Psyllid ID: psy2883

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF
cccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccEEEcccccccccEEEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccc
mytdpnhlhisdpgkvdgnpvftyldqfgtdkkknCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF
mytdpnhlhisdpgkvdgnPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRikrkqlskdkkyIQDILKigsekaqeeAEKTlkriknamnidyf
MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF
*****************GNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKI*************************
MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF
MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF
*YT*PNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDKKYIQDILKIGxxxxxxxxxxxxxxxxxxxxxDYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query112 2.2.26 [Sep-21-2011]
Q46127341 Tryptophan--tRNA ligase O N/A N/A 1.0 0.328 0.5 1e-25
Q9CJD1341 Tryptophan--tRNA ligase O yes N/A 1.0 0.328 0.456 3e-23
Q8DRR1340 Tryptophan--tRNA ligase O yes N/A 0.973 0.320 0.487 5e-23
Q8DWP7341 Tryptophan--tRNA ligase O N/A N/A 0.973 0.319 0.470 2e-22
Q8E2J5341 Tryptophan--tRNA ligase O N/A N/A 0.973 0.319 0.470 2e-22
P67596341 Tryptophan--tRNA ligase O yes N/A 1.0 0.328 0.438 2e-22
P67595341 Tryptophan--tRNA ligase O yes N/A 1.0 0.328 0.438 2e-22
Q9RVD6351 Tryptophan--tRNA ligase 2 yes N/A 0.973 0.310 0.422 2e-21
Q99XH4340 Tryptophan--tRNA ligase O N/A N/A 0.973 0.320 0.470 2e-21
P0DG61340 Tryptophan--tRNA ligase O yes N/A 0.973 0.320 0.470 2e-21
>sp|Q46127|SYW_CLOLO Tryptophan--tRNA ligase OS=Clostridium longisporum GN=trpS PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (68%)

Query: 1   MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVM 60
           MYTDPNH+ ++DPG+V+GN VFTYLD F  D +   + +    +GGLGDV +KK+L E++
Sbjct: 226 MYTDPNHIKVTDPGQVEGNTVFTYLDTFCKDTETLEEMKAHYSRGGLGDVKVKKFLNEIL 285

Query: 61  QDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF 112
           Q  L PIR +RK+  KD   +  ILK GSEKA+E A  TLK ++  + I+YF
Sbjct: 286 QAELEPIRNRRKEFQKDIPEVYRILKEGSEKAREVAAGTLKEVRETIGIEYF 337

Clostridium longisporum (taxid: 1523)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2
>sp|Q9CJD1|SYW_LACLA Tryptophan--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|Q8DRR1|SYW_STRMU Tryptophan--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|Q8DWP7|SYW_STRA5 Tryptophan--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|Q8E2J5|SYW_STRA3 Tryptophan--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|P67596|SYW_STRR6 Tryptophan--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|P67595|SYW_STRPN Tryptophan--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|Q9RVD6|SYW2_DEIRA Tryptophan--tRNA ligase 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpS2 PE=1 SV=1 Back     alignment and function description
>sp|Q99XH4|SYW_STRP1 Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=trpS PE=3 SV=1 Back     alignment and function description
>sp|P0DG61|SYW_STRPQ Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=trpS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
257866176 335 tryptophanyl-tRNA synthetase [Enterococc 1.0 0.334 0.544 6e-30
257875811 335 tryptophanyl-tRNA synthetase [Enterococc 1.0 0.334 0.535 1e-29
315640907 338 tryptophan--tRNA ligase [Enterococcus it 1.0 0.331 0.535 2e-28
314939887 348 tryptophan--tRNA ligase [Enterococcus fa 1.0 0.321 0.526 2e-28
227551334 348 tryptophan--tRNA ligase [Enterococcus fa 1.0 0.321 0.526 2e-28
69246351 336 Tryptophanyl-tRNA synthetase, class Ib [ 1.0 0.333 0.526 2e-28
257887552 336 tryptophanyl-tRNA synthetase [Enterococc 1.0 0.333 0.526 2e-28
293554034 336 tryptophanyl-tRNA synthetase [Enterococc 1.0 0.333 0.526 2e-28
257884716 336 tryptophanyl-tRNA synthetase [Enterococc 1.0 0.333 0.526 2e-28
416143167 307 tryptophanyl-tRNA synthetase [Enterococc 1.0 0.364 0.526 2e-28
>gi|257866176|ref|ZP_05645829.1| tryptophanyl-tRNA synthetase [Enterococcus casseliflavus EC30] gi|257872507|ref|ZP_05652160.1| tryptophanyl-tRNA synthetase [Enterococcus casseliflavus EC10] gi|257800110|gb|EEV29162.1| tryptophanyl-tRNA synthetase [Enterococcus casseliflavus EC30] gi|257806671|gb|EEV35493.1| tryptophanyl-tRNA synthetase [Enterococcus casseliflavus EC10] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 86/112 (76%)

Query: 1   MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVM 60
           MYTDPNH+H++DPG+V+GN VFTYLD FGT+K+K  + +    +GGLGDV IK+YLI+V+
Sbjct: 223 MYTDPNHIHVNDPGQVEGNMVFTYLDVFGTEKEKIAELKEHYTRGGLGDVKIKRYLIDVL 282

Query: 61  QDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF 112
           +    PIR +R+  +KD   + ++LKIGSEKA++ A +TL  +KNAM I+YF
Sbjct: 283 EAEFAPIRERREAFAKDPGEVMNLLKIGSEKAEQVAAQTLAEVKNAMGINYF 334

Source: Enterococcus casseliflavus EC30

Species: Enterococcus casseliflavus

Genus: Enterococcus

Family: Enterococcaceae

Order: Lactobacillales

Class: Bacilli

Phylum: Firmicutes

Superkingdom: Bacteria
>gi|257875811|ref|ZP_05655464.1| tryptophanyl-tRNA synthetase [Enterococcus casseliflavus EC20] gi|325570411|ref|ZP_08146188.1| tryptophan--tRNA ligase [Enterococcus casseliflavus ATCC 12755] gi|420264517|ref|ZP_14767147.1| tryptophanyl-tRNA synthetase [Enterococcus sp. C1] gi|257809977|gb|EEV38797.1| tryptophanyl-tRNA synthetase [Enterococcus casseliflavus EC20] gi|325156621|gb|EGC68798.1| tryptophan--tRNA ligase [Enterococcus casseliflavus ATCC 12755] gi|394768258|gb|EJF48202.1| tryptophanyl-tRNA synthetase [Enterococcus sp. C1] Back     alignment and taxonomy information
>gi|315640907|ref|ZP_07896003.1| tryptophan--tRNA ligase [Enterococcus italicus DSM 15952] gi|315483325|gb|EFU73825.1| tryptophan--tRNA ligase [Enterococcus italicus DSM 15952] Back     alignment and taxonomy information
>gi|314939887|ref|ZP_07847093.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133a04] gi|314943734|ref|ZP_07850473.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133C] gi|314949690|ref|ZP_07853008.1| tryptophan--tRNA ligase [Enterococcus faecium TX0082] gi|314953236|ref|ZP_07856175.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133A] gi|314993684|ref|ZP_07859032.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133B] gi|314997399|ref|ZP_07862350.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133a01] gi|389868467|ref|YP_006375890.1| tryptophan--tRNA ligase [Enterococcus faecium DO] gi|424789054|ref|ZP_18215772.1| tryptophan--tRNA ligase [Enterococcus faecium V689] gi|424797421|ref|ZP_18223012.1| tryptophan--tRNA ligase [Enterococcus faecium S447] gi|424819533|ref|ZP_18244618.1| tryptophan--tRNA ligase [Enterococcus faecium R501] gi|424855214|ref|ZP_18279531.1| tryptophan--tRNA ligase [Enterococcus faecium R499] gi|424868065|ref|ZP_18291830.1| tryptophan--tRNA ligase [Enterococcus faecium R497] gi|424945357|ref|ZP_18361058.1| tryptophan--tRNA ligase [Enterococcus faecium R496] gi|424953217|ref|ZP_18368193.1| tryptophan--tRNA ligase [Enterococcus faecium R494] gi|424955689|ref|ZP_18370510.1| tryptophan--tRNA ligase [Enterococcus faecium R446] gi|424961560|ref|ZP_18375996.1| tryptophan--tRNA ligase [Enterococcus faecium P1986] gi|424965461|ref|ZP_18379444.1| tryptophan--tRNA ligase [Enterococcus faecium P1190] gi|424966734|ref|ZP_18380492.1| tryptophan--tRNA ligase [Enterococcus faecium P1140] gi|424970454|ref|ZP_18383964.1| tryptophan--tRNA ligase [Enterococcus faecium P1139] gi|424973657|ref|ZP_18386927.1| tryptophan--tRNA ligase [Enterococcus faecium P1137] gi|424976701|ref|ZP_18389770.1| tryptophan--tRNA ligase [Enterococcus faecium P1123] gi|424981572|ref|ZP_18394299.1| tryptophan--tRNA ligase [Enterococcus faecium ERV99] gi|424983798|ref|ZP_18396370.1| tryptophan--tRNA ligase [Enterococcus faecium ERV69] gi|424987831|ref|ZP_18400186.1| tryptophan--tRNA ligase [Enterococcus faecium ERV38] gi|424991131|ref|ZP_18403302.1| tryptophan--tRNA ligase [Enterococcus faecium ERV26] gi|424994380|ref|ZP_18406322.1| tryptophan--tRNA ligase [Enterococcus faecium ERV168] gi|424996818|ref|ZP_18408606.1| tryptophan--tRNA ligase [Enterococcus faecium ERV165] gi|424999932|ref|ZP_18411523.1| tryptophan--tRNA ligase [Enterococcus faecium ERV161] gi|425004373|ref|ZP_18415687.1| tryptophan--tRNA ligase [Enterococcus faecium ERV102] gi|425007134|ref|ZP_18418283.1| tryptophan--tRNA ligase [Enterococcus faecium ERV1] gi|425009658|ref|ZP_18420654.1| tryptophan--tRNA ligase [Enterococcus faecium E422] gi|425015548|ref|ZP_18426159.1| tryptophan--tRNA ligase [Enterococcus faecium E417] gi|425017648|ref|ZP_18428145.1| tryptophan--tRNA ligase [Enterococcus faecium C621] gi|425020066|ref|ZP_18430394.1| tryptophan--tRNA ligase [Enterococcus faecium C497] gi|425025566|ref|ZP_18434633.1| tryptophan--tRNA ligase [Enterococcus faecium C1904] gi|425031086|ref|ZP_18436230.1| tryptophan--tRNA ligase [Enterococcus faecium 515] gi|425035803|ref|ZP_18440616.1| tryptophan--tRNA ligase [Enterococcus faecium 514] gi|425037907|ref|ZP_18442546.1| tryptophan--tRNA ligase [Enterococcus faecium 513] gi|425041363|ref|ZP_18445762.1| tryptophan--tRNA ligase [Enterococcus faecium 511] gi|425044123|ref|ZP_18448306.1| tryptophan--tRNA ligase [Enterococcus faecium 510] gi|425048232|ref|ZP_18452149.1| tryptophan--tRNA ligase [Enterococcus faecium 509] gi|425051237|ref|ZP_18454912.1| tryptophan--tRNA ligase [Enterococcus faecium 506] gi|425058520|ref|ZP_18461901.1| tryptophan--tRNA ligase [Enterococcus faecium 504] gi|425061667|ref|ZP_18464877.1| tryptophan--tRNA ligase [Enterococcus faecium 503] gi|313588534|gb|EFR67379.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133a01] gi|313591858|gb|EFR70703.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133B] gi|313594702|gb|EFR73547.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133A] gi|313597597|gb|EFR76442.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133C] gi|313640850|gb|EFS05430.1| tryptophan--tRNA ligase [Enterococcus faecium TX0133a04] gi|313643948|gb|EFS08528.1| tryptophan--tRNA ligase [Enterococcus faecium TX0082] gi|388533716|gb|AFK58908.1| tryptophan--tRNA ligase [Enterococcus faecium DO] gi|402921140|gb|EJX41605.1| tryptophan--tRNA ligase [Enterococcus faecium S447] gi|402922746|gb|EJX43097.1| tryptophan--tRNA ligase [Enterococcus faecium V689] gi|402926083|gb|EJX46148.1| tryptophan--tRNA ligase [Enterococcus faecium R501] gi|402931690|gb|EJX51257.1| tryptophan--tRNA ligase [Enterococcus faecium R499] gi|402935150|gb|EJX54425.1| tryptophan--tRNA ligase [Enterococcus faecium R496] gi|402937476|gb|EJX56586.1| tryptophan--tRNA ligase [Enterococcus faecium R497] gi|402939645|gb|EJX58544.1| tryptophan--tRNA ligase [Enterococcus faecium R494] gi|402943349|gb|EJX61838.1| tryptophan--tRNA ligase [Enterococcus faecium P1986] gi|402943660|gb|EJX62131.1| tryptophan--tRNA ligase [Enterococcus faecium P1190] gi|402948084|gb|EJX66251.1| tryptophan--tRNA ligase [Enterococcus faecium R446] gi|402955920|gb|EJX73414.1| tryptophan--tRNA ligase [Enterococcus faecium P1140] gi|402958120|gb|EJX75461.1| tryptophan--tRNA ligase [Enterococcus faecium P1137] gi|402961695|gb|EJX78704.1| tryptophan--tRNA ligase [Enterococcus faecium P1139] gi|402963420|gb|EJX80287.1| tryptophan--tRNA ligase [Enterococcus faecium ERV99] gi|402968802|gb|EJX85262.1| tryptophan--tRNA ligase [Enterococcus faecium P1123] gi|402970612|gb|EJX86933.1| tryptophan--tRNA ligase [Enterococcus faecium ERV69] gi|402973498|gb|EJX89618.1| tryptophan--tRNA ligase [Enterococcus faecium ERV38] gi|402977579|gb|EJX93383.1| tryptophan--tRNA ligase [Enterococcus faecium ERV26] gi|402980298|gb|EJX95916.1| tryptophan--tRNA ligase [Enterococcus faecium ERV168] gi|402987611|gb|EJY02660.1| tryptophan--tRNA ligase [Enterococcus faecium ERV165] gi|402989570|gb|EJY04491.1| tryptophan--tRNA ligase [Enterococcus faecium ERV102] gi|402990255|gb|EJY05132.1| tryptophan--tRNA ligase [Enterococcus faecium ERV161] gi|402995012|gb|EJY09499.1| tryptophan--tRNA ligase [Enterococcus faecium E417] gi|402995757|gb|EJY10190.1| tryptophan--tRNA ligase [Enterococcus faecium ERV1] gi|403002172|gb|EJY16177.1| tryptophan--tRNA ligase [Enterococcus faecium E422] gi|403003937|gb|EJY17781.1| tryptophan--tRNA ligase [Enterococcus faecium C621] gi|403006451|gb|EJY20091.1| tryptophan--tRNA ligase [Enterococcus faecium C1904] gi|403010210|gb|EJY23601.1| tryptophan--tRNA ligase [Enterococcus faecium C497] gi|403016410|gb|EJY29230.1| tryptophan--tRNA ligase [Enterococcus faecium 515] gi|403016896|gb|EJY29683.1| tryptophan--tRNA ligase [Enterococcus faecium 514] gi|403020772|gb|EJY33274.1| tryptophan--tRNA ligase [Enterococcus faecium 513] gi|403026113|gb|EJY38131.1| tryptophan--tRNA ligase [Enterococcus faecium 511] gi|403030789|gb|EJY42448.1| tryptophan--tRNA ligase [Enterococcus faecium 510] gi|403031269|gb|EJY42888.1| tryptophan--tRNA ligase [Enterococcus faecium 509] gi|403038129|gb|EJY49365.1| tryptophan--tRNA ligase [Enterococcus faecium 506] gi|403038227|gb|EJY49450.1| tryptophan--tRNA ligase [Enterococcus faecium 504] gi|403040735|gb|EJY51791.1| tryptophan--tRNA ligase [Enterococcus faecium 503] Back     alignment and taxonomy information
>gi|227551334|ref|ZP_03981383.1| tryptophan--tRNA ligase [Enterococcus faecium TX1330] gi|424763654|ref|ZP_18191124.1| tryptophan--tRNA ligase [Enterococcus faecium TX1337RF] gi|425054073|ref|ZP_18457588.1| tryptophan--tRNA ligase [Enterococcus faecium 505] gi|227179545|gb|EEI60517.1| tryptophan--tRNA ligase [Enterococcus faecium TX1330] gi|402422551|gb|EJV54788.1| tryptophan--tRNA ligase [Enterococcus faecium TX1337RF] gi|403036598|gb|EJY47941.1| tryptophan--tRNA ligase [Enterococcus faecium 505] Back     alignment and taxonomy information
>gi|69246351|ref|ZP_00603907.1| Tryptophanyl-tRNA synthetase, class Ib [Enterococcus faecium DO] gi|257878161|ref|ZP_05657814.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,230,933] gi|257881055|ref|ZP_05660708.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,231,502] gi|257889640|ref|ZP_05669293.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,231,410] gi|257898674|ref|ZP_05678327.1| tryptophanyl-tRNA synthetase [Enterococcus faecium Com15] gi|260559208|ref|ZP_05831394.1| tryptophanyl-tRNA synthetase [Enterococcus faecium C68] gi|289565816|ref|ZP_06446258.1| tryptophanyl-tRNA synthetase [Enterococcus faecium D344SRF] gi|293569783|ref|ZP_06680870.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1071] gi|293572579|ref|ZP_06683553.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E980] gi|294614010|ref|ZP_06693940.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1636] gi|294619643|ref|ZP_06699065.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1679] gi|294623306|ref|ZP_06702168.1| tryptophanyl-tRNA synthetase [Enterococcus faecium U0317] gi|406580213|ref|ZP_11055429.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD4E] gi|406582437|ref|ZP_11057559.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD3E] gi|406584707|ref|ZP_11059729.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD2E] gi|406589570|ref|ZP_11064002.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD1E] gi|410938190|ref|ZP_11370047.1| tryptophanyl-tRNA ligase II [Enterococcus sp. GMD5E] gi|415893496|ref|ZP_11550178.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4453] gi|427395005|ref|ZP_18887927.1| tryptophanyl-tRNA synthetase [Enterococcus durans FB129-CNAB-4] gi|430820229|ref|ZP_19438865.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0045] gi|430822199|ref|ZP_19440778.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0120] gi|430825248|ref|ZP_19443453.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0164] gi|430828502|ref|ZP_19446622.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0269] gi|430830448|ref|ZP_19448506.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0333] gi|430836068|ref|ZP_19454053.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0680] gi|430841124|ref|ZP_19459044.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1007] gi|430844359|ref|ZP_19462257.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1050] gi|430846341|ref|ZP_19464201.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1133] gi|430849945|ref|ZP_19467712.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1185] gi|430854550|ref|ZP_19472263.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1392] gi|430862118|ref|ZP_19479470.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1573] gi|430864695|ref|ZP_19480520.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1574] gi|430870798|ref|ZP_19483404.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1575] gi|430959839|ref|ZP_19486974.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1576] gi|431071377|ref|ZP_19494348.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1604] gi|431103754|ref|ZP_19496971.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1613] gi|431195433|ref|ZP_19500411.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1620] gi|431228531|ref|ZP_19501672.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1622] gi|431259008|ref|ZP_19505185.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1623] gi|431295294|ref|ZP_19507182.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1626] gi|431369872|ref|ZP_19509571.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1627] gi|431430764|ref|ZP_19512904.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1630] gi|431500742|ref|ZP_19515124.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1634] gi|431539657|ref|ZP_19517861.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1731] gi|431582238|ref|ZP_19520187.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1861] gi|431622444|ref|ZP_19522871.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1904] gi|431737872|ref|ZP_19526823.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1972] gi|431740290|ref|ZP_19529207.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2039] gi|431743633|ref|ZP_19532509.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2071] gi|431745911|ref|ZP_19534748.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2134] gi|431748582|ref|ZP_19537338.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2297] gi|431754552|ref|ZP_19543213.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2883] gi|431759039|ref|ZP_19547656.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E3346] gi|431765337|ref|ZP_19553851.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4215] gi|431766923|ref|ZP_19555383.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1321] gi|431770542|ref|ZP_19558942.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1644] gi|431773065|ref|ZP_19561399.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2369] gi|431776068|ref|ZP_19564336.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2560] gi|431778469|ref|ZP_19566680.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4389] gi|431782169|ref|ZP_19570307.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E6012] gi|431785443|ref|ZP_19573468.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E6045] gi|447913057|ref|YP_007394469.1| Tryptophanyl-tRNA synthetase [Enterococcus faecium NRRL B-2354] gi|68195304|gb|EAN09755.1| Tryptophanyl-tRNA synthetase, class Ib [Enterococcus faecium DO] gi|257812389|gb|EEV41147.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,230,933] gi|257816713|gb|EEV44041.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,231,502] gi|257826000|gb|EEV52626.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,231,410] gi|257836586|gb|EEV61660.1| tryptophanyl-tRNA synthetase [Enterococcus faecium Com15] gi|260074965|gb|EEW63281.1| tryptophanyl-tRNA synthetase [Enterococcus faecium C68] gi|289162359|gb|EFD10217.1| tryptophanyl-tRNA synthetase [Enterococcus faecium D344SRF] gi|291587531|gb|EFF19408.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1071] gi|291593117|gb|EFF24696.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1636] gi|291594117|gb|EFF25569.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1679] gi|291597274|gb|EFF28463.1| tryptophanyl-tRNA synthetase [Enterococcus faecium U0317] gi|291607362|gb|EFF36710.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E980] gi|364092695|gb|EHM35040.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4453] gi|404454364|gb|EKA01309.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD4E] gi|404458058|gb|EKA04523.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD3E] gi|404463740|gb|EKA09326.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD2E] gi|404470619|gb|EKA15230.1| tryptophanyl-tRNA synthetase II [Enterococcus sp. GMD1E] gi|410733477|gb|EKQ75401.1| tryptophanyl-tRNA ligase II [Enterococcus sp. GMD5E] gi|425724141|gb|EKU87025.1| tryptophanyl-tRNA synthetase [Enterococcus durans FB129-CNAB-4] gi|430439719|gb|ELA50040.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0045] gi|430443257|gb|ELA53242.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0120] gi|430446141|gb|ELA55826.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0164] gi|430483050|gb|ELA60149.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0333] gi|430483335|gb|ELA60413.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0269] gi|430488908|gb|ELA65556.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0680] gi|430494566|gb|ELA70809.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1007] gi|430496949|gb|ELA73008.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1050] gi|430536640|gb|ELA77007.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1185] gi|430539135|gb|ELA79397.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1133] gi|430548209|gb|ELA88114.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1392] gi|430549409|gb|ELA89241.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1573] gi|430553476|gb|ELA93162.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1574] gi|430556323|gb|ELA95831.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1576] gi|430558757|gb|ELA98163.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1575] gi|430567010|gb|ELB06096.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1604] gi|430570099|gb|ELB09074.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1613] gi|430571811|gb|ELB10685.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1620] gi|430574833|gb|ELB13596.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1622] gi|430577103|gb|ELB15708.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1623] gi|430581384|gb|ELB19829.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1626] gi|430583619|gb|ELB21977.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1627] gi|430587788|gb|ELB26005.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1630] gi|430587898|gb|ELB26111.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1634] gi|430593877|gb|ELB31852.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1731] gi|430594128|gb|ELB32098.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1861] gi|430598174|gb|ELB35921.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1972] gi|430603414|gb|ELB40939.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1904] gi|430603826|gb|ELB41339.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2039] gi|430606422|gb|ELB43773.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2071] gi|430609551|gb|ELB46735.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2134] gi|430613355|gb|ELB50371.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2297] gi|430619146|gb|ELB55974.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2883] gi|430626664|gb|ELB63230.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E3346] gi|430628424|gb|ELB64859.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4215] gi|430631796|gb|ELB68096.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1321] gi|430635469|gb|ELB71565.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1644] gi|430637352|gb|ELB73375.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2369] gi|430641805|gb|ELB77599.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2560] gi|430644015|gb|ELB79718.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4389] gi|430647412|gb|ELB82858.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E6045] gi|430648184|gb|ELB83607.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E6012] gi|445188766|gb|AGE30408.1| Tryptophanyl-tRNA synthetase [Enterococcus faecium NRRL B-2354] Back     alignment and taxonomy information
>gi|257887552|ref|ZP_05667205.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,141,733] gi|257896046|ref|ZP_05675699.1| tryptophanyl-tRNA synthetase [Enterococcus faecium Com12] gi|293378782|ref|ZP_06624939.1| tryptophan--tRNA ligase [Enterococcus faecium PC4.1] gi|431034918|ref|ZP_19491795.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1590] gi|431751672|ref|ZP_19540359.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2620] gi|431756513|ref|ZP_19545145.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E3083] gi|431761765|ref|ZP_19550327.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E3548] gi|257823606|gb|EEV50538.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,141,733] gi|257832611|gb|EEV59032.1| tryptophanyl-tRNA synthetase [Enterococcus faecium Com12] gi|292642575|gb|EFF60728.1| tryptophan--tRNA ligase [Enterococcus faecium PC4.1] gi|430563633|gb|ELB02842.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1590] gi|430614966|gb|ELB51936.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E2620] gi|430620367|gb|ELB57169.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E3083] gi|430624457|gb|ELB61107.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E3548] Back     alignment and taxonomy information
>gi|293554034|ref|ZP_06674634.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1039] gi|430833371|ref|ZP_19451384.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0679] gi|430837821|ref|ZP_19455771.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0688] gi|430858418|ref|ZP_19476046.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1552] gi|291601816|gb|EFF32068.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1039] gi|430486826|gb|ELA63662.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0679] gi|430492101|gb|ELA68515.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E0688] gi|430545627|gb|ELA85600.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1552] Back     alignment and taxonomy information
>gi|257884716|ref|ZP_05664369.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,231,501] gi|430852648|ref|ZP_19470379.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1258] gi|257820554|gb|EEV47702.1| tryptophanyl-tRNA synthetase [Enterococcus faecium 1,231,501] gi|430541482|gb|ELA81627.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E1258] Back     alignment and taxonomy information
>gi|416143167|ref|ZP_11599722.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4452] gi|364089398|gb|EHM32093.1| tryptophanyl-tRNA synthetase [Enterococcus faecium E4452] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
TIGR_CMR|CBU_2049356 CBU_2049 "tryptophanyl-tRNA sy 0.946 0.297 0.377 9.2e-16
TIGR_CMR|CHY_1947326 CHY_1947 "tryptophanyl-tRNA sy 0.946 0.325 0.321 7.3e-09
TIGR_CMR|GSU_1833327 GSU_1833 "tryptophanyl-tRNA sy 0.964 0.330 0.284 6.7e-06
TIGR_CMR|DET_1343323 DET_1343 "tryptophanyl-tRNA sy 0.937 0.325 0.289 1.1e-05
TIGR_CMR|CBU_2049 CBU_2049 "tryptophanyl-tRNA synthetase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 201 (75.8 bits), Expect = 9.2e-16, P = 9.2e-16
 Identities = 40/106 (37%), Positives = 64/106 (60%)

Query:     1 MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVM 60
             MYTDP  L  +DPG V+ NP++ + D F  DK    + +    +G +GDV  KK L+EV+
Sbjct:   246 MYTDPKRLRATDPGTVENNPLWVFHDTFNPDKNWVDEAKTRYREGRIGDVECKKRLVEVL 305

Query:    61 QDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNA 106
              +FL PI+ +R +   D   +Q IL  G+++  E A++TL+ ++ A
Sbjct:   306 LEFLNPIQQRRAEYENDFAQVQRILNEGAQRVNEIADETLRFVRKA 351
GO:0004830 "tryptophan-tRNA ligase activity" evidence=ISS
GO:0006436 "tryptophanyl-tRNA aminoacylation" evidence=ISS
TIGR_CMR|CHY_1947 CHY_1947 "tryptophanyl-tRNA synthetase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1833 GSU_1833 "tryptophanyl-tRNA synthetase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1343 DET_1343 "tryptophanyl-tRNA synthetase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
PRK12282333 PRK12282, PRK12282, tryptophanyl-tRNA synthetase I 6e-47
PRK00927333 PRK00927, PRK00927, tryptophanyl-tRNA synthetase; 4e-23
COG0180314 COG0180, TrpS, Tryptophanyl-tRNA synthetase [Trans 2e-17
TIGR00233327 TIGR00233, trpS, tryptophanyl-tRNA synthetase 3e-13
PRK12283398 PRK12283, PRK12283, tryptophanyl-tRNA synthetase; 7e-10
PRK12556332 PRK12556, PRK12556, tryptophanyl-tRNA synthetase; 2e-08
PLN02886389 PLN02886, PLN02886, aminoacyl-tRNA ligase 6e-07
cd00806280 cd00806, TrpRS_core, catalytic core domain of tryp 5e-04
>gnl|CDD|183400 PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information 
 Score =  152 bits (387), Expect = 6e-47
 Identities = 62/113 (54%), Positives = 83/113 (73%), Gaps = 2/113 (1%)

Query: 1   MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQ-GGLGDVTIKKYLIEV 59
           MYTDPNH+ + DPGKV+GN VFTYLD F  DK +  + + + YQ GGLGDV  K+YL EV
Sbjct: 221 MYTDPNHIRVEDPGKVEGNVVFTYLDAFDPDKAEVAELK-AHYQRGGLGDVKCKRYLEEV 279

Query: 60  MQDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDYF 112
           +Q+ L PIR +R + +KD  Y+ +ILK GSEKA+E A +TL  +K+AM ++YF
Sbjct: 280 LQELLAPIRERRAEFAKDPGYVLEILKAGSEKAREVAAQTLSEVKDAMGLNYF 332

Length = 333
>gnl|CDD|234866 PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|223258 COG0180, TrpS, Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232888 TIGR00233, trpS, tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183401 PRK12283, PRK12283, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183592 PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215478 PLN02886, PLN02886, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|173903 cd00806, TrpRS_core, catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 112
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 99.97
PLN02886389 aminoacyl-tRNA ligase 99.97
PRK12284431 tryptophanyl-tRNA synthetase; Reviewed 99.96
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 99.96
KOG2713|consensus347 99.96
PRK00927333 tryptophanyl-tRNA synthetase; Reviewed 99.96
PRK12556332 tryptophanyl-tRNA synthetase; Provisional 99.95
TIGR00233328 trpS tryptophanyl-tRNA synthetase. This model repr 99.92
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ri 99.85
PRK12285368 tryptophanyl-tRNA synthetase; Reviewed 99.44
PLN02486383 aminoacyl-tRNA ligase 99.25
PTZ00348 682 tyrosyl-tRNA synthetase; Provisional 99.05
PRK08560329 tyrosyl-tRNA synthetase; Validated 98.96
cd00806280 TrpRS_core catalytic core domain of tryptophanyl-t 98.79
PTZ00126383 tyrosyl-tRNA synthetase; Provisional 98.67
KOG2145|consensus397 97.58
PF00579292 tRNA-synt_1b: tRNA synthetases class I (W and Y); 96.68
cd00805269 TyrRS_core catalytic core domain of tyrosinyl-tRNA 96.19
PRK05912408 tyrosyl-tRNA synthetase; Validated 95.76
PTZ00348682 tyrosyl-tRNA synthetase; Provisional 95.48
cd00395273 Tyr_Trp_RS_core catalytic core domain of tyrosinyl 95.16
PRK13354410 tyrosyl-tRNA synthetase; Provisional 94.28
KOG2144|consensus360 94.21
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information 
Probab=99.97  E-value=2e-30  Score=200.65  Aligned_cols=107  Identities=24%  Similarity=0.455  Sum_probs=100.7

Q ss_pred             CCCCCCCCCCCCCCCCcccHHHHHHHhhCCCCCcC-cHHHH-HHhH-cCCChHHHHHHHHHHHHHhhHHHHHHHHHHhhC
Q psy2883           1 MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKN-CQYEI-SLYQ-GGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKD   77 (112)
Q Consensus         1 a~TDs~~~~~~~~~~p~~~nl~~l~~~~~~~~~~~-~~~~i-~~~~-~~~~~~~~K~~lae~i~~~l~pirer~~~l~~d   77 (112)
                      |+|||.++....|++|++|||++||++|    ++. +++++ ++|+ ++++||+||+.|+|.|+++|+|||+||.++++|
T Consensus       289 a~TDs~~~~~~~~g~Pe~~nl~~i~~~~----~~~~~~~~i~~~~~~g~~~~g~~K~~lae~v~e~L~~irer~~~~~~~  364 (398)
T PRK12283        289 MPTDPARVRRTDPGDPEKCPVWQLHQVY----SDEETKEWVQKGCRSAGIGCLECKQPVIDAILREQQPMRERAQKYEDD  364 (398)
T ss_pred             CCCCCcccccCCCCCCCcCHHHHHHHHh----CCChHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            7899987666777999999999999999    444 68999 9999 899999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcCC
Q psy2883          78 KKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDY  111 (112)
Q Consensus        78 ~~~l~~il~~Ga~kA~~~A~~tl~~Vk~~~Gl~~  111 (112)
                      +++|++||++|++|||++|++||.+||++|||.|
T Consensus       365 ~~~~~~il~~G~~kA~~~a~~t~~~v~~~~g~~~  398 (398)
T PRK12283        365 PSLVRAIVADGCEKARKVARETMRDVREAMGLSY  398 (398)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            9999999999999999999999999999999986

>PLN02886 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>KOG2713|consensus Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02486 aminoacyl-tRNA ligase Back     alignment and domain information
>PTZ00348 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2145|consensus Back     alignment and domain information
>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PTZ00348 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2144|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
2a4m_A331 Structure Of Trprs Ii Bound To Atp Length = 331 4e-23
1yi8_B351 Crystal Structure Of Tryptophanyl Trrna Synthetase 1e-22
2g36_A340 Crystal Structure Of Tryptophanyl-Trna Synthetase ( 7e-11
2el7_A337 Crystal Structure Of Tryptophanyl-Trna Synthetase F 4e-09
>pdb|2A4M|A Chain A, Structure Of Trprs Ii Bound To Atp Length = 331 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%)
Query: 1   MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVM 60
           MYTDP HL  SDPG+V+GNPVFT+LD F  D  +    +     GGLGDV +KK+LI+V+
Sbjct: 220 MYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVL 279
Query: 61  QDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNI 109
              L PIR +R +  +D   +   +  G+ + +E A +TL +++ AM +
Sbjct: 280 NGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRL 328
>pdb|1YI8|B Chain B, Crystal Structure Of Tryptophanyl Trrna Synthetase Ii From Deinococcus Radiodurans In Complex With L-Trp Length = 351 Back     alignment and structure
>pdb|2G36|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase (Ec 6.1.1.2) (Tryptophan-Trna Ligase)(Trprs) (Tm0492) From Thermotoga Maritima At 2.50 A Resolution Length = 340 Back     alignment and structure
>pdb|2EL7|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Thermus Thermophilus Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural g 2e-39
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 3e-38
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 3e-32
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphospha 3e-26
1r6u_A437 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 1e-24
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin 3e-22
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, struc 1e-20
3i05_A395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP 2e-20
3tzl_A322 Tryptophanyl-tRNA synthetase; structural genomics, 2e-18
3tze_A406 Tryptophanyl-tRNA synthetase; structural genomics, 1e-16
1r6t_A477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 2e-16
3vgj_A373 Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; 4e-16
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str 7e-14
3sz3_A341 Tryptophanyl-tRNA synthetase; structural genomics, 2e-13
3n9i_A346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga 1e-12
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, 6e-12
3prh_A388 Tryptophanyl-tRNA synthetase; TRPRS, protein biosy 7e-11
1i6k_A328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA 1e-10
2yy5_A348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt 3e-10
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy 2e-09
3p0j_A690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 3e-04
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 3e-04
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Length = 340 Back     alignment and structure
 Score =  132 bits (335), Expect = 2e-39
 Identities = 34/111 (30%), Positives = 61/111 (54%)

Query: 1   MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVM 60
           M TDP  +  SDPG  +  PV+ Y   F   ++++           +G V  KK L++ M
Sbjct: 230 MMTDPARVRRSDPGNPENCPVWKYHQAFDISEEESKWVWEGCTTASIGCVDCKKLLLKNM 289

Query: 61  QDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDY 111
           +  L PI    +++ +D  Y+ D++  G++KA+E A KT++ ++ AMN+ +
Sbjct: 290 KRKLAPIWENFRKIDEDPHYVDDVIMEGTKKAREVAAKTMEEVRRAMNLMF 340
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Length = 351 Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Length = 337 Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Length = 392 Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Length = 437 Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} Length = 393 Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* Length = 432 Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} Length = 395 Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} PDB: 3m5w_A* Length = 322 Back     alignment and structure
>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} Length = 406 Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Length = 477 Back     alignment and structure
>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} Length = 373 Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} Length = 386 Back     alignment and structure
>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} Length = 341 Back     alignment and structure
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} Length = 346 Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Length = 451 Back     alignment and structure
>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} Length = 388 Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A Length = 328 Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} Length = 348 Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} Length = 375 Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Length = 690 Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Length = 690 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
3sz3_A341 Tryptophanyl-tRNA synthetase; structural genomics, 99.96
3n9i_A346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga 99.95
3prh_A388 Tryptophanyl-tRNA synthetase; TRPRS, protein biosy 99.95
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural g 99.94
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 99.94
3tzl_A322 Tryptophanyl-tRNA synthetase; structural genomics, 99.94
1i6k_A328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA 99.94
2yy5_A348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt 99.93
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 99.93
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphospha 99.6
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, struc 99.57
3tze_A406 Tryptophanyl-tRNA synthetase; structural genomics, 99.49
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin 99.48
3i05_A395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP 99.47
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, 99.46
3a04_A372 Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tR 99.37
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str 99.34
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.25
3vgj_A373 Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; 99.0
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 98.9
2zp1_A314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 98.85
1r6t_A477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 98.85
1r6u_A437 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 98.79
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st 98.69
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy 98.69
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas 98.67
2j5b_A348 Tyrosyl-tRNA synthetase; ligase, protein biosynthe 98.58
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 98.57
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 98.38
3p0j_A690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 97.73
2yxn_A322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 97.57
1y42_X392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 96.88
2pid_A356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 96.83
2ts1_A419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 96.0
1jil_A420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 95.92
2jan_A432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 95.7
>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
Probab=99.96  E-value=1.2e-28  Score=187.50  Aligned_cols=107  Identities=21%  Similarity=0.266  Sum_probs=100.8

Q ss_pred             CCCCCCC---CCCCCCCCCcccHHHHHHHhhCCCCCcCcHHHH-HHhHcCCChHHHHHHHHHHHHHhhHHHHHHHHHHhh
Q psy2883           1 MYTDPNH---LHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEI-SLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSK   76 (112)
Q Consensus         1 a~TDs~~---~~~~~~~~p~~~nl~~l~~~~~~~~~~~~~~~i-~~~~~~~~~~~~K~~lae~i~~~l~pirer~~~l~~   76 (112)
                      |+|||.+   +.++++++|++||++.||++|    ++.+++++ ++|.++.++++||+.|++.|+++|+|||+||+++++
T Consensus       229 a~Td~~~~~~~~~~~~~~p~v~~l~~~~~~~----~~~~~e~i~~~~~g~~~~g~~K~~lae~i~~~l~pirer~~~~~~  304 (341)
T 3sz3_A          229 AQTDAETPPRIAYDVENKAGIANLMGLYSAA----TGKTFAEIEAQYAGVEMYGPFKKDVGEAVVAMLEPVQAEYQRIRN  304 (341)
T ss_dssp             CCCCCCSSCCCCCCTTTCHHHHHHHHHHHHH----HCCCHHHHHHHTTTCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             ccCCCCCCcccccCCCCCcchhHHHHHHHHc----CCccHHHHHHHHccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            6899974   678889999999999999999    77899999 999844899999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcCC
Q psy2883          77 DKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDY  111 (112)
Q Consensus        77 d~~~l~~il~~Ga~kA~~~A~~tl~~Vk~~~Gl~~  111 (112)
                      |+++|++||++|++|||++|++||++||++|||.+
T Consensus       305 ~~~~l~~il~~G~~kA~~~A~~tl~~v~~~~g~~~  339 (341)
T 3sz3_A          305 DREYLNSVMRDGAEKASAKALQTLKKVYAAVGFVA  339 (341)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            99999999999999999999999999999999964
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1 Back     alignment and structure
>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* Back     alignment and structure
>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0 Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0 Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Back     alignment and structure
>3a04_A Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding, protein biosynthesis; 1.97A {Aeropyrum pernix} PDB: 3a05_A* Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus} Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 112
d1i6la_326 c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) 1e-15
d1r6ta2386 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase ( 2e-10
d1n3la_339 c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Hum 0.003
>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} Length = 326 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Tryptophanyl-tRNA synthetase (TrpRS)
species: Bacillus stearothermophilus [TaxId: 1422]

 Score = 68.3 bits (166), Expect = 1e-15
 Identities = 19/109 (17%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 1   MYTDPNHLHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEISLYQGGLGDVTIKKYLIEVM 60
                 +   + PG  +   +++ L     ++ +           G G    K  L +V+
Sbjct: 224 SEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELER-------QYEGKGYGVFKADLAQVV 276

Query: 61  QDFLFPIRIKRKQLSKDKKYIQDILKIGSEKAQEEAEKTLKRIKNAMNI 109
            + L PI+ +     + +  +  +L  G+EKA   A + +++++ AM +
Sbjct: 277 IETLRPIQERYHHWMESE-ELDRVLDEGAEKANRVASEMVRKMEQAMGL 324
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Length = 386 Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Length = 339 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
d1i6la_326 Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus ste 99.95
d1r6ta2386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 98.98
d1n3la_339 Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie 98.63
d1j1ua_306 Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc 98.42
d1h3fa1343 Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi 83.96
>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Tryptophanyl-tRNA synthetase (TrpRS)
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=99.95  E-value=1.5e-28  Score=183.44  Aligned_cols=105  Identities=20%  Similarity=0.304  Sum_probs=98.3

Q ss_pred             CCCCCCC-CCCCCCCCCcccHHHHHHHhhCCCCCcCcHHHH-HHhHcCCChHHHHHHHHHHHHHhhHHHHHHHHHHhhCH
Q psy2883           1 MYTDPNH-LHISDPGKVDGNPVFTYLDQFGTDKKKNCQYEI-SLYQGGLGDVTIKKYLIEVMQDFLFPIRIKRKQLSKDK   78 (112)
Q Consensus         1 a~TDs~~-~~~~~~~~p~~~nl~~l~~~~~~~~~~~~~~~i-~~~~~~~~~~~~K~~lae~i~~~l~pirer~~~l~~d~   78 (112)
                      |+|||.+ +.++++++|+++|++.+|+.+    ++.+++++ .+|. +.+||+||+.|+|.|+++|+|||+||++|++|+
T Consensus       220 a~td~~~~~~~~~~~~p~~~~l~~i~~~~----~~~~~~e~~~~~~-~~~~gdlK~~lae~i~~~L~PiRer~~~l~~~~  294 (326)
T d1i6la_         220 AVTDSEGTIRYDKEAKPGISNLLNIYSTL----SGQSIEELERQYE-GKGYGVFKADLAQVVIETLRPIQERYHHWMESE  294 (326)
T ss_dssp             CCCCSSCCCCCCTTTCHHHHHHHHHHHHH----HCCCHHHHHHHTT-TCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTCT
T ss_pred             hhccccCCccccccCCCCccHHHHHHHHc----CCCcHHHHHHHhc-CCCHHHHHHHHHHHHHHHhHHHHHHHHHHhCCH
Confidence            6899986 888899999999999999999    77889999 8886 778999999999999999999999999999886


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcCC
Q psy2883          79 KYIQDILKIGSEKAQEEAEKTLKRIKNAMNIDY  111 (112)
Q Consensus        79 ~~l~~il~~Ga~kA~~~A~~tl~~Vk~~~Gl~~  111 (112)
                       +|++||++|++|||++|++||++||++|||.+
T Consensus       295 -~l~~iL~~Ga~kAr~~A~~tl~~Vr~~~Gl~r  326 (326)
T d1i6la_         295 -ELDRVLDEGAEKANRVASEMVRKMEQAMGLGR  326 (326)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence             79999999999999999999999999999974
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure