Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Mus musculus (taxid: 10090)
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Mus musculus (taxid: 10090)
>sp|B4J6Q0|FBSP1_DROGR F-box/SPRY domain-containing protein 1 OS=Drosophila grimshawi GN=Fsn PE=3 SV=1
The SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. All four SPSB proteins interact with c-Met, the hepatocyte growth factor receptor, but only SPSB1, SPSB2, and SPSB4 interact with prostate apoptosis response protein 4 (Par-4). They are negative regulators that recruit the ECS E3 ubiquitin ligase complex to polyubiquitinate inducible nitric-oxide synthase (iNOS), resulting in its proteasomal degradation, thus contributing to protection against the cytotoxic effect of iNOS in activated macrophages. It has been shown that SPSB1 and SPSB4 induce the degradation of iNOS more strongly than SPSB2. The Drosophila melanogaster SPSB1 homolog, GUSTAVUS, interacts with the DEAD box RNA helicase Vasa. Suppressor of cytokine signaling (SOCS) proteins negatively regulate signaling from JAK-associated cytokine receptor complexes, and play key roles in the regulation of immune homeostasis. Length = 174
>gnl|CDD|240455 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and suppressors of cytokine signaling (SOCS) proteins
This family consists of the SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) as well as F-box protein 45 (Fbxo45), a novel synaptic E3 and ubiquitin ligase. The SPSB protein is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. SPSB1, SPSB2, and SPSB4 interact with prostate apoptosis response protein 4 (Par-4) and are negative regulators that recruit the ECS E3 ubiquitin ligase complex to polyubiquitinate inducible nitric-oxide synthase (iNOS), resulting in its proteasomal degradation. Fbxo45 is related to this family; it is located N-terminal to the SPRY domain, and known to induce the degradation of a synaptic vesicle-priming factor, Munc13-1, via the SPRY domain, thus playing an important role in the regulation of neurotransmission by modulating Munc13-1 at the synapse. Suppressor of cytokine signaling (SOCS) proteins negatively regulate signaling from JAK-associated cytokine receptor complexes, and play key roles in the regulation of immune homeostasis. Length = 171
>gnl|CDD|240487 cd12907, SPRY_Fbox, SPRY domain in the F-box family Fbxo45
Fbxo45 is a novel synaptic E3 and ubiquitin ligase, related to the suppressor of cytokine signaling (SOCS) proteins and located N-terminal to a SPRY (SPla and the ryanodine receptor) domain. Fbxo45 induces the degradation of a synaptic vesicle-priming factor, Munc13-1, via the SPRY domain, thus playing an important role in the regulation of neurotransmission by modulating Munc13-1 at the synapse. F-box motifs are found in proteins that function as the substrate recognition component of SCF E3 complexes. Length = 175
Score = 62.4 bits (152), Expect = 6e-14
Identities = 34/92 (36%), Positives = 43/92 (46%), Gaps = 11/92 (11%)
Query: 7 TSLVGSNDQSWGWDLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVILDMDEGTLS 66
VG ++ SWG+D R R H + G + D +LD+D GTLS
Sbjct: 31 ERGVGDDEGSWGFDGSRLRKGHGGSSEPGG---------RPWKSGDVVGCLLDLDAGTLS 81
Query: 67 FVVDGQYLGVAFRGL--KGRKLYPIVSAVWGH 96
F ++G LGVAF L KG LYP VS G
Sbjct: 82 FSLNGVDLGVAFENLFRKGGPLYPAVSLGSGQ 113
SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit Ryanodine receptor (hence the name), are homologous to B30.2. SPRY domains have been identified in at least 11 protein families, covering a wide range of functions, including regulation of cytokine signaling (SOCS), RNA metabolism (DDX1 and hnRNP), immunity to retroviruses (TRIM5alpha), intracellular calcium release (ryanodine receptors or RyR) and regulatory and developmental processes (HERC1 and Ash2L). B30.2 also contains residues in the N-terminus that form a distinct PRY domain structure; i.e. B30.2 domain consists of PRY and SPRY subdomains. B30.2 domains comprise the C-terminus of three protein families: BTNs (receptor glycoproteins of immunoglobulin superfamily); several TRIM proteins (composed of RING/B-box/coiled-coil or RBCC core); Stonutoxin (secreted poisonous protein of the stonefish Synanceia horrida). While SPRY domains are evolutionarily ancient, B30.2 domains are a more recent adaptation where the SPRY/PRY combination is a possible component of immune defense. Mutations found in the SPRY-containing proteins have shown to cause Mediterranean fever and Opitz syndrome. Length = 118
>gnl|CDD|240456 cd12876, SPRY_SOCS3, SPRY domain in the suppressor of cytokine signaling 3 (SOCS3) family
The SPRY domain-containing SOCS box protein family (SPSB1-4, also known as SSB-1 to -4) is composed of a central SPRY protein interaction domain and a C-terminal SOCS box. All four SPSB proteins interact with c-Met, the hepatocyte growth factor receptor, but SOCS3 regulates cellular response to a variety of cytokines such as leukemia inhibitory factor (LIF) and interleukin 6. SOCS3, along with SOCS1, are expressed by immune cells and cells of the central nervous system (CNS) and have the potential to impact immune processes within the CNS. In non-small cell lung cancer (NSCLC), SOCS3 is silenced and proline-rich tyrosine kinase 2 (Pyk2) is over-expressed; it has been suggested that SOCS3 could be an effective way to prevent the progression of NSCLC due to its role in regulating Pyk2 expression. Length = 187
>gnl|CDD|214669 smart00449, SPRY, Domain in SPla and the RYanodine Receptor
Score = 56.6 bits (137), Expect = 1e-11
Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 11/100 (11%)
Query: 6 VTSLVGSNDQSWGWDLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVILDMDEGTL 65
L+G ++ SWG+D YH N Y F D LD++EG +
Sbjct: 31 GFRLLGDDEGSWGYDGSGGSKYH---NGESEPYG------LKFQEGDVIGCFLDLEEGEI 81
Query: 66 SFVVDGQYL-GVAFRGLK-GRKLYPIVSAVWGHCEITMKY 103
SF +G+ L G FR ++ G LYP VS + +
Sbjct: 82 SFTKNGKDLGGYTFRNVEFGGPLYPAVSLGSTGEAVQFNF 121
SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues. Length = 125
>gnl|CDD|240461 cd12881, SPRY_HERC1, SPRY domain in HERC1
This SPRY domain is found in the HERC1, a large protein related to chromosome condensation regulator RCC1. It is widely expressed in many tissues, playing an important role in intracellular membrane trafficking in the cytoplasm as well as Golgi apparatus. HERC1 also interacts with tuberous sclerosis 2 (TSC2, tuberin), which suppresses cell growth, and results in the destabilization of TSC2. However, the biological function of HERC1 has yet to be defined. Length = 160
>gnl|CDD|240462 cd12882, SPRY_RNF123, SPRY domain at N-terminus of ring finger protein 123
Score = 44.2 bits (105), Expect = 8e-07
Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 13/85 (15%)
Query: 10 VGSNDQSWGWDLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVILDMDEGTLSFVV 69
VG S+ +D R R ++ S G E +V D +D+DEGT+SF
Sbjct: 42 VGDTPDSYAYDGNRVRKWNVSTQKYG----------EPWVAGDVIGCCIDLDEGTISFYR 91
Query: 70 DGQYLGVAF---RGLKGRKLYPIVS 91
+G+ LGVAF R G +P VS
Sbjct: 92 NGRSLGVAFDNVRRGPGLAYFPAVS 116
This SPRY domain is found at the N-terminus of RING finger protein 123 domain (also known as E3 ubiquitin-protein ligase RNF123). The ring finger domain motif is present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. RNF123 displays E3 ubiquitin ligase activity toward the cyclin-dependent kinase inhibitor p27 (Kip1). Length = 128
>gnl|CDD|240465 cd12885, SPRY_RanBP_like, SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3
Score = 41.9 bits (99), Expect = 7e-06
Identities = 22/98 (22%), Positives = 36/98 (36%), Gaps = 18/98 (18%)
Query: 8 SLVGSNDQSWGW--DLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVI---LDMDE 62
+ G D S+G+ D GR +Y F D V+ ++
Sbjct: 44 RMPGWEDGSYGYHGDDGR--VYLGGGEGENY--------GPPFGTGD---VVGCGINFKT 90
Query: 63 GTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEIT 100
G + F +G+ LG AF + +LYP V ++
Sbjct: 91 GEIFFTKNGELLGTAFENVVKGRLYPTVGLGSPGVKVR 128
This family includes SPRY domains found in Ran binding proteins (RBP or RanBPM) 9 and 10, SSH4 (suppressor of SHR3 null mutation protein 4), SPRY domain-containing protein 3 (SPRYD3) as well as HECT, a C-terminal catalytic domain of a subclass of ubiquitin-protein ligase (E3). RanBP9 and RanBP10 act as androgen receptor (AR) coactivators. Both consist of the N-terminal proline- and glutamine-rich regions, the SPRY domain, and LisH-CTLH and CRA motifs. The SPRY domain in SSH4 may be involved in cargo recognition, either directly or by combination with other adaptors, possibly leading to a higher selectivity. SPRYD3 is highly expressed in most tissues in humans, possibly involved in important cellular processes. HECT E3 mediates the direct transfer of ubiquitin from E2 to substrate. Length = 132
>gnl|CDD|240464 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1
This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 (also known as HNRPUL1 ) which is a major constituent of nuclear matrix or scaffold and binds directly to DNA sequences through the N-terminal acidic region named serum amyloid P (SAP). Its function is specifically modulated by E1B-55kDa in adenovirus-infected cells. HNRPUL1 also participates in ATR protein kinase signaling pathways during adenovirus infection. Two transcript variants encoding different isoforms have been found for this gene. When associated with bromodomain-containing protein 7 (BRD7), it activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Length = 176
>gnl|CDD|240469 cd12889, SPRY_PRY_TRIM67_9, PRY/SPRY domain in tripartite motif-containing proteins, TRIM9 and TRIM67
Score = 38.0 bits (89), Expect = 3e-04
Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
Query: 56 VILDMDEGTLSFVVDGQYLG-VAFRGLKGRKLYPIVS 91
V+LD+D GTLSF V+ + G VAF L G YP S
Sbjct: 121 VLLDLDRGTLSFYVNDEPQGPVAFTNLPG-LFYPAFS 156
This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of TRIM9 proteins. TRIM9 protein is expressed mainly in the cerebral cortex, and functions as an E3 ubiquitin ligase. It has been shown that TRIM9 is localized to the neurons in the normal human brain and its immunoreactivity in affected brain areas in Parkinson's disease and dementia with Lewy bodies is severely decreased, possibly playing an important role in the regulation of neuronal function and participating in pathological process of Lewy body disease through its ligase. TRIM67 negatively regulates Ras activity via degradation of 80K-H , leading to neural differentiation, including neuritogenesis. Length = 172
>gnl|CDD|240453 cd12873, SPRY_DDX1, SPRY domain associated with DEAD box gene DDX1
This SPRY domain is associated with the DEAD box gene, DDX1, an RNA-dependent ATPase involved in HIV-1 Rev function and virus replication. It is suggested that DDX1 acts as a cellular cofactor by promoting oligomerization of Rev on the Rev response element (RRE). DDX1 RNA is overexpressed in breast cancer, data showing a strong and independent association between poor prognosis and deregulation of the DEAD box protein DDX1, thus potentially serving as an effective prognostic biomarker for early recurrence in primary breast cancer. DDX1 also interacts with RelA and enhances nuclear factor kappaB-mediated transcription. DEAD-box proteins are associated with all levels of RNA metabolism and function, and have been implicated in translation initiation, transcription, RNA splicing, ribosome assembly, RNA transport, and RNA decay. Length = 155
>gnl|CDD|240489 cd12909, SPRY_RanBP9_10, SPRY domain in Ran binding proteins 9 and 10
This family includes SPRY domain in Ran binding protein (RBP or RanBPM) 9 and 10, and similar proteins. RanBP9 (also known as RanBPM), a binding partner of Ran, is a small Ras-like GTPase that exerts multiple functions via interactions with various proteins. RanBP9 and RanBP10 also act as androgen receptor (AR) coactivators. Both consist of the N-terminal proline- and glutamine-rich regions, the SPRY domain, and LisH-CTLH and CRA motifs. SPRY domain of RanBPM forms a complex with CD39, a prototypic member of the NTPDase family, thus down-regulating activity substantially. RanBP10 enhances the transcriptional activity of AR in a ligand-dependent manner and exhibits a protein expression pattern different from RanBPM in various cell lines. RanBP10 is highly expressed in AR-positive prostate cancer LNCaP cells, while RanBPM is abundant in WI-38 and MCF-7 cells. Length = 153
Distant homologues are domains in butyrophilin/marenostrin/pyrin []. Ca2+-release from the sarcoplasmic or endoplasmic reticulum, the intracellular Ca2+ store, is mediated by the ryanodine receptor (RyR) and/or the inositol trisphosphate receptor (IP3R).; GO: 0005515 protein binding; PDB: 2V24_A 3EK9_A 2AFJ_A 2IWG_E 3EMW_A 2WL1_A 3TOJ_B 2VOK_A 2VOL_B 2FNJ_A ....
>pdb|3F2O|A Chain A, Crystal Structure Of Human SplaRYANODINE RECEPTOR DOMAIN AND SOCS BOX Containing 1 (Spsb1) In Complex With A 20-Residue Vasa Peptide Length = 233
>pdb|3EMW|A Chain A, Crystal Structure Of Human SplaRYANODINE RECEPTOR DOMAIN AND SOCS BOX Containing 2 (Spsb2) In Complex With A 20-Residue Vasa Peptide Length = 217
