Psyllid ID: psy3001


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
MLANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEWVNDKKPKDEWPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQHEVSEGGENL
cHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEEccccccEEEEccccccHHHHHHHHHHHHccccccEEEcccccccccHHHHccccEEEccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEHHHHccccccccccEEEEEccEEEEcccHHHHHcccccHHHHHHHHccccccccccccccccEEEEEcEEEEEcccccccEEEEEEEEcccEEEEEccccccHHHHHHHHHHHHccccccEEEcccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEccccccEEEEEccccccHHHHHHHHHHHccccccEEEEccccHHHccHHHHHHHccEcccccEEEccccccccEEEcccHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHcHccccHHHcccccccEccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHcccccccccccccccEEEEEEEEEEcccccccEEEcEEEEEccccEEEEEccccccHHHHHHHHHHHccccccEEEEccccHHHccHHHHHHHccccccccEEEcccHHHHccccccccHHHHHHHHHHHcHHHHHHHccccccEEEccccccc
mlangsiraskgLHLVVLRNILHScmsffdttpvgrMISRFSQdvetvdsnlpTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLrwsplffdttpvgrvlsrfssdvntldnklTLSVQQtlsqpfkitQTLNWLVRMTSDVETNIVAVERIKeygetpqeaewvndkkpkdewpekgevefKDYKVRYREGLELVGIvgrtgagksSLTLALFRIiepadgtiiidgvdirtlglhTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSliftedvkpliitpfcsNLQRFYVATSRQLkrlesvsrspiyshfgetvtgnvgQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGlvvefdspsvlmkNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIvgrtgagksSLTLALFRIiepadgtiiidgvdirtlglhtlrsrltiipqdpvlfsgtlrlnldpvgessDEAIWKALELAHLNTFVSNLPARLQHEVSEGGENL
mlangsiraskgLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLsvqqtlsqpfkitqtlNWLVRMTSDVETNIVAVERIKeygetpqeaewvndkkpkdewpekgevefkdykVRYREGLELvgivgrtgagksSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKrlesvsrspiyshfgetvtgnvgqRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLvvefdspsvlMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSrltiipqdpvlfsGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQHEVSEGGENL
MLANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEWVNDKKPKDEWPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYstpvfifvivpvsvLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQHEVSEGGENL
**********KGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYG**********************EVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLP**************
MLANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEA***********WPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQ**********************NVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWL*VRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQHEVSEGGE**
MLANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEWVNDKKPKDEWPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQ**********
MLANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEWVNDKKPKDEWPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQHEVSEG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMPVTITVFFYGFVISLGTLFAAKRLHEKLLKSMLRWSPLFFDTTPVGRVLSRFSSDVNTLDNKLTLSVQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEWVNDKKPKDEWPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLAWLAVRLETVGNLITFSAALLAVLSKETLNAGLVGLSVSYAMQVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGESSDEAIWKALELAHLNTFVSNLPARLQHEVSEGGENL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query602 2.2.26 [Sep-21-2011]
Q928871545 Canalicular multispecific yes N/A 0.689 0.268 0.423 9e-93
Q286891564 Canalicular multispecific no N/A 0.696 0.267 0.409 3e-91
O353791528 Multidrug resistance-asso yes N/A 0.674 0.265 0.419 3e-88
Q8HXQ51530 Multidrug resistance-asso yes N/A 0.677 0.266 0.418 7e-88
P335271531 Multidrug resistance-asso no N/A 0.677 0.266 0.416 1e-87
Q8CG091532 Multidrug resistance-asso yes N/A 0.677 0.266 0.420 2e-87
B2RX121523 Canalicular multispecific no N/A 0.682 0.269 0.402 2e-87
Q6UR051531 Multidrug resistance-asso no N/A 0.677 0.266 0.416 9e-87
Q864R91531 Multidrug resistance-asso N/A N/A 0.677 0.266 0.413 9e-87
O154381527 Canalicular multispecific no N/A 0.684 0.269 0.406 2e-85
>sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 Back     alignment and function desciption
 Score =  341 bits (875), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 223/526 (42%), Positives = 295/526 (56%), Gaps = 111/526 (21%)

Query: 3    ANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINC 62
            A G + AS  LH  +L NIL + M FFDTTP GR+++RF+ D+ TVD  LP  LRSWI C
Sbjct: 1046 AFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRIVNRFAGDISTVDDTLPQSLRSWITC 1105

Query: 63   LFSVLYLM-------PV-TITVFFYGFV-ISLGTLFAAKRLHEKLLKSMLRWSPLF--FD 111
               ++  +       PV TI V   G + +S+   + +     + L S+ R SP++  F 
Sbjct: 1106 FLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMFYVSTSRQLRRLDSVTR-SPIYSHFS 1164

Query: 112  TT----PVGRV-----------------------------------------LSRFSSDV 126
             T    PV R                                          L+ F S +
Sbjct: 1165 ETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSWITSNRWLAIRLELVGNLTVFFSAL 1224

Query: 127  NTLDNKLTLS---VQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEW 183
              +  + TLS   V   LS    ITQTLNWLVRMTS++ETNIVAVERI EY +   EA W
Sbjct: 1225 MMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTSEIETNIVAVERITEYTKVENEAPW 1284

Query: 184  VNDKKPKDEWPEKGEVEFKDYKVRYREGLELV--------------GIVGRTGAGKSSLT 229
            V DK+P  +WP KG+++F +Y+VRYR  L+LV              G+VGRTGAGKSSLT
Sbjct: 1285 VTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGITCDIGSMEKIGVVGRTGAGKSSLT 1344

Query: 230  LALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPV 289
              LFRI+E A G IIIDGVDI ++GLH LR +LTIIPQ            P+        
Sbjct: 1345 NCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIPQ-----------DPI-------- 1385

Query: 290  SVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLES--VSRSPIYSHFGET 347
                       +F+  ++ + + PF +N     +  + +L  L+S   S     SH    
Sbjct: 1386 -----------LFSGSLR-MNLDPF-NNYSDEEIWKALELAHLKSFVASLQLGLSHEVTE 1432

Query: 348  VTGN--VGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIA 405
              GN  +GQRQL+CL RALLRK+KIL+LDEATAA+DLETD+LIQ+TI++EFAHCTV+TIA
Sbjct: 1433 AGGNLSIGQRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIA 1492

Query: 406  HRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGL 451
            HRL+TI+DSD+V+VLD G ++E  SP  L++     FY MAK+AG+
Sbjct: 1493 HRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGP-FYFMAKEAGI 1537




Mediates hepatobiliary excretion of numerous organic anions. May function as a cellular cisplatin transporter.
Homo sapiens (taxid: 9606)
>sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 Back     alignment and function description
>sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 Back     alignment and function description
>sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 Back     alignment and function description
>sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 Back     alignment and function description
>sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 Back     alignment and function description
>sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 Back     alignment and function description
>sp|Q6UR05|MRP1_CANFA Multidrug resistance-associated protein 1 OS=Canis familiaris GN=ABCC1 PE=2 SV=1 Back     alignment and function description
>sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 Back     alignment and function description
>sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
383847547 1526 PREDICTED: multidrug resistance-associat 0.687 0.271 0.459 1e-105
270013629 1806 hypothetical protein TcasGA2_TC012253 [T 0.687 0.229 0.463 1e-103
189240635 1890 PREDICTED: similar to AGAP009835-PA [Tri 0.687 0.219 0.463 1e-103
380015470 1523 PREDICTED: LOW QUALITY PROTEIN: multidru 0.687 0.271 0.455 1e-102
242014418 1471 multidrug resistance protein, putative [ 0.684 0.280 0.446 1e-102
328777607 1524 PREDICTED: multidrug resistance-associat 0.687 0.271 0.455 1e-102
45552343 1548 Multidrug-Resistance like protein 1, iso 0.699 0.271 0.450 1e-101
45552363 1548 Multidrug-Resistance like protein 1, iso 0.699 0.271 0.450 1e-100
158298785 1877 AGAP009835-PA [Anopheles gambiae str. PE 0.692 0.222 0.465 1e-100
195351121 2042 GM10053 [Drosophila sechellia] gi|194123 0.699 0.206 0.450 1e-100
>gi|383847547|ref|XP_003699414.1| PREDICTED: multidrug resistance-associated protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 242/527 (45%), Positives = 311/527 (59%), Gaps = 113/527 (21%)

Query: 5    GSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLF 64
            G   A++ +H+V+LR ++ + ++FFDTTP+GR+ISRF++DV+ +D++LP  +   I CLF
Sbjct: 1033 GCWLAARQMHIVMLRAVMRAPLTFFDTTPIGRIISRFAKDVDVLDTSLPQQISDSIYCLF 1092

Query: 65   SVLYLMPVTI--TVFFYGFVISLG-------TLFAAKRLHEKLLKSMLRWSPLF--FDTT 113
             V+  + V    T  F   ++ +G        ++ A     K L+S+ R SP++  F  T
Sbjct: 1093 EVIATLVVISFSTPIFVAVIVPIGGIYYFVQRMYVASSRQLKRLESISR-SPIYSHFSET 1151

Query: 114  PVGR-------VLSRF-SSDVNTLD----------------------------------- 130
              G        V  RF     N +D                                   
Sbjct: 1152 VTGTQMIRAFGVQERFIRESENKVDFNQVCYYPSIIANRWLAVRLEMVGNLIIFFAALFA 1211

