Arsenic_SBP_like Periplasmic solute-binding d | 87.03 | |
| cd06331 | 333 | PBP1_AmiC_like Type I periplasmic components of am | 87.01 | |
| cd06374 | 472 | PBP1_mGluR_groupI Ligand binding domain of the gro | 86.88 | |
| cd06363 | 410 | PBP1_Taste_receptor Ligand-binding domain of the T | 86.82 | |
| cd06350 | 348 | PBP1_GPCR_family_C_like Ligand-binding domain of m | 86.33 | |
| cd06361 | 403 | PBP1_GPC6A_like Ligand-binding domain of the promi | 84.26 | |
| cd06345 | 344 | PBP1_ABC_ligand_binding_like_10 Type I periplasmic | 82.44 | |
| cd06342 | 334 | PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind | 81.87 |
| >cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor | Back alignment and domain information |
|---|
Probab=99.61 E-value=4.2e-16 Score=133.38 Aligned_cols=80 Identities=20% Similarity=0.322 Sum_probs=68.9
Q ss_pred eEeEEecCCChHHHHHHHHHHHHhhhccc-Ccc-eeEEEEEEeeCCCChhHHHHHHHHHH---HHHhcccCCC-------
Q psy2803 17 GLGAIFEQGTDEVQSAFKFAMLTHNQNTT-TRR-FELQAYVDVINTADAFKLSRLSIRKM---LVTNLMSLHS------- 84 (141)
Q Consensus 17 ~IGaIFd~~d~~~ElAFk~AI~~IN~~k~-l~~-f~L~p~I~~V~~~DSFeaSkkaC~ql---~~a~~~~~~~------- 84 (141)
.|||||+++++++|.||++||+++|++++ .++ ++|+|+|++++++|||++++++|+|+ ++|||||+++
T Consensus 1 ~iG~iF~~~~~~~~~aF~~Av~~~N~~~~~~~~~~~l~~~i~~~~~~dsf~~~~~~C~l~~~GV~AIfGp~~~~s~~~v~ 80 (372)
T cd06387 1 SIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLT 80 (372)
T ss_pred CcceeecCCcHHHHHHHHHHHHHhcccccccccCeEEEEeeEEecCCChHHHHHHHHHHhhcccEEEEecCCHhHHHHHH
Confidence 38999999999999999999999999874 333 79999999999999999999999999 7888888654
Q ss_pred ----CCCcchhhhhcC
Q psy2803 85 ----SPNLINFMTRLG 96 (141)
Q Consensus 85 ----~~~~~~~~~~~~ 96 (141)
..++||...+..
T Consensus 81 s~c~~~~iP~i~~~~~ 96 (372)
T cd06387 81 SFCGALHTSFITPSFP 96 (372)
T ss_pred HhhccccCCeeeeCCC
Confidence 557888766543
|
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs). |
| >cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 | Back alignment and domain information |
|---|
| >KOG1054|consensus | Back alignment and domain information |
|---|
| >cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors | Back alignment and domain information |
|---|
| >cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor | Back alignment and domain information |
|---|
| >cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors | Back alignment and domain information |
|---|
| >cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors | Back alignment and domain information |
|---|
| >cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases | Back alignment and domain information |
|---|
| >cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) | Back alignment and domain information |
|---|
| >cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] | Back alignment and domain information |
|---|
| >cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G | Back alignment and domain information |
|---|
| >cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) | Back alignment and domain information |
|---|
| >cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family | Back alignment and domain information |
|---|
| >cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues | Back alignment and domain information |
|---|
| >cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors | Back alignment and domain information |
|---|
| >cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A | Back alignment and domain information |
|---|
| >cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
| >cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins | Back alignment and domain information |
|---|
| >cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) | Back alignment and domain information |
|---|
| >cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor | Back alignment and domain information |
|---|
| >cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) | Back alignment and domain information |
|---|
| >cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor | Back alignment and domain information |
|---|
| >cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 141 | |||
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 2e-06 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 3e-06 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 5e-06 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 | Back alignment and structure |
|---|
Score = 45.2 bits (106), Expect = 2e-06
Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
Query: 14 HHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLSR 68
+ I +G +F +G D+ SAF+ M+ + + F L ++D + A++F ++
Sbjct: 1 NSIQIGGLFPRGADQEYSAFRVGMVQFSTS----EFRLTPHIDNLEVANSFAVTN 51
|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| 4gpa_A | 389 | Glutamate receptor 4; PBP fold, ligand-gated ION c | 99.27 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 98.63 | |
| 3qel_B | 364 | Glutamate [NMDA] receptor subunit epsilon-2; ION c | 98.6 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 98.57 | |
| 3h6g_A | 395 | Glutamate receptor, ionotropic kainate 2; membrane | 98.43 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 98.22 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 98.17 | |
| 3qek_A | 384 | NMDA glutamate receptor subunit; amino terminal do | 98.12 | |
| 3om0_A | 393 | Glutamate receptor, ionotropic kainate 5; membrane | 97.93 | |
| 3h5l_A | 419 | Putative branched-chain amino acid ABC transporter | 96.34 | |
| 4f11_A | 433 | Gamma-aminobutyric acid type B receptor subunit 2; | 96.0 | |
| 1jdp_A | 441 | NPR-C, atrial natriuretic peptide clearance recept | 95.98 | |
| 1dp4_A | 435 | Atrial natriuretic peptide receptor A; periplasmic | 95.87 | |
| 2e4u_A | 555 | Metabotropic glutamate receptor 3; G-protein-coupl | 94.49 | |
| 3sm9_A | 479 | Mglur3, metabotropic glutamate receptor 3; structu | 94.46 | |
| 3i45_A | 387 | Twin-arginine translocation pathway signal protei; | 94.0 | |
| 3n0x_A | 374 | Possible substrate binding protein of ABC transpo | 93.97 | |
| 3ks9_A | 496 | Mglur1, metabotropic glutamate receptor 1; glutama | 93.25 | |
| 4gnr_A | 353 | ABC transporter substrate-binding protein-branche | 91.25 | |
| 3mq4_A | 481 | Mglur7, metabotropic glutamate receptor 7; glutama | 91.25 | |
| 3ipc_A | 356 | ABC transporter, substrate binding protein (amino; | 88.89 | |
| 3lop_A | 364 | Substrate binding periplasmic protein; protein str | 85.85 | |
| 1usg_A | 346 | Leucine-specific binding protein; leucine-binding | 85.35 | |
| 3td9_A | 366 | Branched chain amino acid ABC transporter, peripl | 83.59 | |
| 3hut_A | 358 | Putative branched-chain amino acid ABC transporter | 82.89 | |
| 3lkb_A | 392 | Probable branched-chain amino acid ABC transporter | 82.02 | |
| 3eaf_A | 391 | ABC transporter, substrate binding protein; PSI2, | 80.6 |
| >4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.27 E-value=9.6e-12 Score=98.09 Aligned_cols=77 Identities=22% Similarity=0.360 Sum_probs=68.4
Q ss_pred cccceeeEeEEecCCChHHHHHHHHHHHHhhhcccC--cceeEEEEEEeeCCCChhHHHHHHHHHH---HHHhcccCCCC
Q psy2803 11 LVVHHIGLGAIFEQGTDEVQSAFKFAMLTHNQNTTT--RRFELQAYVDVINTADAFKLSRLSIRKM---LVTNLMSLHSS 85 (141)
Q Consensus 11 ~~p~~I~IGaIFd~~d~~~ElAFk~AI~~IN~~k~l--~~f~L~p~I~~V~~~DSFeaSkkaC~ql---~~a~~~~~~~~ 85 (141)
+.|..|+|||||+.+..+.+.||++||++||++... ++++|.+.+...+.+|++.+.+++|+++ +.|++||..|.
T Consensus 1 a~P~~I~IG~lf~~~~~~~~~a~~~Av~~iN~~~~ilg~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~V~aiiG~~~S~ 80 (389)
T 4gpa_A 1 AFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKR 80 (389)
T ss_dssp -CCSEEEEEEEECTTCHHHHHHHHHHHHHHHTCSCTTTCSSEEEEEEEECSSCCHHHHHHHHHHHHHTTCSEEEECCCTT
T ss_pred CCCCeEEEEEEEcCCChHHHHHHHHHHHHHHhCCCCCCCCEEEEEEEecCCCchHHHHHHHHHHHHhcCCEEEEeCCccH
Confidence 468999999999999999999999999999988653 4589999999999999999999999998 78999998876
Q ss_pred CC
Q psy2803 86 PN 87 (141)
Q Consensus 86 ~~ 87 (141)
.-
T Consensus 81 ~~ 82 (389)
T 4gpa_A 81 SV 82 (389)
T ss_dssp TH
T ss_pred HH
Confidence 53
|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A | Back alignment and structure |
|---|
| >3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A | Back alignment and structure |
|---|
| >3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* | Back alignment and structure |
|---|
| >3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A | Back alignment and structure |
|---|
| >3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* | Back alignment and structure |
|---|
| >1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* | Back alignment and structure |
|---|
| >1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* | Back alignment and structure |
|---|
| >2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* | Back alignment and structure |
|---|
| >3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B | Back alignment and structure |
|---|
| >3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* | Back alignment and structure |
|---|
| >4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* | Back alignment and structure |
|---|
| >3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A | Back alignment and structure |
|---|
| >3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A | Back alignment and structure |
|---|
| >3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| d1ewka_ | 477 | Metabotropic glutamate receptor subtype 1 {Rat (Ra | 97.15 | |
| d1dp4a_ | 425 | Hormone binding domain of the atrial natriuretic p | 96.74 | |
| d1jdpa_ | 401 | Hormone binding domain of the atrial natriuretic p | 95.37 | |
| d1usga_ | 346 | Leucine-binding protein {Escherichia coli [TaxId: | 90.15 |
| >d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like I superfamily: Periplasmic binding protein-like I family: L-arabinose binding protein-like domain: Metabotropic glutamate receptor subtype 1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=97.15 E-value=0.00032 Score=56.43 Aligned_cols=44 Identities=11% Similarity=-0.034 Sum_probs=31.3
Q ss_pred HHHHHHHHHHhhhccc-CcceeEEEEEEeeCCCChhHHHHHHHHHH
Q psy2803 30 QSAFKFAMLTHNQNTT-TRRFELQAYVDVINTADAFKLSRLSIRKM 74 (141)
Q Consensus 30 ElAFk~AI~~IN~~k~-l~~f~L~p~I~~V~~~DSFeaSkkaC~ql 74 (141)
-.|+.|||++||++.. +|+++|-++|..- -+++..+-+.+.+++
T Consensus 44 ~~Am~~Aie~IN~~~~lLPn~tLg~~i~Dt-c~~~~~a~~~~~~~i 88 (477)
T d1ewka_ 44 VEAMFHTLDKINADPVLLPNITLGSEIRDS-CWHSSVALEQSIEFI 88 (477)
T ss_dssp HHHHHHHHHHHHHCSSSSTTCCEEEEEEEC-TTCHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhCCCCcCCCCEEEEEEEEc-CCChHHHHHHHHHHH
Confidence 4599999999999887 4569999988642 245555555555543
|
| >d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|