Query: 131  --NKLTLS---VQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAEWVN 185
              NK T+    V  ++S   ++TQTLNWLVRMTSDVETNIVAVERIKEYGETPQEA W N
Sbjct: 1212 VLNKDTIKSGVVGLSVSYALQVTQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAPWKN 1271

Query: 186  -DKKPKDEWPEKGEVEFKDYKVRYREGLELV--------------GIVGRTGAGKSSLTL 230
             +  P  EWP +G VEFKDYKVRYREGLELV              GIVGRTGAGKSSLTL
Sbjct: 1272 PNYTPPKEWPVQGTVEFKDYKVRYREGLELVLRGLSFSVKGGEKVGIVGRTGAGKSSLTL 1331

Query: 231  ALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVS 290
            ALFRIIE ADG I ID +DI  LGLH LRSRLTIIPQ            P+         
Sbjct: 1332 ALFRIIEAADGKIFIDDIDIAKLGLHDLRSRLTIIPQ-----------DPI--------- 1371

Query: 291  VLYFFIQVSLIFTEDVKPLIITPF-CSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVT 349
                      +F+  ++ + + PF C      + A       L+S  ++       E   
Sbjct: 1372 ----------LFSGTLR-INLDPFNCYTDDEVWRALEH--AHLKSFIKTLPNGLLHEITE 1418

Query: 350  G----NVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIA 405
            G    ++GQRQLICLARALLRKTK+LILDEATA++DLETDDLIQ+TIR EF+ CTVLTIA
Sbjct: 1419 GGENLSIGQRQLICLARALLRKTKVLILDEATASVDLETDDLIQTTIRQEFSDCTVLTIA 1478

Query: 406  HRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLA 452
            HRLNTI+DSDRV+VLDKGL++E+DSP  L++N +S+F+++AKDAGLA
Sbjct: 1479 HRLNTILDSDRVIVLDKGLIMEYDSPEALLRNSSSLFHNIAKDAGLA 1525




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270013629|gb|EFA10077.1| hypothetical protein TcasGA2_TC012253 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240635|ref|XP_969354.2| PREDICTED: similar to AGAP009835-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380015470|ref|XP_003691724.1| PREDICTED: LOW QUALITY PROTEIN: multidrug resistance-associated protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|242014418|ref|XP_002427888.1| multidrug resistance protein, putative [Pediculus humanus corporis] gi|212512357|gb|EEB15150.1| multidrug resistance protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328777607|ref|XP_003249371.1| PREDICTED: multidrug resistance-associated protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|45552343|ref|NP_995694.1| Multidrug-Resistance like protein 1, isoform H [Drosophila melanogaster] gi|45445110|gb|AAS64692.1| Multidrug-Resistance like protein 1, isoform H [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552363|ref|NP_995704.1| Multidrug-Resistance like protein 1, isoform M [Drosophila melanogaster] gi|45445117|gb|AAS64699.1| Multidrug-Resistance like protein 1, isoform M [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158298785|ref|XP_553715.3| AGAP009835-PA [Anopheles gambiae str. PEST] gi|157014052|gb|EAL39215.3| AGAP009835-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195351121|ref|XP_002042085.1| GM10053 [Drosophila sechellia] gi|194123909|gb|EDW45952.1| GM10053 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
ZFIN|ZDB-GENE-040426-1523 1567 abcc2 "ATP-binding cassette, s 0.496 0.190 0.427 1.1e-62
FB|FBgn00324561549 MRP "Multidrug-Resistance like 0.210 0.081 0.662 2.4e-90
UNIPROTKB|F1PHV01544 ABCC2 "Uncharacterized protein 0.267 0.104 0.541 5.6e-88
MGI|MGI:13524471543 Abcc2 "ATP-binding cassette, s 0.227 0.088 0.611 8.1e-88
UNIPROTKB|Q28689 1564 ABCC2 "Canalicular multispecif 0.490 0.188 0.390 3.5e-50
RGD|23661541 Abcc2 "ATP-binding cassette, s 0.210 0.082 0.602 1.1e-83
UNIPROTKB|F1NM511534 ABCC3 "Uncharacterized protein 0.212 0.083 0.601 1.2e-82
MGI|MGI:102676 1528 Abcc1 "ATP-binding cassette, s 0.196 0.077 0.661 2.1e-65
RGD|3112 1532 Abcc1 "ATP-binding cassette, s 0.196 0.077 0.652 5.5e-66
UNIPROTKB|F1M7Y0 1533 Abcc1 "Multidrug resistance-as 0.196 0.076 0.652 5.6e-66
ZFIN|ZDB-GENE-040426-1523 abcc2 "ATP-binding cassette, sub-family C (CFTR/MRP), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 1.1e-62, Sum P(2) = 1.1e-62
 Identities = 144/337 (42%), Positives = 193/337 (57%)

Query:   292 LYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSPIYSHFGETVTGN 351
             L+     + IFT  V P+ +  +   +QRFYVATSRQL+RL+SVSRSPIYSHFGETV+G 
Sbjct:  1131 LFVICLATPIFTAVVVPMAVVYYF--VQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGL 1188

Query:   352 VGQRQLICLARAL----------LRKTKILILDEATAAIDLET-DDLIQ------STIRS 394
                R      R L          L+     I+     A+ LE+  +L+       + I  
Sbjct:  1189 SVIRAYGHQDRFLKHNEDTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISR 1248

Query:   395 EFAHCTV--LTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGLA 452
             +  +  +  L+I++ LN +  +   LV    +  E ++ +++   +   +  +  +A   
Sbjct:  1249 DSLNSGLVGLSISYALN-VTQTLNWLVR---MTSELET-NIVAVERVREYAEIQNEA--P 1301

Query:   453 WL-AVR----LETVGNLITFSAALLAVLSKETLNAGLVGLS--VSYAMQVGIVGRTGAGK 505
             W+ +VR      + GN I F      V  +  L   L G++  +    ++GIVGRTGAGK
Sbjct:  1302 WVTSVRPPDDWPSAGN-IRFED--YKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGK 1358

Query:   506 SSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQDPVLFSGTLRLNLDPVGE 565
             SSLT  LFRI+E ADG I+ID +DI TLGLH LRSRLTIIPQDPVLFSGTLR+NLDP   
Sbjct:  1359 SSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQT 1418

Query:   566 SSDEAIWKALELAHLNTFVSNLPARLQHEVSEGGENL 602
              SD  IW  LELAHL  +V  LP  L+HEVSEGGENL
Sbjct:  1419 FSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENL 1455


GO:0016887 "ATPase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0032456 MRP "Multidrug-Resistance like Protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHV0 ABCC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1352447 Abcc2 "ATP-binding cassette, sub-family C (CFTR/MRP), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q28689 ABCC2 "Canalicular multispecific organic anion transporter 1" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
RGD|2366 Abcc2 "ATP-binding cassette, subfamily C (CFTR/MRP), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM51 ABCC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:102676 Abcc1 "ATP-binding cassette, sub-family C (CFTR/MRP), member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3112 Abcc1 "ATP-binding cassette, subfamily C (CFTR/MRP), member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M7Y0 Abcc1 "Multidrug resistance-associated protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 1e-113
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-84
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 1e-73
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 4e-70
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 5e-67
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 7e-57
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 7e-48
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 1e-47
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 8e-46
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 6e-42
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 1e-40
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 9e-39
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 2e-38
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-38
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 9e-33
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 4e-32
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 6e-29
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-28
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 4e-28
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-27
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 3e-27
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 5e-27
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 2e-26
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 5e-26
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 2e-25
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-24
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 9e-24
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 1e-23
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 1e-23
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-23
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 3e-23
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 8e-23
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 3e-22
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 3e-22
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 4e-22
cd03289 275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 5e-22
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-21
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 2e-21
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-20
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 3e-20
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 4e-20
COG4988559 COG4988, CydD, ABC-type transport system involved 8e-20
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-19
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-19
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-19
COG5265497 COG5265, ATM1, ABC-type transport system involved 9e-19
COG4988 559 COG4988, CydD, ABC-type transport system involved 1e-18
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 1e-18
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 2e-18
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-17
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 1e-17
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-17
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-17
PRK11174 588 PRK11174, PRK11174, cysteine/glutathione ABC trans 4e-17
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 7e-17
COG4987573 COG4987, CydC, ABC-type transport system involved 8e-17
COG1123539 COG1123, COG1123, ATPase components of various ABC 1e-16
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-16
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 2e-16
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-16
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-16
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 2e-16
TIGR02203 571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 5e-16
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 6e-16
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 7e-16
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 2e-15
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-15
COG5265497 COG5265, ATM1, ABC-type transport system involved 7e-15
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 8e-15
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 8e-15
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 1e-14
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 1e-14
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-14
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-14
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 4e-14
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 8e-14
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 2e-13
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 2e-13
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 4e-13
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 6e-13
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 9e-13
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 2e-12
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 3e-12
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 3e-12
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 4e-12
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 4e-12
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 5e-12
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-12
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 7e-12
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 8e-12
COG4987573 COG4987, CydC, ABC-type transport system involved 1e-11
PRK14250 241 PRK14250, PRK14250, phosphate ABC transporter ATP- 1e-11
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-11
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-11
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 2e-11
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-11
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-11
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 3e-11
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 4e-11
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 4e-11
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 6e-11
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 6e-11
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 6e-11
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 7e-11
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 8e-11
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 1e-10
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-10
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 1e-10
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 1e-10
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-10
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-10
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-10
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-10
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-10
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 3e-10
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 4e-10
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 4e-10
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 5e-10
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 5e-10
COG4618 580 COG4618, ArpD, ABC-type protease/lipase transport 5e-10
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 5e-10
COG4988559 COG4988, CydD, ABC-type transport system involved 6e-10
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 6e-10
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 7e-10
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 7e-10
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 7e-10
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 8e-10
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 8e-10
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 8e-10
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 8e-10
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 8e-10
PRK11176 582 PRK11176, PRK11176, lipid transporter ATP-binding/ 1e-09
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-09
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 1e-09
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 1e-09
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 1e-09
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-09
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-09
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 2e-09
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-09
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-09
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 2e-09
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-09
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-09
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-09
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-09
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 3e-09
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 4e-09
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 4e-09
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 5e-09
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 6e-09
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 7e-09
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 7e-09
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 8e-09
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-08
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 1e-08
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-08
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-08
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-08
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 2e-08
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-08
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-08
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-08
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-08
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 3e-08
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 3e-08
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 3e-08
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 3e-08
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 4e-08
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 4e-08
pfam00005119 pfam00005, ABC_tran, ABC transporter 4e-08
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-08
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 5e-08
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 5e-08
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 5e-08
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 6e-08
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 6e-08
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 8e-08
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-07
cd03256 241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-07
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 1e-07
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 1e-07
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-07
COG1137 243 COG1137, YhbG, ABC-type (unclassified) transport s 1e-07
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 1e-07
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-07
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-07
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 2e-07
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-07
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-07
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 2e-07
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-07
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 3e-07
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 4e-07
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 4e-07
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 4e-07
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 4e-07
COG1123 539 COG1123, COG1123, ATPase components of various ABC 5e-07
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 5e-07
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 5e-07
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 5e-07
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 5e-07
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 6e-07
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 6e-07
COG5265497 COG5265, ATM1, ABC-type transport system involved 7e-07
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 8e-07
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 8e-07
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 9e-07
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 9e-07
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 1e-06
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 1e-06
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 1e-06
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-06
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-06
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 1e-06
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 1e-06
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 1e-06
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-06
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-06
COG1123 539 COG1123, COG1123, ATPase components of various ABC 2e-06
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-06
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-06
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-06
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 2e-06
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 2e-06
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-06
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-06
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-06
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-06
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-06
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 3e-06
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 3e-06
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-06
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-06
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 3e-06
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 3e-06
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 3e-06
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-06
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 3e-06
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 4e-06
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 4e-06
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 4e-06
PRK13637 287 PRK13637, cbiO, cobalt transporter ATP-binding sub 4e-06
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-06
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 4e-06
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 4e-06
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 4e-06
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 4e-06
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 5e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 5e-06
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 6e-06
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 6e-06
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 6e-06
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 7e-06
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 7e-06
COG1124 252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 7e-06
PRK13632 271 PRK13632, cbiO, cobalt transporter ATP-binding sub 7e-06
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 7e-06
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 7e-06
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 7e-06
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 8e-06
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 8e-06
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 8e-06
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 8e-06
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 9e-06
COG1117253 COG1117, PstB, ABC-type phosphate transport system 9e-06
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-05
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 1e-05
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 1e-05
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 1e-05
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 1e-05
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-05
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-05
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 2e-05
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-05
TIGR02315 243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 2e-05
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-05
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-05
PRK15112 267 PRK15112, PRK15112, antimicrobial peptide ABC syst 2e-05
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-05
COG1125 309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-05
COG1127 263 COG1127, Ttg2A, ABC-type transport system involved 2e-05
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 2e-05
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 2e-05
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-05
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 2e-05
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 2e-05
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-05
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-05
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 3e-05
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-05
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 3e-05
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-05
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 3e-05
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 3e-05
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 3e-05
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 3e-05
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 3e-05
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 3e-05
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-05
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-05
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 3e-05
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 4e-05
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 4e-05
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 4e-05
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 5e-05
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 5e-05
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 5e-05
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 5e-05
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 6e-05
COG4608 268 COG4608, AppF, ABC-type oligopeptide transport sys 6e-05
cd03299 235 cd03299, ABC_ModC_like, ATP-binding cassette domai 7e-05
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 7e-05
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 8e-05
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 9e-05
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 1e-04
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-04
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-04
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-04
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-04
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 1e-04
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 1e-04
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 1e-04
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-04
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-04
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-04
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 2e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-04
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 2e-04
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-04
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 2e-04
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 2e-04
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 2e-04
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 2e-04
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 2e-04
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-04
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-04
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-04
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 2e-04
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 3e-04
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 3e-04
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 3e-04
PRK10895 241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 3e-04
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 3e-04
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 3e-04
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 3e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 3e-04
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 3e-04
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 3e-04
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 3e-04
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 3e-04
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 3e-04
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 4e-04
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-04
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 4e-04
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 4e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 4e-04
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 4e-04
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 4e-04
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 5e-04
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 5e-04
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 5e-04
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 5e-04
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 5e-04
PRK13636 283 PRK13636, cbiO, cobalt transporter ATP-binding sub 5e-04
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 5e-04
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 5e-04
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 6e-04
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 6e-04
cd03294 269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 6e-04
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 6e-04
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 6e-04
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 6e-04
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 6e-04
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 6e-04
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 7e-04
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 7e-04
PRK11308 327 PRK11308, dppF, dipeptide transporter ATP-binding 7e-04
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 7e-04
COG4148352 COG4148, ModC, ABC-type molybdate transport system 7e-04
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 8e-04
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 8e-04
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 8e-04
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 9e-04
PRK11231 255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 9e-04
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 9e-04
COG4987573 COG4987, CydC, ABC-type transport system involved 0.001
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 0.001
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 0.001
PRK13644 274 PRK13644, cbiO, cobalt transporter ATP-binding sub 0.001
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 0.001
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 0.001
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 0.001
PRK13639 275 PRK13639, cbiO, cobalt transporter ATP-binding sub 0.001
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 0.001
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 0.001
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 0.001
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 0.001
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 0.001
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 0.001
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 0.001
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 0.001
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 0.001
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 0.001
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 0.002
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 0.002
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 0.002
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 0.002
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 0.002
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 0.002
TIGR02314 343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 0.002
COG4167 267 COG4167, SapF, ABC-type antimicrobial peptide tran 0.002
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 0.002
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 0.002
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 0.002
PRK15079 331 PRK15079, PRK15079, oligopeptide ABC transporter A 0.002
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 0.002
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 0.002
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 0.002
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 0.003
TIGR02769 265 TIGR02769, nickel_nikE, nickel import ATP-binding 0.003
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 0.003
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 0.003
PRK13647 274 PRK13647, cbiO, cobalt transporter ATP-binding sub 0.003
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.003
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 0.003
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 0.003
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 0.004
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 0.004
PRK13633 280 PRK13633, PRK13633, cobalt transporter ATP-binding 0.004
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 0.004
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 0.004
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 0.004
PRK13638 271 PRK13638, cbiO, cobalt transporter ATP-binding sub 0.004
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 0.004
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 0.004
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 0.004
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 0.004
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 0.004
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
 Score =  369 bits (949), Expect = e-113
 Identities = 221/530 (41%), Positives = 302/530 (56%), Gaps = 116/530 (21%)

Query: 2    LANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWIN 61
            ++ G I+AS+ LH  +L N L S MSFF+ TP G +++RFS++++TVDS +P  ++ ++ 
Sbjct: 1029 VSIGGIQASRVLHQDLLHNKLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPPVIKMFMG 1088

Query: 62   CLFSVLYLMPVTI--TVFFYGFVISLGTLF-------AAKRLHEKLLKSMLRWSPLF--F 110
             LF+V+  + V +  T      +  LG L+        A     K L+S+ R SP++  F
Sbjct: 1089 SLFNVIGALIVILLATPIAAVIIPPLGLLYFFVQRFYVASSRQLKRLESVSR-SPVYSHF 1147

Query: 111  DTTPVGRVLSR---------FSSDVNTLDN------------------------------ 131
            + T +G  + R           SD+   +N                              
Sbjct: 1148 NETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAA 1207

Query: 132  ------KLTLS---VQQTLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAE 182
                  + +LS   V  ++S   ++T  LNWLVRM+S++ETNIVAVER+KEY ET +EA 
Sbjct: 1208 LFAVISRHSLSAGLVGLSVSYSLQVTFYLNWLVRMSSEMETNIVAVERLKEYSETEKEAP 1267

Query: 183  W-VNDKKPKDEWPEKGEVEFKDYKVRYREGLELV--------------GIVGRTGAGKSS 227
            W + +  P   WP +G VEF++Y +RYRE L+LV              GIVGRTGAGKSS
Sbjct: 1268 WQIQETAPPSGWPPRGRVEFRNYCLRYREDLDLVLRHINVTIHGGEKVGIVGRTGAGKSS 1327

Query: 228  LTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIV 287
            LTL LFRI E A+G IIIDG++I  +GLH LR ++TIIPQ            PV      
Sbjct: 1328 LTLGLFRINESAEGEIIIDGLNIAKIGLHDLRFKITIIPQ-----------DPV------ 1370

Query: 288  PVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLES-VSRSPIYSHF-- 344
                         +F+  ++ + + PF S      V  + +L  L++ VS  P       
Sbjct: 1371 -------------LFSGSLR-MNLDPF-SQYSDEEVWWALELAHLKTFVSALPDKLDHEC 1415

Query: 345  ---GETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTV 401
               GE ++  VGQRQL+CLARALLRKTKIL+LDEATAA+DLETD+LIQSTIR++F  CTV
Sbjct: 1416 AEGGENLS--VGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTV 1473

Query: 402  LTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAGL 451
            LTIAHRLNTI+D  RV+VLDKG V EF +PS L++ +  IFYSMAKDAGL
Sbjct: 1474 LTIAHRLNTIMDYTRVIVLDKGEVAEFGAPSNLLQQRG-IFYSMAKDAGL 1522


This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved [Transport and binding proteins, Other]. Length = 1522

>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 602
KOG0055|consensus 1228 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
KOG0054|consensus 1381 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
KOG0058|consensus716 100.0
KOG0054|consensus1381 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
KOG0055|consensus1228 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PTZ002431560 ABC transporter; Provisional 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
KOG0056|consensus790 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
KOG0057|consensus591 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
COG3845 501 ABC-type uncharacterized transport systems, ATPase 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
PRK11147 635 ABC transporter ATPase component; Reviewed 100.0
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
PRK13409 590 putative ATPase RIL; Provisional 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
KOG0927|consensus614 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4167267 SapF ABC-type antimicrobial peptide transport syst 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.98
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.98
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.98
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.98
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.98
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.98
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.98
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.98
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.98
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.98
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.97
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.97
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.97
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.97
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.97
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.97
KOG0058|consensus 716 99.97
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.97
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.97
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.97
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.97
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.97
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.97
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.97
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.97
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.97
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.97
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.97
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.97
COG4152300 ABC-type uncharacterized transport system, ATPase 99.97
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.97
PLN03211 659 ABC transporter G-25; Provisional 99.97
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.97
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.97
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.97
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.97
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.97
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.96
PRK10938490 putative molybdenum transport ATP-binding protein 99.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.96
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.96
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.96
COG4586325 ABC-type uncharacterized transport system, ATPase 99.96
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.96
KOG0062|consensus582 99.96
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.96
PLN03073718 ABC transporter F family; Provisional 99.96
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.96
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.96
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.96
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.95
PRK13409590 putative ATPase RIL; Provisional 99.95
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.95
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.95
PRK11147635 ABC transporter ATPase component; Reviewed 99.95
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.95
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.95
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.95
COG4136213 ABC-type uncharacterized transport system, ATPase 99.94
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.94
PLN03140 1470 ABC transporter G family member; Provisional 99.94
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 99.94
KOG0057|consensus 591 99.94
COG4178604 ABC-type uncharacterized transport system, permeas 99.94
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 99.94
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.93
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.93
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.93
COG0488530 Uup ATPase components of ABC transporters with dup 99.93
COG4988 559 CydD ABC-type transport system involved in cytochr 99.93
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 99.93
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.92
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.92
COG4987573 CydC ABC-type transport system involved in cytochr 99.92
KOG0066|consensus807 99.92
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.92
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 99.92
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.92
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.92
COG4133209 CcmA ABC-type transport system involved in cytochr 99.92
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 99.92
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.92
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.92
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.92
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.92
KOG0056|consensus 790 99.91
KOG0061|consensus 613 99.91
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.91
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.91
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.9
KOG0059|consensus885 99.9
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.9
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.9
KOG0060|consensus659 99.9
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.89
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 99.89
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.89
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.89
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.88
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.88
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.88
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.88
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 99.88
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.87
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.87
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.87
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.87
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.87
KOG0927|consensus614 99.85
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.85
KOG0062|consensus582 99.85
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.84
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.84
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.83
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.83
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.83
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.83
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.82
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.82
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.82
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.82
KOG0064|consensus728 99.82
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.82
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.81
KOG0065|consensus 1391 99.81
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.81
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.8
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.8
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.8
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.79
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.79
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.79
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.79
COG4619223 ABC-type uncharacterized transport system, ATPase 99.79
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.79
KOG0065|consensus 1391 99.78
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.78
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.78
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.78
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.78
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.78
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.78
KOG0066|consensus807 99.78
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.78
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.78
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.77
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.77
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.77
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.77
COG1127 263 Ttg2A ABC-type transport system involved in resist 99.77
COG0410237 LivF ABC-type branched-chain amino acid transport 99.76
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.76
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.76
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.76
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
COG0411250 LivG ABC-type branched-chain amino acid transport 99.76
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.75
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.75
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.75
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.75
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.75
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.75
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.75
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.75
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.75
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.75
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.75
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.74
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.74
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.74
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.74
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.74
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.74
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.74
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.74
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.73
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.73
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.73
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.73
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.73
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.73
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.73
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.73
KOG2355|consensus291 99.73
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.73
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.73
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.73
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.73
>KOG0055|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-75  Score=652.90  Aligned_cols=406  Identities=25%  Similarity=0.343  Sum_probs=272.7

Q ss_pred             cchhhHHHHHHHHHHHHHHHcCcccccccccccchhhhhhhhHHHHhhhHHHHHHHHHHHHHHHHHHHH---HHHHH--H
Q psy3001           3 ANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMP---VTITV--F   77 (602)
Q Consensus         3 ~~~~~~~~~~l~~~~~~~l~~~~~~~f~~~~~G~i~sr~~~d~~~i~~~~~~~~~~~~~~~~~~~~~~~---~~~~~--~   77 (602)
                      -..+.|...++|.++++.+++++++|||++..|++.+|+++|++.|++.+..-+..++..+...+..++   +..|.  +
T Consensus        96 ~~~geRq~~riR~~yl~~iLrQdi~~fD~~~~g~~~~~l~~d~~~I~d~~geKvg~~i~~~~~fi~g~ii~F~~~W~Ltl  175 (1228)
T KOG0055|consen   96 MRTGERQTARIRSKYLKAILRQDIGWFDTNSTGELVTRLSDDIELIQDAIGEKVGNFIQLLATFIAGFVIGFYYGWKLTL  175 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCccceeecccccceEEEecCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            356889999999999999999999999999999999999999999999988777777666554433222   11121  1


Q ss_pred             HHHHHHHHHHHH---HH---HHHHHHHHHHhhcccchhhhhcchh-----------HHHHHHHHHHhhhh-----hHHH-
Q psy3001          78 FYGFVISLGTLF---AA---KRLHEKLLKSMLRWSPLFFDTTPVG-----------RVLSRFSSDVNTLD-----NKLT-  134 (602)
Q Consensus        78 ~~~~~~~~~~~~---~~---~~~~~~~~~~~~~~~~~~~~~~~~g-----------~~~~r~~~~~~~~~-----~~~~-  134 (602)
                      +.....|+.++.   ..   .+...+..++..+ .....++...+           +..+||.+......     ..+. 
T Consensus       176 v~l~~~Pli~~~g~~~a~~~~~~t~ke~~~ya~-Ag~iaEe~i~~iRTV~af~gq~~e~~ry~~~L~~~~k~gi~~g~~~  254 (1228)
T KOG0055|consen  176 VMLSFIPLIAIAGGLLARFLSKLTEKEQEAYAK-AGSIAEEVISSIRTVYAFNGEKKEIERYSKALENALKFGIKKGLFK  254 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHhhhhhhhhhcCcHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            111222222221   11   1222233333333 22233444333           23355544222110     0110 


Q ss_pred             -HHHH-----------HHHHHHHH---------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccc
Q psy3001         135 -LSVQ-----------QTLSQPFK---------------------ITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEA  181 (602)
Q Consensus       135 -~~~~-----------~~~~~~~~---------------------~~~~l~~~~~~~~~~~~~~~~~~ri~~~~~~~~~~  181 (602)
                       +..|           ..++|-..                     -...+....-....+..+..+..+|.+..+..+..
T Consensus       255 G~~~G~~~~~~~~~~a~~~WyG~~li~~~~~~~g~v~~v~~~vl~g~~sLgqa~p~l~~f~~a~~aa~~I~~~i~~~~~i  334 (1228)
T KOG0055|consen  255 GLGLGFTFFLLFASYALAFWYGSTLILNGGYNGGDVITVFFSVLIGGMSLGQASPHLSAFAKARAAAYRIFETIDRKPSI  334 (1228)
T ss_pred             HHHhHHHHHHHHHHHHHHHHHHHHHHhcCCCCCceEEEEEeehhhhhhhhhccccchHHHhccccchHHHHHHhcCCCCC
Confidence             1111           11111100                     00011112233455667778899999988765543


Q ss_pred             ccccCCCCCCCCCCCCcEEEeeeEEEEecC---------------CceEEEEeccCCChhHHHHHHhcccCCCCceEEEC
Q psy3001         182 EWVNDKKPKDEWPEKGEVEFKDYKVRYREG---------------LELVGIVGRTGAGKSSLTLALFRIIEPADGTIIID  246 (602)
Q Consensus       182 ~~~~~~~~~~~~~~~~~i~~~~vs~~~~~~---------------~e~~~lvG~sGsGKSTL~~ll~g~~~~~~G~I~i~  246 (602)
                      +... .........++.++|+||.|+|+..               ++.+||||+|||||||++++|.|+|+|++|+|.+|
T Consensus       335 ~~~~-~~~~~~~~~~g~ief~nV~FsYPsRpdv~Il~g~sl~i~~G~~valVG~SGsGKST~i~LL~RfydP~~G~V~id  413 (1228)
T KOG0055|consen  335 DPYS-KGGRVLSSIKGEIEFRNVCFSYPSRPDVKILKGVSLKIPSGQTVALVGPSGSGKSTLIQLLARFYDPTSGEVLID  413 (1228)
T ss_pred             Cccc-ccCCcccccccceEEEEEEecCCCCCcchhhCCeEEEeCCCCEEEEECCCCCCHHHHHHHHHHhcCCCCceEEEc
Confidence            3211 1111122246789999999999642               27799999999999999999999999999999999


Q ss_pred             CeecCCCChHHHhhccceecccchhhhhhccCCceeEeeecccceeeeccccceeecccccccccccccchhHHHHHHHH
Q psy3001         247 GVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFCSNLQRFYVATS  326 (602)
Q Consensus       247 g~~~~~~~~~~~~~~i~~v~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  326 (602)
                      |.|+++++...+|++||+|.|+           |++|..++..++.+.-...+   .+++.   .....++..+++...+
T Consensus       414 G~di~~~~~~~lr~~iglV~Qe-----------PvlF~~tI~eNI~~G~~dat---~~~i~---~a~k~ana~~fi~~lp  476 (1228)
T KOG0055|consen  414 GEDIRNLNLKWLRSQIGLVSQE-----------PVLFATTIRENIRYGKPDAT---REEIE---EAAKAANAHDFILKLP  476 (1228)
T ss_pred             CccchhcchHHHHhhcCeeeec-----------hhhhcccHHHHHhcCCCccc---HHHHH---HHHHHccHHHHHHhhH
Confidence            9999999999999999999998           55552222111111100000   01110   0112334445555555


Q ss_pred             HHHHHHhhcccCCcccccCCcCCCChhhHHHHHHHHHHhhCCCeEEEecccccCChhHHHHHHHHHHHhccccEEEEeee
Q psy3001         327 RQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAH  406 (602)
Q Consensus       327 ~~~~~l~~~~~~~~~~~~~~~lsgs~Gq~Qrl~lAral~~~p~iliLDEpts~LD~~~~~~i~~~l~~~~~~~tvi~itH  406 (602)
                      .++++        .+++.|..||  |||||||||||||+++|+||+||||||+||+++++.++++|++..+|+|.|+|+|
T Consensus       477 ~g~~T--------~vge~g~qLS--GGQKQRIAIARalv~~P~ILLLDEaTSaLD~~se~~Vq~ALd~~~~grTTivVaH  546 (1228)
T KOG0055|consen  477 DGYDT--------LVGERGVQLS--GGQKQRIAIARALVRNPKILLLDEATSALDAESERVVQEALDKASKGRTTIVVAH  546 (1228)
T ss_pred             Hhhcc--------cccCCCCCCC--hHHHHHHHHHHHHHhCCCEEEecCcccccCHHHHHHHHHHHHHhhcCCeEEEEee
Confidence            55544        4778888888  5999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCeEEEEeCceEEeecChhHHhhc
Q psy3001         407 RLNTIIDSDRVLVLDKGLVVEFDSPSVLMKN  437 (602)
Q Consensus       407 ~l~~i~~~d~i~~l~~G~i~~~g~~~~l~~~  437 (602)
                      |++++++||+|++|++|+|+|.|+|+|++..
T Consensus       547 RLStIrnaD~I~v~~~G~IvE~G~h~ELi~~  577 (1228)
T KOG0055|consen  547 RLSTIRNADKIAVMEEGKIVEQGTHDELIAL  577 (1228)
T ss_pred             ehhhhhccCEEEEEECCEEEEecCHHHHHhc
Confidence            9999999999999999999999999999854



>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0064|consensus Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG2355|consensus Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 6e-23
4ayt_A 595 Structure Of The Human Mitochondrial Abc Transporte 3e-12
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 2e-22
4ayw_A 619 Structure Of The Human Mitochondrial Abc Transporte 3e-12
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 3e-22
3b5x_A 582 Crystal Structure Of Msba From Vibrio Cholerae Leng 2e-11
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 2e-21
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 4e-17
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-20
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-12
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 2e-20
1mt0_A 241 Atp-Binding Domain Of Haemolysin B From Escherichia 8e-09
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-20
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-12
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 2e-20
2ff7_A 247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 8e-09
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 2e-20
2pmk_A 243 Crystal Structures Of An Isolated Abc-Atpase In Com 9e-09
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 3e-20
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 8e-11
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-20
3b5j_A 243 Crystal Structures Of The S504a Mutant Of An Isolat 1e-08
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 4e-20
3qf4_B 598 Crystal Structure Of A Heterodimeric Abc Transporte 7e-14
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 6e-20
2ffb_A 247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 8e-09
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 4e-19
1xef_A 241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 7e-09
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 4e-19
2ffa_A 247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 7e-09
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 2e-18
3b5y_A 582 Crystal Structure Of Msba From Salmonella Typhimuri 3e-08
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 2e-18
3b5w_A 582 Crystal Structure Of Eschericia Coli Msba Length = 4e-08
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 1e-17
1mv5_A 243 Crystal Structure Of Lmra Atp-Binding Domain Length 3e-14
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 6e-17
3nh6_A 306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 4e-09
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 2e-16
2ghi_A 260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 5e-10
3qf4_A 587 Crystal Structure Of A Heterodimeric Abc Transporte 5e-16
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 4e-15
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 2e-11
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 5e-11
2ixf_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-05
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-10
2ixg_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-05
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 9e-10
2ixe_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-05
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 3e-09
1jj7_A 260 Crystal Structure Of The C-Terminal Atpase Domain O 9e-05
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 4e-09
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-09
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 2e-08
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 1e-07
3tui_C366 Inward Facing Conformations Of The Metni Methionine 4e-07
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 5e-07
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 1e-06
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 3e-06
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 3e-06
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 4e-06
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 5e-06
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 6e-06
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 1e-05
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 2e-05
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 3e-05
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 3e-05
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 5e-05
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 6e-05
1g29_1372 Malk Length = 372 7e-05
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 7e-05
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 9e-05
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 1e-04
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 3e-04
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 3e-04
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure

Iteration: 1

Score = 105 bits (262), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 82/252 (32%), Positives = 127/252 (50%), Gaps = 28/252 (11%) Query: 193 WPEKGEVE-FKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIR 251 +P + EV F+D+ + G + +VG +G+GKS++ L R+ +PA GTI +DG DIR Sbjct: 351 YPARPEVPIFQDFSLSIPSG-SVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIR 409 Query: 252 TLGLHTLRSRLTIIPQVLATIFVICYXXXXXXXXXXXXXXLYFFIQVSLIFTEDVKPLII 311 L LRS++ + Q I C I ++ + D P + Sbjct: 410 QLNPVWLRSKIGTVSQ--EPILFSCS------------------IAENIAYGAD-DPSSV 448 Query: 312 TPFCSNLQRFY-VATSRQLKRLESVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKI 370 T +QR VA + R + + G ++G GQ+Q I +ARALL+ KI Sbjct: 449 T--AEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSG--GQKQRIAIARALLKNPKI 504 Query: 371 LILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVEFDS 430 L+LDEAT+A+D E + L+Q + TVL IAHRL+TI +++ V VLD+G + E+ Sbjct: 505 LLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGK 564 Query: 431 PSVLMKNKASIF 442 L+ I+ Sbjct: 565 HEELLSKPNGIY 576
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 1e-101
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 4e-59
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 4e-27
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 3e-21
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 5e-15
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 2e-26
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 1e-23
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 7e-15
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 6e-26
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-24
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-11
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 6e-25
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 7e-25
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 7e-23
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 4e-19
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-10
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-09
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-04
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 2e-24
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 5e-24
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 7e-15
2ghi_A260 Transport protein; multidrug resistance protein, M 3e-24
2ghi_A 260 Transport protein; multidrug resistance protein, M 9e-23
2ghi_A260 Transport protein; multidrug resistance protein, M 7e-12
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 6e-24
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 3e-22
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-17
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 6e-05
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 8e-24
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 4e-21
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 5e-11
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 9e-06
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-23
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 5e-23
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 6e-14
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-05
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 2e-23
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-23
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 5e-14
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-05
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 6e-04
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-23
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 3e-20
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 8e-11
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-21
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 8e-20
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-14
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 3e-05
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 6e-21
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 3e-14
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 3e-04
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 2e-19
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-15
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 6e-19
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-08
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 7e-05
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-04
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 7e-19
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-08
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-04
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-04
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-16
1sgw_A214 Putative ABC transporter; structural genomics, P p 8e-13
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-05
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 6e-11
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 4e-10
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 3e-08
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 3e-07
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 1e-08
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-08
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 2e-06
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-05
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-08
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 8e-08
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 5e-06
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 4e-08
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 7e-06
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 1e-05
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-07
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 2e-07
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-06
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-07
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 6e-07
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 8e-07
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-07
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 4e-07
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 9e-07
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-06
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-06
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-04
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 1e-05
1g6h_A257 High-affinity branched-chain amino acid transport 3e-05
1ji0_A240 ABC transporter; ATP binding protein, structural g 3e-05
1ji0_A240 ABC transporter; ATP binding protein, structural g 3e-04
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 2e-04
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 2e-04
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
 Score =  312 bits (801), Expect = e-101
 Identities = 76/285 (26%), Positives = 125/285 (43%), Gaps = 53/285 (18%)

Query: 185 NDKKPKDEWPEKGEVEFKDYKVRYREGLELV--------------GIVGRTGAGKSSLTL 230
           +  K  D WP  G++  KD   +Y EG   +              G++GRTG+GKS+L  
Sbjct: 6   SHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLS 65

Query: 231 ALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVS 290
           A  R++   +G I IDGV   ++ L   R                          ++P  
Sbjct: 66  AFLRLLNT-EGEIQIDGVSWDSITLEQWRKAFG----------------------VIP-- 100

Query: 291 VLYFFIQVSLIFTEDVKPLIITPF--CSNLQRFYVATSRQLKRLESVSRSPIYSHFGETV 348
                 Q   IF+   +   + P    S+ + + VA    L+    + + P    F    
Sbjct: 101 ------QKVFIFSGTFR-KNLDPNAAHSDQEIWKVADEVGLR--SVIEQFPGKLDFVLVD 151

Query: 349 TGN---VGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIA 405
            G     G +QL+CLAR++L K KIL+LDE +A +D  T  +I+ T++  FA CTV+   
Sbjct: 152 GGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCE 211

Query: 406 HRLNTIIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAKDAG 450
            R+  +++ D+ LV+++  V ++DS   L    A  F +    + 
Sbjct: 212 ARIEAMLECDQFLVIEENKVRQYDSILELYHYPADRFVAGFIGSP 256


>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 100.0
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.96
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.96
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.96
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.96
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.96
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.96
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.95
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.95
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.94
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.94
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.93
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.93
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 99.93
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.92
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.92
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.91
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.91
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.9
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.9
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 99.89
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 99.89
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.89
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 99.89
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.89
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 99.89
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.89
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 99.89
1e69_A322 Chromosome segregation SMC protein; structural mai 99.87
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.87
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.87
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.86
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.86
2ghi_A 260 Transport protein; multidrug resistance protein, M 99.86
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.85
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.85
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.81
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.81
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 99.81
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.81
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.81
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.81
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.8
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.8
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.79
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.79
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.79
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.79
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.79
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.79
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 99.78
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.78
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 99.78
1g6h_A257 High-affinity branched-chain amino acid transport 99.78
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.78
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 99.78
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 99.77
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.77
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.77
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.77
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.77
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.77
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.77
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.76
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 99.76
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.75
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.73
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.73
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 99.73
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.72
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.72
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.71
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.71
2og2_A359 Putative signal recognition particle receptor; nuc 99.7
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.69
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.69
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 99.69
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.68
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.68
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.67
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.66
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.64
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.63
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.61
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.61
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.58
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.57
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.54
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.52
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.52
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.51
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.51
3kta_B173 Chromosome segregation protein SMC; structural mai 99.5
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.48
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.46
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.45
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.45
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.42
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.42
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.4
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.4
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.38
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.36
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.36
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.36
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.35
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.35
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.35
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.35
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.34
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.34
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.34
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.33
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.31
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.31
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.3
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.28
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.28
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.24
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.24
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.22
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.21
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.21
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.19
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.19
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.19
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.18
2ewv_A 372 Twitching motility protein PILT; pilus retraction 99.16
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.16
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.15
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.15
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.14
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 99.13
2og2_A359 Putative signal recognition particle receptor; nuc 99.12
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.11
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.11
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.1
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.09
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.08
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.07
2eyu_A 261 Twitching motility protein PILT; pilus retraction 99.07
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.05
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.04
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.03
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.03
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.02
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.01
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.99
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.98
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.98
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.98
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.98
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 98.97
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.97
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.95
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.95
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.92
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.92
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 98.92
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.9
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.89
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.89
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.88
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.87
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.86
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.86
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.85
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.85
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.84
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.84
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.82
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.81
1p9r_A418 General secretion pathway protein E; bacterial typ 98.81
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.79
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.79
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 98.78
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.77
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.76
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 98.74
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.69
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.69
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.67
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.67
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.67
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 98.66
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.65
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.64
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.64
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 98.63
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 98.62
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.62
1p9r_A 418 General secretion pathway protein E; bacterial typ 98.61
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.6
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.59
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.58
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.57
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.54
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.54
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.53
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.52
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 98.5
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.5
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.48
1e69_A 322 Chromosome segregation SMC protein; structural mai 98.48
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.47
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.47
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.45
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.44
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.44
3kta_A182 Chromosome segregation protein SMC; structural mai 98.44
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.42
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.39
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.38
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.37
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.37
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.33
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.32
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.29
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.29
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 98.28
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.27
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.26
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.25
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.24
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.24
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.24
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.23
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.22
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.22
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.21
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.21
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.2
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.2
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.19
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.16
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.14
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.09
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.08
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.08
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.08
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.07
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 98.06
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.05
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.05
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.03
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.02
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.01
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.01
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.0
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.0
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.0
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.99
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.98
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.97
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.97
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.96
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.96
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 97.96
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.94
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.86
3kta_A182 Chromosome segregation protein SMC; structural mai 97.84
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.83
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.81
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.81
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.79
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.79
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.78
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.77
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.76
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.76
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.75
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.73
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.73
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.72
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.72
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.71
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.65
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.63
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.63
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.63
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.62
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.61
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.61
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.61
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.6
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.59
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 97.54
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.52
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.52
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.5
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.48
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.48
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.45
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.44
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 97.42
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.41
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.4
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.39
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.38
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 97.37
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.37
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.36
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.34
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 97.33
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.33
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.32
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.3
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 97.3
2z43_A324 DNA repair and recombination protein RADA; archaea 97.3
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.27
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.26
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.25
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.22
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.21
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.21
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.18
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.16
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.14
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.14
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.13
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.12
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.11
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.11
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.1
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.09
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.09
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.06
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.04
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.0
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.99
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.99
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.99
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.99
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.98
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.94
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.94
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.93
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.93
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.93
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.91
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.88
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.84
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.84
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.84
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.82
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 96.79
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.79
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.79
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.79
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.77
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.77
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.77
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.75
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.73
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.72
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.69
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 96.67
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.65
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.65
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.63
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.62
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.58
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.57
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.55
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.54
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.53
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.51
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.49
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.44
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.44
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.43
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.43
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.43
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 96.41
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.4
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.38
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.38
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.35
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.35
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.34
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.3
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.3
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.28
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 96.28
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.26
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.22
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.18
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.15
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.15
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.13
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.13
3ice_A 422 Transcription termination factor RHO; transcriptio 96.12
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.08
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 96.07
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.06
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.03
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.01
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.01
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.0
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.99
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.98
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.96
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.95
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.95
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.94
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 95.9
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.9
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.89
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.87
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.86
1via_A175 Shikimate kinase; structural genomics, transferase 95.81
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.8
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.8
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.78
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 95.76
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.74
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.74
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.74
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.72
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.72
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 95.66
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 95.66
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.65
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 95.64
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.62
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.61
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.6
1via_A175 Shikimate kinase; structural genomics, transferase 95.53
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.53
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.53
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.52
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.48
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.48
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 95.47
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.47
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.46
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.46
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.45
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.45
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.45
1jal_A363 YCHF protein; nucleotide-binding fold, structural 95.45
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.42
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.4
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.4
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.4
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.38
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 95.37
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.36
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
Probab=100.00  E-value=1.6e-79  Score=733.25  Aligned_cols=400  Identities=23%  Similarity=0.293  Sum_probs=276.2

Q ss_pred             cchhhHHHHHHHHHHHHHHHcCcccccccccccchhhhhhhhHHHHhhhHHHHHHHHHHHHHHHHHHHH---HHHHHH--
Q psy3001           3 ANGSIRASKGLHLVVLRNILHSCMSFFDTTPVGRMISRFSQDVETVDSNLPTFLRSWINCLFSVLYLMP---VTITVF--   77 (602)
Q Consensus         3 ~~~~~~~~~~l~~~~~~~l~~~~~~~f~~~~~G~i~sr~~~d~~~i~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~--   77 (602)
                      .+.+.|+..+||.++|+|++++|++||+++++|++++|+++|++.+++.+...+..++..++.++..++   +..+.+  
T Consensus       161 ~~~~~r~~~~lR~~~~~~ll~~~~~~fd~~~~G~l~sr~~~D~~~i~~~~~~~l~~~~~~~~~~i~~~i~~~~~~~~l~l  240 (1321)
T 4f4c_A          161 LYVAEQMNNRLRREFVKSILRQEISWFDTNHSGTLATKLFDNLERVKEGTGDKIGMAFQYLSQFITGFIVAFTHSWQLTL  240 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCHHHHHHTCCTTHHHHHHHHHHHHHHTSSHHHHHHHHHHHHHHHHHHHHHHHCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            356789999999999999999999999999999999999999999999877666666665555443322   111111  


Q ss_pred             HHHHHHHHHHHH---HHH---HHHHHHHHHhhcccchhhhhcchh----HH-------HHHHHHHHhhh----------h
Q psy3001          78 FYGFVISLGTLF---AAK---RLHEKLLKSMLRWSPLFFDTTPVG----RV-------LSRFSSDVNTL----------D  130 (602)
Q Consensus        78 ~~~~~~~~~~~~---~~~---~~~~~~~~~~~~~~~~~~~~~~~g----~~-------~~r~~~~~~~~----------~  130 (602)
                      +....+|+..+.   ..+   +...+..+...+ ....+.|...|    +.       .++|.+.....          .
T Consensus       241 v~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~e~l~gi~~ik~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~  319 (1321)
T 4f4c_A          241 VMLAVTPIQALCGFAIAKSMSTFAIRETLRYAK-AGKVVEETISSIRTVVSLNGLRYELERYSTAVEEAKKAGVLKGLFL  319 (1321)
T ss_dssp             HHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHTHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHhHHHHHHhcccHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            111112221111   111   111222222222 12234444444    11       13333211110          0


Q ss_pred             h-------HH-------------------HHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccc
Q psy3001         131 N-------KL-------------------TLSVQQ---TLSQPFKITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEA  181 (602)
Q Consensus       131 ~-------~~-------------------~~~~~~---~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ri~~~~~~~~~~  181 (602)
                      .       .+                   .++.+.   ++.+...+..|+..+...+..++++..+++|+.++++.+++.
T Consensus       320 ~~~~~~~~~~~~~~~~~~~~~g~~~v~~g~lt~g~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~s~~ri~~~l~~~~~~  399 (1321)
T 4f4c_A          320 GISFGAMQASNFISFALAFYIGVGWVHDGSLNFGDMLTTFSSVMMGSMALGLAGPQLAVLGTAQGAASGIYEVLDRKPVI  399 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSCCS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccc
Confidence            0       00                   011222   223344456677778888899999999999999999876554


Q ss_pred             ccccCCCCCCCCCCCCcEEEeeeEEEEecC---------------CceEEEEeccCCChhHHHHHHhcccCCCCceEEEC
Q psy3001         182 EWVNDKKPKDEWPEKGEVEFKDYKVRYREG---------------LELVGIVGRTGAGKSSLTLALFRIIEPADGTIIID  246 (602)
Q Consensus       182 ~~~~~~~~~~~~~~~~~i~~~~vs~~~~~~---------------~e~~~lvG~sGsGKSTL~~ll~g~~~~~~G~I~i~  246 (602)
                      +.... ......+..+.++|+||+|+|+..               ++.+||||+||||||||+++|.|+|+|++|+|.+|
T Consensus       400 ~~~~~-~~~~~~~~~g~I~~~nvsF~Y~~~~~~~vL~~isl~i~~G~~vaivG~sGsGKSTll~ll~~~~~~~~G~I~id  478 (1321)
T 4f4c_A          400 DSSSK-AGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVLKGKITID  478 (1321)
T ss_dssp             SCSSS-CCCCCCCCCCCEEEEEEEECCSSSTTSCSEEEEEEEECTTCEEEEEECSSSCHHHHHHHHTTSSCCSEEEEEET
T ss_pred             ccccc-ccccCCCCCCcEEEEEeeeeCCCCCCCceeeceEEeecCCcEEEEEecCCCcHHHHHHHhccccccccCcccCC
Confidence            32111 111222345678888888888531               27899999999999999999999999999999999


Q ss_pred             CeecCCCChHHHhhccceecccchhhhhhccCCceeEeeecccceeeeccccceeeccccccccccccc-chhHHHHHHH
Q psy3001         247 GVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPFC-SNLQRFYVAT  325 (602)
Q Consensus       247 g~~~~~~~~~~~~~~i~~v~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~  325 (602)
                      |+|+++++...+|++|+||+|+           |++|             .++++.|      +..... ...++...+.
T Consensus       479 G~~i~~~~~~~lr~~i~~v~Q~-----------~~Lf-------------~~TI~eN------I~~g~~~~~~~~v~~a~  528 (1321)
T 4f4c_A          479 GVDVRDINLEFLRKNVAVVSQE-----------PALF-------------NCTIEEN------ISLGKEGITREEMVAAC  528 (1321)
T ss_dssp             TEETTTSCHHHHHHHEEEECSS-----------CCCC-------------SEEHHHH------HHTTCTTCCHHHHHHHH
T ss_pred             CccchhccHHHHhhcccccCCc-----------ceee-------------CCchhHH------HhhhcccchHHHHHHHH
Confidence            9999999999999999999998           7776             3333332      221111 1111111111


Q ss_pred             HH-H-HHHHh--hcccCCcccccCCcCCCChhhHHHHHHHHHHhhCCCeEEEecccccCChhHHHHHHHHHHHhccccEE
Q psy3001         326 SR-Q-LKRLE--SVSRSPIYSHFGETVTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTV  401 (602)
Q Consensus       326 ~~-~-~~~l~--~~~~~~~~~~~~~~lsgs~Gq~Qrl~lAral~~~p~iliLDEpts~LD~~~~~~i~~~l~~~~~~~tv  401 (602)
                      .. . .+.++  ..+.+..+++.|.+||  |||||||+||||++++|+|||||||||+||+++++.+.+.|++..+++|+
T Consensus       529 ~~a~l~~~i~~lp~G~~T~vGe~G~~LS--GGQkQRiaiARAl~~~~~IliLDE~tSaLD~~te~~i~~~l~~~~~~~T~  606 (1321)
T 4f4c_A          529 KMANAEKFIKTLPNGYNTLVGDRGTQLS--GGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTT  606 (1321)
T ss_dssp             HHTTCHHHHHHSTTTTSSEESSSSCCCC--HHHHHHHHHHHHHTTCCSEEEEESTTTTSCTTTHHHHHHHHHHHHTTSEE
T ss_pred             HHccchhHHHcCCCCCccEecCCCCCCC--HHHHHHHHHHHHHccCCCEEEEecccccCCHHHHHHHHHHHHHHhCCCEE
Confidence            11 0 11122  1234556788888999  59999999999999999999999999999999999999999998889999


Q ss_pred             EEeeecccccccCCeEEEEeCceEEeecChhHHhh
Q psy3001         402 LTIAHRLNTIIDSDRVLVLDKGLVVEFDSPSVLMK  436 (602)
Q Consensus       402 i~itH~l~~i~~~d~i~~l~~G~i~~~g~~~~l~~  436 (602)
                      |+||||++++..||+|++|++|+|++.|+|+++++
T Consensus       607 iiiaHrls~i~~aD~Iivl~~G~ive~Gth~eL~~  641 (1321)
T 4f4c_A          607 IIIAHRLSTIRNADLIISCKNGQVVEVGDHRALMA  641 (1321)
T ss_dssp             EEECSCTTTTTTCSEEEEEETTEEEEEECHHHHHT
T ss_pred             EEEcccHHHHHhCCEEEEeeCCeeeccCCHHHHHH
Confidence            99999999999999999999999999999998864



>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 602
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 5e-45
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-25
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-44
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-21
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-42
d2pmka1 241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-19
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 5e-39
d1mv5a_ 242 c.37.1.12 (A:) Multidrug resistance ABC transporte 1e-20
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 7e-39
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 8e-23
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 7e-33
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 9e-17
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 4e-22
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 5e-08
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-21
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-09
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 9e-21
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 6e-09
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 7e-20
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 3e-06
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-19
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-07
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-19
d1b0ua_ 258 c.37.1.12 (A:) ATP-binding subunit of the histidin 1e-09
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 4e-19
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-04
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 5e-17
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 9e-06
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 7e-16
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 9e-06
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-15
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 0.002
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 5e-15
d2onka1 240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 3e-08
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 9e-15
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-04
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 9e-14
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 4e-06
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-11
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-04
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-08
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 5e-08
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 5e-06
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-05
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 3e-07
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 2e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 0.004
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 0.003
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]
 Score =  158 bits (401), Expect = 5e-45
 Identities = 63/277 (22%), Positives = 119/277 (42%), Gaps = 52/277 (18%)

Query: 190 KDEWPEKGEVEFKDYKVRYREGL--------------ELVGIVGRTGAGKSSLTLALFRI 235
           +    ++G ++      +Y +                E V  VG +G GKS+L   + R 
Sbjct: 8   QPIEIKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRF 67

Query: 236 IEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATIFVICYSTPVFIFVIVPVSVLYFF 295
            +   G I+IDG +I+     +LR+++ ++ Q                            
Sbjct: 68  YDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQD--------------------------- 100

Query: 296 IQVSLIFTEDVKPLIITPFCSNLQRFYVATSRQLKRLESVSRSP-----IYSHFGETVTG 350
              +++F++ VK  I+    +      V  ++     + +   P          G  ++G
Sbjct: 101 ---NILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG 157

Query: 351 NVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNT 410
             GQ+Q + +AR  L    ILILDEAT+A+DLE++ +IQ  +       T L +AHRL+T
Sbjct: 158 --GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLST 215

Query: 411 IIDSDRVLVLDKGLVVEFDSPSVLMKNKASIFYSMAK 447
           I  +D+++V++ G +VE  +   L+  +   +  +  
Sbjct: 216 ITHADKIVVIENGHIVETGTHRELIAKQ-GAYEHLYS 251


>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.95
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.95
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 99.94
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.94
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.93
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.87
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.86
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.86
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.86
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.86
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.86
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.85
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.85
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 99.84
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.81
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 99.81
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.8
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.79
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.73
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.72
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.67
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.58
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 98.99
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.87
d2hyda2323 Putative multidrug export ATP-binding/permease pro 98.84
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.55
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.35
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.88
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.43
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.34
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.18
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.01
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.97
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.95
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.9
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.83
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.82
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.8
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.77
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.77
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.67
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.63
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.6
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.59
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.54
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.54
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.53
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.53
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.52
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.52
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.51
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.49
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.48
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.48
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.43
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.42
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.42
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.39
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.34
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.33
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.32
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.32
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.31
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.31
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.31
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.3
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.27
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.27
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.27
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.25
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.23
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.2
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.19
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.17
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.16
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.08
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.08
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.08
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.07
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.06
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.06
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.03
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.03
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.99
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.96
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.96
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.95
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.94
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.93
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.93
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.89
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.83
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.82
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.81
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.81
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.78
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.78
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.77
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.74
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.7
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.69
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.69
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.68
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.65
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 95.65
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.65
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.63
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.62
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.6
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.59
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.55
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.55
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.55
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.54
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.53
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.53
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.52
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.5
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.47
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.47
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.47
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.46
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.45
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.44
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.43
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.43
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.42
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.41
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.4
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.38
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.38
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.37
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.37
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.32
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.32
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 95.3
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.29
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.25
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.22
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.21
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.2
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.18
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.17
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.16
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.16
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.16
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.13
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.11
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.11
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.1
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.1
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.08
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.07
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.06
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.02
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.02
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.02
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.02
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.0
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.98
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.97
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.93
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.92
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.89
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.88
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.85
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.84
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.82
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 94.79
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.76
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.75
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.75
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 94.75
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.73
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.71
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.71
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.68
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.65
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.64
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.63
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.61
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.61
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.55
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.54
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.51
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.51
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.51
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.5
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 94.46
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.45
d1vmaa2213 GTPase domain of the signal recognition particle r 94.43
d1okkd2207 GTPase domain of the signal recognition particle r 94.43
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.37
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.36
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.35
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.35
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 94.35
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 94.33
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.29
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.25
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.23
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.22
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.2
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.12
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.09
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 94.07
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.05
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.05
d2qy9a2211 GTPase domain of the signal recognition particle r 94.0
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.98
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.92
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.87
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.85
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.77
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.73
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.73
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.7
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.67
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.61
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.6
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.54
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.54
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.51
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.45
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.45
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.44
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.41
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.4
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.39
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.38
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.38
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.36
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.35
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.34
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.28
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.28
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.26
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.24
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.21
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.21
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.21
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.19
d1vmaa2213 GTPase domain of the signal recognition particle r 93.18
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.18
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.17
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 93.14
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.14
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 93.13
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.13
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.13
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 93.11
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.08
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.01
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.01
d1okkd2207 GTPase domain of the signal recognition particle r 92.98
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.97
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.97
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 92.93
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.9
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.85
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.85
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.85
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.84
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.83
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.76
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 92.73
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.72
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.7
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.69
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.66
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.66
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.65
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.63
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.63
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.63
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.62
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.61
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.61
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 92.6
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.59
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.58
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.58
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.56
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.53
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.53
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.53
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 92.52
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.51
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.5
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.47
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.45
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.44
d2qy9a2211 GTPase domain of the signal recognition particle r 92.43
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.41
d1ls1a2207 GTPase domain of the signal sequence recognition p 92.4
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.38
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.37
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.34
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.34
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.3
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.28
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.23
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.18
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.18
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.16
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.16
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.15
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 92.1
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.1
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.08
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.06
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.04
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 92.03
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 92.02
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.01
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.01
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 91.93
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.93
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.89
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.82
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.82
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.81
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.8
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 91.79
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.79
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.79
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.76
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 91.7
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 91.7
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 91.69
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 91.66
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.65
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.65
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.63
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.62
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.61
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.6
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.57
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.53
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.5
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 91.49
d1xpua3 289 Transcription termination factor Rho, ATPase domai 91.49
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.39
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.37
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.37
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.32
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 91.28
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.27
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.27
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.26
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 91.25
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.23
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.22
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 91.21
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.21
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.06
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.99
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.98
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.97
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.95
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 90.91
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.9
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.89
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.84
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 90.83
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 90.82
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 90.81
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.8
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.79
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.72
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.71
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.71
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.69
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.68
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.64
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.62
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 90.58
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.56
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.54
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.5
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.45
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.43
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.33
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.31
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.3
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.25
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 90.2
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.13
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.06
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.01
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 89.98
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.93
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.88
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.82
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.82
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.73
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.69
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.68
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.6
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.47
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.46
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.4
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 89.17
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.96
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 88.94
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 88.8
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.61
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.37
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 88.13
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.89
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 87.81
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 87.67
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.51
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 87.49
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 87.29
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 87.21
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 87.07
d1svma_362 Papillomavirus large T antigen helicase domain {Si 87.01
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.79
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 86.7
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.69
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 86.63
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 86.52
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 86.42
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 86.39
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.18
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 86.01
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 85.86
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 85.43
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 85.43
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.3
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.66
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 84.57
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.52
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.5
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 84.22
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 84.11
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 83.98
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.77
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 83.6
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 83.53
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 83.43
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 83.39
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 83.2
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 83.17
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 83.01
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 83.01
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 82.4
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 82.09
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 82.02
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 81.83
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 81.59
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 81.39
d1xpua3289 Transcription termination factor Rho, ATPase domai 81.34
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.24
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 81.22
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.9e-48  Score=376.12  Aligned_cols=222  Identities=31%  Similarity=0.490  Sum_probs=176.5

Q ss_pred             CCCCCcEEEeeeEEEEecCCceEEEEeccCCChhHHHHHHhcccCCCCceEEECCeecCCCChHHHhhccceecccchhh
Q psy3001         193 WPEKGEVEFKDYKVRYREGLELVGIVGRTGAGKSSLTLALFRIIEPADGTIIIDGVDIRTLGLHTLRSRLTIIPQVLATI  272 (602)
Q Consensus       193 ~~~~~~i~~~~vs~~~~~~~e~~~lvG~sGsGKSTL~~ll~g~~~~~~G~I~i~g~~~~~~~~~~~~~~i~~v~Q~~~~~  272 (602)
                      |+......++||||++++| +++||+|+||||||||+++|+|+++|++|+|.+||+|+..++...+|++|+||||+    
T Consensus        11 Y~~~~~~vL~~isl~i~~G-e~vaIvG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~lr~~i~~v~Q~----   85 (241)
T d2pmka1          11 YKPDSPVILDNINLSIKQG-EVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQD----   85 (241)
T ss_dssp             SSTTSCEEEEEEEEEEETT-CEEEEECSTTSSHHHHHHHHTTSSCCSEEEEEETTEETTTSCHHHHHHHEEEECSS----
T ss_pred             eCCCCcceEeeeEEEEcCC-CEEEEECCCCCCHHHHHHHHHhcCCCCCCEEEECCEEecccchhhhhceEEEEecc----
Confidence            3344556899999999998 99999999999999999999999999999999999999999999999999999998    


Q ss_pred             hhhccCCceeEeeecccceeeeccccceeecccccccccccc-cchhHHHHHH--HHHHHHHHhh--cccCCcccccCCc
Q psy3001         273 FVICYSTPVFIFVIVPVSVLYFFIQVSLIFTEDVKPLIITPF-CSNLQRFYVA--TSRQLKRLES--VSRSPIYSHFGET  347 (602)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~--~~~~~~~l~~--~~~~~~~~~~~~~  347 (602)
                             |++|             .+++..|      +.... .....+....  .....+.+..  .+....+++.|..
T Consensus        86 -------~~lf-------------~~Ti~eN------i~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~t~i~~~g~~  139 (241)
T d2pmka1          86 -------NVLL-------------NRSIIDN------ISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAG  139 (241)
T ss_dssp             -------CCCT-------------TSBHHHH------HCTTSTTCCHHHHHHHHHHHTCHHHHTTSTTGGGSBCSTTTTC
T ss_pred             -------cccC-------------Ccccccc------ccccCccccHHHHHHHHHHHhhHHHHHhhhcchhhhcCCCCCc
Confidence                   4333             2332222      11111 1111111111  1111111111  1223346667788


Q ss_pred             CCCChhhHHHHHHHHHHhhCCCeEEEecccccCChhHHHHHHHHHHHhccccEEEEeeecccccccCCeEEEEeCceEEe
Q psy3001         348 VTGNVGQRQLICLARALLRKTKILILDEATAAIDLETDDLIQSTIRSEFAHCTVLTIAHRLNTIIDSDRVLVLDKGLVVE  427 (602)
Q Consensus       348 lsgs~Gq~Qrl~lAral~~~p~iliLDEpts~LD~~~~~~i~~~l~~~~~~~tvi~itH~l~~i~~~d~i~~l~~G~i~~  427 (602)
                      +|  |||||||+|||||+++|+|||||||||+||+.++..+.+.++++.+++|+|+||||++.+..||||++|++|+|++
T Consensus       140 LS--GGq~QRvalARal~~~p~ililDEpts~LD~~~~~~i~~~l~~l~~~~Tvi~itH~l~~~~~~D~i~vl~~G~Iv~  217 (241)
T d2pmka1         140 LS--GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVE  217 (241)
T ss_dssp             CC--HHHHHHHHHHHHHTTCCSEEEECCCCSCCCHHHHHHHHHHHHHHHTTSEEEEECSSGGGGTTSSEEEEEETTEEEE
T ss_pred             cC--HHHHHHHhhhhhhhcccchhhhhCCccccCHHHHHHHHHHHHHHhCCCEEEEEECCHHHHHhCCEEEEEECCEEEE
Confidence            88  5999999999999999999999999999999999999999999888999999999999998899999999999999


Q ss_pred             ecChhHHhhcchhHHHHHHH
Q psy3001         428 FDSPSVLMKNKASIFYSMAK  447 (602)
Q Consensus       428 ~g~~~~l~~~~~~~~~~~~~  447 (602)
                      .|++++++++++..|..+++
T Consensus       218 ~G~~~ell~~~~~~y~~l~~  237 (241)
T d2pmka1         218 QGKHKELLSEPESLYSYLYQ  237 (241)
T ss_dssp             EECHHHHHHSTTCHHHHHHH
T ss_pred             ECCHHHHHhCCCCHHHHHHH
Confidence            99999999887777776664



>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure