Psyllid ID: psy3092
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 347 | ||||||
| 410130138 | 416 | retinoid X receptor [Periplaneta america | 0.982 | 0.819 | 0.736 | 1e-147 | |
| 302202572 | 403 | retinoid X receptor [Gryllus firmus] | 0.988 | 0.851 | 0.750 | 1e-147 | |
| 314955486 | 403 | retinoid X receptor [Gryllus firmus] | 0.988 | 0.851 | 0.747 | 1e-147 | |
| 314955556 | 403 | retinoid X receptor [Gryllus firmus] | 0.988 | 0.851 | 0.747 | 1e-147 | |
| 383848789 | 427 | PREDICTED: retinoic acid receptor RXR-al | 0.985 | 0.800 | 0.738 | 1e-147 | |
| 242008309 | 420 | retinoid X receptor, putative [Pediculus | 0.976 | 0.807 | 0.740 | 1e-147 | |
| 449082861 | 441 | ultraspiracle long isoform [Periplaneta | 0.991 | 0.780 | 0.704 | 1e-146 | |
| 380012603 | 440 | PREDICTED: retinoic acid receptor RXR-al | 0.985 | 0.777 | 0.735 | 1e-145 | |
| 58585210 | 427 | ultraspiracle [Apis mellifera] gi|811861 | 0.985 | 0.800 | 0.735 | 1e-145 | |
| 340719093 | 427 | PREDICTED: retinoic acid receptor RXR-al | 0.985 | 0.800 | 0.735 | 1e-145 |
| >gi|410130138|dbj|BAM63276.2| retinoid X receptor [Periplaneta americana] | Back alignment and taxonomy information |
|---|
Score = 528 bits (1361), Expect = e-147, Method: Compositional matrix adjust.
Identities = 265/360 (73%), Positives = 294/360 (81%), Gaps = 19/360 (5%)
Query: 1 MKPDTATLLVNFNS-----GGANSMSSFG-------SNNHSSSHNNGSSNSSIISPYPPN 48
MKPDTA LL+ S GG N+ SF S + SS +NGS SS PYPPN
Sbjct: 29 MKPDTACLLLGSGSFTPTGGGPNTPGSFCIGQSRVFSKSTGSSQSNGSWGSS---PYPPN 85
Query: 49 HPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRN 108
HPL GSKHLC+ICGDRA GKHYGVY CEGCKGFFK TVRKDLSYACRE +NCIIDKRQRN
Sbjct: 86 HPLSGSKHLCTICGDRACGKHYGVYCCEGCKGFFKWTVRKDLSYACREDKNCIIDKRQRN 145
Query: 109 RCQYCRYQKCLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMK 168
RCQYCRYQKCL MGMKREAVQEERQRTKERD NEVESTS +MPVERILEAE+RV+ K
Sbjct: 146 RCQYCRYQKCLGMGMKREAVQEERQRTKERDQNEVESTSSLHTDMPVERILEAEKRVECK 205
Query: 169 QEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIA 228
E + E TNIC+AT+KQLFQLV+WAKHIPHFT+LPL DQVLLLRAGWNELLIA
Sbjct: 206 TE---HQVEFESAVTNICQATNKQLFQLVEWAKHIPHFTSLPLSDQVLLLRAGWNELLIA 262
Query: 229 SFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLR 288
+FSHRS+ VKDGI+LA G+TV+R+SAH+AGVG IFDRVLTELV+KMREMKMDKTEL CLR
Sbjct: 263 AFSHRSVEVKDGIVLATGLTVHRNSAHQAGVGTIFDRVLTELVAKMREMKMDKTELVCLR 322
Query: 289 TIILFNPD-VRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV 347
++ILFNPD VRGLKS+Q VE+LREKVY +LEEYTR H +EPGRFAKLL LPSLRSI +
Sbjct: 323 SVILFNPDVVRGLKSRQEVELLREKVYAALEEYTRTTHPDEPGRFAKLLPSLPSLRSISL 382
|
Source: Periplaneta americana Species: Periplaneta americana Genus: Periplaneta Family: Blattidae Order: Blattodea Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|302202572|gb|ADL09403.1| retinoid X receptor [Gryllus firmus] | Back alignment and taxonomy information |
|---|
| >gi|314955486|gb|ADT64884.1| retinoid X receptor [Gryllus firmus] | Back alignment and taxonomy information |
|---|
| >gi|314955556|gb|ADT64885.1| retinoid X receptor [Gryllus firmus] | Back alignment and taxonomy information |
|---|
| >gi|383848789|ref|XP_003700030.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242008309|ref|XP_002424949.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212508563|gb|EEB12211.1| retinoid X receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|449082861|dbj|BAM83567.1| ultraspiracle long isoform [Periplaneta americana] | Back alignment and taxonomy information |
|---|
| >gi|380012603|ref|XP_003690369.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|58585210|ref|NP_001011634.1| ultraspiracle [Apis mellifera] gi|8118613|gb|AAF73057.1|AF263459_1 ultraspiracle protein [Apis mellifera] gi|30691980|gb|AAP33487.1| ultraspiracle protein [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340719093|ref|XP_003397991.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like isoform 1 [Bombus terrestris] gi|350396161|ref|XP_003484462.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 347 | ||||||
| UNIPROTKB|F1NSP3 | 467 | RXRG "Retinoic acid receptor R | 0.864 | 0.642 | 0.668 | 2e-104 | |
| ZFIN|ZDB-GENE-070314-2 | 495 | rxraa "retinoid X receptor, al | 0.861 | 0.604 | 0.667 | 5.3e-104 | |
| ZFIN|ZDB-GENE-980526-36 | 441 | rxrga "retinoid x receptor, ga | 0.867 | 0.682 | 0.664 | 6.7e-104 | |
| UNIPROTKB|P28701 | 467 | RXRG "Retinoic acid receptor R | 0.864 | 0.642 | 0.665 | 1.1e-103 | |
| UNIPROTKB|P51129 | 470 | rxrg "Retinoic acid receptor R | 0.867 | 0.640 | 0.661 | 3.7e-103 | |
| UNIPROTKB|B3KY83 | 365 | RXRA "cDNA FLJ16020 fis, clone | 0.867 | 0.824 | 0.657 | 1.3e-102 | |
| UNIPROTKB|P19793 | 462 | RXRA "Retinoic acid receptor R | 0.867 | 0.651 | 0.657 | 1.3e-102 | |
| UNIPROTKB|F1P6M9 | 486 | RXRA "Uncharacterized protein" | 0.867 | 0.619 | 0.654 | 2.6e-102 | |
| MGI|MGI:98214 | 467 | Rxra "retinoid X receptor alph | 0.867 | 0.644 | 0.654 | 2.6e-102 | |
| UNIPROTKB|P51128 | 488 | rxra "Retinoic acid receptor R | 0.870 | 0.618 | 0.650 | 3.3e-102 |
| UNIPROTKB|F1NSP3 RXRG "Retinoic acid receptor RXR-gamma" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 1034 (369.0 bits), Expect = 2.0e-104, P = 2.0e-104
Identities = 204/305 (66%), Positives = 236/305 (77%)
Query: 45 YPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDX 104
YP P +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDL Y CR+ ++C+ID
Sbjct: 130 YPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDK 189
Query: 105 XXXXXXXXXXXXXXLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQR 164
L MGMKREAVQEERQR++ER NE ESTSG +MPVERILEAE
Sbjct: 190 RQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERSENEAESTSGGSEDMPVERILEAELA 249
Query: 165 VDMKQEPADQDIVNEQQA----TNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRA 220
V+ K E A D+ E TNIC A DKQLF LV+WAK IPHF+ L LEDQV+LLRA
Sbjct: 250 VEPKTE-AYSDVNTESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRA 308
Query: 221 GWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMD 280
GWNELLIASFSHRS+SV+DGILLA G+ V+RSSAH AGVG IFDRVLTELVSKM++M+MD
Sbjct: 309 GWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMD 368
Query: 281 KTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLP 340
K+ELGCLR I+LFNPD +GL S VE LREKVY +LE YT+ + E+PGRFAKLLLRLP
Sbjct: 369 KSELGCLRAIVLFNPDAKGLSSPSEVESLREKVYATLEAYTKQKYPEQPGRFAKLLLRLP 428
Query: 341 SLRSI 345
+LRSI
Sbjct: 429 ALRSI 433
|
|
| ZFIN|ZDB-GENE-070314-2 rxraa "retinoid X receptor, alpha a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-980526-36 rxrga "retinoid x receptor, gamma a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28701 RXRG "Retinoic acid receptor RXR-gamma" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51129 rxrg "Retinoic acid receptor RXR-gamma" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3KY83 RXRA "cDNA FLJ16020 fis, clone BRAMY2003287, highly similar to RETINOIC ACID RECEPTOR RXR-ALPHA" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P19793 RXRA "Retinoic acid receptor RXR-alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P6M9 RXRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98214 Rxra "retinoid X receptor alpha" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51128 rxra "Retinoic acid receptor RXR-alpha" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 347 | |||
| cd06943 | 207 | cd06943, NR_LBD_RXR_like, The ligand binding domai | 1e-123 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 8e-57 | |
| cd06956 | 77 | cd06956, NR_DBD_RXR, DNA-binding domain of retinoi | 2e-53 | |
| cd06931 | 222 | cd06931, NR_LBD_HNF4_like, The ligand binding doma | 2e-49 | |
| cd06916 | 72 | cd06916, NR_DBD_like, DNA-binding domain of nuclea | 2e-47 | |
| cd06157 | 168 | cd06157, NR_LBD, The ligand binding domain of nucl | 3e-45 | |
| smart00430 | 163 | smart00430, HOLI, Ligand binding domain of hormone | 2e-43 | |
| pfam00105 | 70 | pfam00105, zf-C4, Zinc finger, C4 type (two domain | 5e-42 | |
| cd06960 | 76 | cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto | 2e-41 | |
| cd06967 | 87 | cd06967, NR_DBD_TR2_like, DNA-binding domain of th | 3e-40 | |
| cd06948 | 236 | cd06948, NR_LBD_COUP-TF, Ligand binding domain of | 6e-40 | |
| cd06961 | 85 | cd06961, NR_DBD_TR, DNA-binding domain of thyroid | 2e-39 | |
| cd06969 | 75 | cd06969, NR_DBD_NGFI-B, DNA-binding domain of the | 3e-39 | |
| cd07164 | 78 | cd07164, NR_DBD_PNR_like_1, DNA-binding domain of | 3e-39 | |
| cd06944 | 237 | cd06944, NR_LBD_Ftz-F1_like, The ligand binding do | 6e-38 | |
| cd07068 | 221 | cd07068, NR_LBD_ER_like, The ligand binding domain | 2e-37 | |
| cd06950 | 206 | cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d | 5e-37 | |
| pfam00104 | 186 | pfam00104, Hormone_recep, Ligand-binding domain of | 7e-37 | |
| cd07167 | 93 | cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain | 3e-36 | |
| smart00399 | 70 | smart00399, ZnF_C4, c4 zinc finger in nuclear horm | 4e-36 | |
| cd06958 | 73 | cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi | 1e-35 | |
| cd07169 | 90 | cd07169, NR_DBD_GCNF_like, DNA-binding domain of G | 1e-33 | |
| cd06968 | 95 | cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi | 4e-33 | |
| cd06965 | 84 | cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi | 5e-33 | |
| cd06957 | 82 | cd06957, NR_DBD_PNR_like_2, DNA-binding domain of | 8e-33 | |
| cd06964 | 85 | cd06964, NR_DBD_RAR, DNA-binding domain of retinoi | 8e-33 | |
| cd07168 | 90 | cd07168, NR_DBD_DHR4_like, DNA-binding domain of e | 1e-32 | |
| cd06970 | 92 | cd06970, NR_DBD_PNR, DNA-binding domain of the pho | 3e-32 | |
| cd07154 | 73 | cd07154, NR_DBD_PNR_like, The DNA-binding domain o | 1e-31 | |
| cd07158 | 73 | cd07158, NR_DBD_Ppar_like, The DNA-binding domain | 2e-31 | |
| cd07165 | 81 | cd07165, NR_DBD_DmE78_like, DNA-binding domain of | 3e-31 | |
| cd07163 | 92 | cd07163, NR_DBD_TLX, DNA-binding domain of Tailles | 1e-30 | |
| cd07166 | 89 | cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV | 2e-30 | |
| cd06929 | 174 | cd06929, NR_LBD_F1, Ligand-binding domain of nucle | 4e-30 | |
| cd07069 | 241 | cd07069, NR_LBD_Lrh-1, The ligand binding domain o | 7e-30 | |
| cd07155 | 75 | cd07155, NR_DBD_ER_like, DNA-binding domain of est | 4e-29 | |
| cd06946 | 221 | cd06946, NR_LBD_ERR, The ligand binding domain of | 4e-28 | |
| cd07179 | 74 | cd07179, 2DBD_NR_DBD2, The second DNA-binding doma | 5e-28 | |
| cd06959 | 73 | cd06959, NR_DBD_EcR_like, The DNA-binding domain o | 6e-28 | |
| cd07170 | 97 | cd07170, NR_DBD_ERR, DNA-binding domain of estroge | 8e-28 | |
| cd07171 | 82 | cd07171, NR_DBD_ER, DNA-binding domain of estrogen | 2e-27 | |
| cd07161 | 91 | cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson | 2e-26 | |
| cd06952 | 222 | cd06952, NR_LBD_TR2_like, The ligand binding domai | 5e-26 | |
| cd07156 | 72 | cd07156, NR_DBD_VDR_like, The DNA-binding domain o | 5e-26 | |
| cd07160 | 101 | cd07160, NR_DBD_LXR, DNA-binding domain of Liver X | 7e-26 | |
| cd06962 | 84 | cd06962, NR_DBD_FXR, DNA-binding domain of Farneso | 3e-24 | |
| cd06937 | 231 | cd06937, NR_LBD_RAR, The ligand binding domain (LB | 6e-24 | |
| cd06953 | 213 | cd06953, NR_LBD_DHR4_like, The ligand binding doma | 1e-23 | |
| cd06949 | 235 | cd06949, NR_LBD_ER, Ligand binding domain of Estro | 5e-23 | |
| cd07162 | 87 | cd07162, NR_DBD_PXR, DNA-binding domain of pregnan | 2e-22 | |
| cd07157 | 86 | cd07157, 2DBD_NR_DBD1, The first DNA-binding domai | 3e-22 | |
| cd06955 | 107 | cd06955, NR_DBD_VDR, DNA-binding domain of vitamin | 2e-21 | |
| cd07172 | 78 | cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco | 3e-21 | |
| cd07070 | 237 | cd07070, NR_LBD_SF-1, The ligand binding domain of | 5e-21 | |
| cd06940 | 189 | cd06940, NR_LBD_REV_ERB, The ligand binding domain | 7e-21 | |
| cd06954 | 236 | cd06954, NR_LBD_LXR, The ligand binding domain of | 2e-20 | |
| cd06963 | 73 | cd06963, NR_DBD_GR_like, The DNA binding domain of | 2e-19 | |
| cd06966 | 94 | cd06966, NR_DBD_CAR, DNA-binding domain of constit | 2e-19 | |
| cd06932 | 259 | cd06932, NR_LBD_PPAR, The ligand binding domain of | 2e-17 | |
| cd06951 | 222 | cd06951, NR_LBD_Dax1_like, The ligand binding doma | 8e-17 | |
| cd06935 | 243 | cd06935, NR_LBD_TR, The ligand binding domain of t | 1e-16 | |
| cd07350 | 232 | cd07350, NR_LBD_Dax1, The ligand binding domain of | 2e-16 | |
| cd07173 | 82 | cd07173, NR_DBD_AR, DNA-binding domain of androgen | 2e-16 | |
| cd06945 | 239 | cd06945, NR_LBD_Nurr1_like, The ligand binding dom | 9e-16 | |
| cd06936 | 221 | cd06936, NR_LBD_Fxr, The ligand binding domain of | 2e-14 | |
| cd07348 | 238 | cd07348, NR_LBD_NGFI-B, The ligand binding domain | 2e-14 | |
| cd07071 | 238 | cd07071, NR_LBD_Nurr1, The ligand binding domain o | 7e-14 | |
| cd07349 | 222 | cd07349, NR_LBD_SHP, The ligand binding domain of | 2e-13 | |
| cd06939 | 241 | cd06939, NR_LBD_ROR_like, The ligand binding domai | 4e-13 | |
| cd06938 | 231 | cd06938, NR_LBD_EcR, The ligand binding domain (LB | 1e-12 | |
| cd06941 | 195 | cd06941, NR_LBD_DmE78_like, The ligand binding dom | 1e-12 | |
| cd07072 | 239 | cd07072, NR_LBD_DHR38_like, Ligand binding domain | 3e-10 | |
| cd06934 | 226 | cd06934, NR_LBD_PXR_like, The ligand binding domai | 1e-09 | |
| cd06947 | 246 | cd06947, NR_LBD_GR_Like, Ligand binding domain of | 3e-08 | |
| cd06933 | 238 | cd06933, NR_LBD_VDR, The ligand binding domain of | 4e-08 | |
| cd07076 | 247 | cd07076, NR_LBD_GR, Ligand binding domain of the g | 1e-07 | |
| cd07075 | 248 | cd07075, NR_LBD_MR, Ligand binding domain of the m | 5e-07 | |
| cd07074 | 248 | cd07074, NR_LBD_PR, Ligand binding domain of the p | 9e-07 | |
| cd07073 | 246 | cd07073, NR_LBD_AR, Ligand binding domain of the n | 3e-06 |
| >gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
Score = 352 bits (906), Expect = e-123
Identities = 139/195 (71%), Positives = 164/195 (84%), Gaps = 1/195 (0%)
Query: 152 EMPVERILEAEQRVDMKQEP-ADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLP 210
+MP+ERILEAE V+ K E A +NIC+A DKQLFQLV+WAK IPHF+ LP
Sbjct: 1 DMPIERILEAELAVEPKSEAVAMVPPEYRDPVSNICQAADKQLFQLVEWAKRIPHFSELP 60
Query: 211 LEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTEL 270
L+DQV+LLRAGWNELLIA+F+HRSI+VKDGILLA G+ ++R+SAH+AGVG IFDR+LTEL
Sbjct: 61 LDDQVILLRAGWNELLIAAFAHRSIAVKDGILLATGLHLHRNSAHQAGVGAIFDRILTEL 120
Query: 271 VSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPG 330
V KMR++KMD+TELGCLR IILFNPDV+GLKS+Q VE LREKVY SLEEY R H E+PG
Sbjct: 121 VVKMRDLKMDRTELGCLRAIILFNPDVKGLKSRQEVESLREKVYASLEEYCRQKHPEQPG 180
Query: 331 RFAKLLLRLPSLRSI 345
RFAKLLLRLP+LRSI
Sbjct: 181 RFAKLLLRLPALRSI 195
|
The ligand binding domain of the retinoid X receptor (RXR) and Ultraspiracle (USP): This family includes two evolutionary related nuclear receptors: retinoid X receptor (RXR) and Ultraspiracle (USP). RXR is a nuclear receptor in mammalian and USP is its counterpart in invertebrates. The native ligand of retinoid X receptor is 9-cis retinoic acid (RA). RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. RXRs can play different roles in these heterodimers. It acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear receptors. Ultraspiracle (USP) plays similar roles as DNA binding partner of other nuclear rec eptors in invertebrates. USP has no known high-affinity ligand and is thought to be a silent component in the heterodimeric complex with partner receptors. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, RXR and USP have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 207 |
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) | Back alignment and domain information |
|---|
| >gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132727 cd06929, NR_LBD_F1, Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132744 cd06946, NR_LBD_ERR, The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132735 cd06937, NR_LBD_RAR, The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132751 cd06953, NR_LBD_DHR4_like, The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >gnl|CDD|132747 cd06949, NR_LBD_ER, Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132755 cd07070, NR_LBD_SF-1, The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132738 cd06940, NR_LBD_REV_ERB, The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132752 cd06954, NR_LBD_LXR, The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132730 cd06932, NR_LBD_PPAR, The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132733 cd06935, NR_LBD_TR, The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132764 cd07350, NR_LBD_Dax1, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132743 cd06945, NR_LBD_Nurr1_like, The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132734 cd06936, NR_LBD_Fxr, The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >gnl|CDD|132762 cd07348, NR_LBD_NGFI-B, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132756 cd07071, NR_LBD_Nurr1, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132737 cd06939, NR_LBD_ROR_like, The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132736 cd06938, NR_LBD_EcR, The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >gnl|CDD|132739 cd06941, NR_LBD_DmE78_like, The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132757 cd07072, NR_LBD_DHR38_like, Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132732 cd06934, NR_LBD_PXR_like, The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132745 cd06947, NR_LBD_GR_Like, Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132731 cd06933, NR_LBD_VDR, The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132761 cd07076, NR_LBD_GR, Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132760 cd07075, NR_LBD_MR, Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132759 cd07074, NR_LBD_PR, Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132758 cd07073, NR_LBD_AR, Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 347 | |||
| KOG4215|consensus | 432 | 100.0 | ||
| KOG4217|consensus | 605 | 100.0 | ||
| KOG4216|consensus | 479 | 100.0 | ||
| KOG4218|consensus | 475 | 100.0 | ||
| KOG4846|consensus | 538 | 100.0 | ||
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 100.0 | |
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 100.0 | |
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 100.0 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 100.0 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 100.0 | |
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 99.98 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 99.98 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 99.98 | |
| cd06940 | 189 | NR_LBD_REV_ERB The ligand binding domain of REV-ER | 99.98 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 99.97 | |
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.97 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 99.97 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 99.97 | |
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 99.97 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 99.97 | |
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 99.97 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 99.97 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 99.97 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 99.97 | |
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 99.97 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 99.97 | |
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 99.97 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 99.97 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 99.97 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 99.97 | |
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 99.97 | |
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 99.97 | |
| cd06929 | 174 | NR_LBD_F1 Ligand-binding domain of nuclear recepto | 99.97 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 99.97 | |
| cd06930 | 165 | NR_LBD_F2 Ligand-binding domain of nuclear recepto | 99.97 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 99.97 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 99.97 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 99.97 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 99.97 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 99.97 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 99.97 | |
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 99.97 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 99.97 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 99.97 | |
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 99.97 | |
| cd06941 | 195 | NR_LBD_DmE78_like The ligand binding domain of Dro | 99.97 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 99.97 | |
| cd06951 | 222 | NR_LBD_Dax1_like The ligand binding domain of DAX1 | 99.97 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 99.97 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 99.97 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 99.97 | |
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.97 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 99.97 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 99.97 | |
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 99.97 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 99.97 | |
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 99.97 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 99.97 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 99.97 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 99.97 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 99.97 | |
| cd07349 | 222 | NR_LBD_SHP The ligand binding domain of DAX1 prote | 99.97 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 99.97 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.97 | |
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 99.97 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 99.97 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 99.97 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 99.97 | |
| cd07350 | 232 | NR_LBD_Dax1 The ligand binding domain of DAX1 prot | 99.97 | |
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 99.97 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 99.96 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 99.96 | |
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 99.96 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 99.96 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.96 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 99.96 | |
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 99.96 | |
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 99.96 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 99.96 | |
| cd06942 | 191 | NR_LBD_Sex_1_like The ligand binding domain of Cae | 99.96 | |
| cd06952 | 222 | NR_LBD_TR2_like The ligand binding domain of the o | 99.96 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 99.95 | |
| cd06157 | 168 | NR_LBD The ligand binding domain of nuclear recept | 99.94 | |
| smart00430 | 163 | HOLI Ligand binding domain of hormone receptors. | 99.94 | |
| PF00104 | 203 | Hormone_recep: Ligand-binding domain of nuclear ho | 99.93 | |
| KOG3277|consensus | 165 | 82.23 | ||
| PF12760 | 46 | Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int | 80.7 | |
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 80.45 |
| >KOG4215|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-70 Score=474.63 Aligned_cols=289 Identities=41% Similarity=0.776 Sum_probs=247.1
Q ss_pred CCcCcccCCCCCCcccccccchhhHHHHHhhhcCCCcccccCCCCcccccccccCchhhhhHHHHhcCcchhHHHHHHhh
Q psy3092 55 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEERQR 134 (347)
Q Consensus 55 ~~~C~VCg~~a~g~HyGv~sC~~Ck~FFRR~v~~~~~~~C~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~r~~ 134 (347)
...|.||||+|+|+||||.+|.||||||||+|+++..|.|+.+.+|.|||+.|+.||+|||+||+.+||++++||.+||+
T Consensus 19 ~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERDr 98 (432)
T KOG4215|consen 19 AEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERDR 98 (432)
T ss_pred cchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhccccc
Confidence 35799999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhccccccccCCCCCCCCCcHHHHHHHHHhccCCCC------CCcc-c------cchhHHHhhhhHHHHHHHHHHHHHHh
Q psy3092 135 TKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQE------PADQ-D------IVNEQQATNICKATDKQLFQLVDWAK 201 (347)
Q Consensus 135 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~------~~~~-~------~~~~~~~~~~~~~~~~~l~~~~~w~k 201 (347)
+..+.+.... +...+..++.++.++..+..... +... + .-......++++....++..+|||||
T Consensus 99 Ig~Rr~~~~~---~n~~~~~id~L~~aE~~~~q~~~srs~~~~~~~~d~r~~~~n~~~at~~Dv~eSm~qqLlllVEWAK 175 (432)
T KOG4215|consen 99 IGSRRPSYEA---GNENSPSIDALVQAEALVRQLRSSRSGGVPGIDGDIRQGPPNKKIATENDVCESMKQQLLLLVEWAK 175 (432)
T ss_pred ccccCCCCCC---CCCCchhHHHHHhHHHHHhhhhccccccCcCcchhhhcCccccccccHHHHHHHHHHHHHHHHHHHH
Confidence 8775432211 11233345666666654432211 1000 0 11224567889999999999999999
Q ss_pred hCCCCCCCCHHHHHHHHHHHHHHHHHHHhhcccccCCCceEecCCccccccchhhcCchhhHHhhHHHHHHHHHhcCCCH
Q psy3092 202 HIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDK 281 (347)
Q Consensus 202 ~~p~F~~L~~~dq~~Llk~~~~~~~~l~~a~~s~~~~~~~~~~~g~~i~~~~~~~~~~~~~~~~~~~~l~~~l~~L~l~~ 281 (347)
.+|.|.+|+.+||+.|||+...+.+++..++|++..++..++.+...+..+..+......+..|+++|++.||++|++|+
T Consensus 176 ~i~~F~el~l~DqvaLLk~~a~~hllLg~a~RSm~l~~v~ll~N~~v~~~~~~~~~eis~v~~RIiDElv~Pmr~L~md~ 255 (432)
T KOG4215|consen 176 YIPPFCELPLDDQVALLKAHAGQHLLLGAAFRSMHLKDVCLLNNTYVLHRHAPDLPEISRVAPRIIDELVNPMRRLQMDE 255 (432)
T ss_pred hccchhcCCchhHHHHHHccchhhhhhhhhhccccccceEEecCceeeccCCCChHHHHHHHHHHHHHHhhHHHHhccch
Confidence 99999999999999999999999999999999999989888888887777666555566788899999999999999999
Q ss_pred hHHHHHHHHHhhcCCCCCCCCH--HHHHHHHHHHHHHHHHHHHhcCC-CCchHHHHHHhhhhhhhccC
Q psy3092 282 TELGCLRTIILFNPDVRGLKSQ--QVVEMLREKVYTSLEEYTRVNHS-EEPGRFAKLLLRLPSLRSIE 346 (347)
Q Consensus 282 ~E~~lL~ai~l~~p~~~~l~~~--~~i~~~r~~~~~~L~~y~~~~~~-~~~~Rf~~LL~ll~~lr~i~ 346 (347)
.||++||||+||+|+..||++. ..|+++|++++..|+.|+..+.+ +.+.|||+||++||+|++|+
T Consensus 256 ~Ey~cLKAi~FfdP~akGis~~s~~~I~~aR~~vl~sLe~yi~d~q~~d~~~R~g~LLLllPsLqsIt 323 (432)
T KOG4215|consen 256 IEYVCLKAIAFFDPDAKGLSDPSQIRIREARNRVLKSLEAYISDRQPYDAPGRFGNLLLLLPSLQSIT 323 (432)
T ss_pred HHHHHHHHHHhcCccccccCCchHhHHHHHHHHHHHHHHHHHhhcCccccccchhhHHHHHHHHHHHH
Confidence 9999999999999999999984 48999999999999999998875 78999999999999999874
|
|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein | Back alignment and domain information |
|---|
| >cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >smart00430 HOLI Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG3277|consensus | Back alignment and domain information |
|---|
| >PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 347 | ||||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 1e-114 | ||
| 1z5x_U | 262 | Hemipteran Ecdysone Receptor Ligand-Binding Domain | 2e-88 | ||
| 1lbd_A | 282 | Ligand-Binding Domain Of The Human Nuclear Receptor | 2e-84 | ||
| 1xiu_A | 230 | Crystal Structure Of The Agonist-Bound Ligand-Bindi | 7e-77 | ||
| 2gl8_A | 241 | Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi | 8e-75 | ||
| 3eyb_A | 219 | Structural And Functional Insights Into The Ligand | 2e-74 | ||
| 1mv9_A | 240 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 4e-74 | ||
| 3e94_A | 244 | Crystal Structure Of Rxralpha Ligand Binding Domain | 4e-74 | ||
| 3uvv_B | 244 | Crystal Structure Of The Ligand Binding Domains Of | 5e-74 | ||
| 1fby_A | 239 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 6e-74 | ||
| 1fm6_A | 238 | The 2.1 Angstrom Resolution Crystal Structure Of Th | 6e-74 | ||
| 1rdt_A | 242 | Crystal Structure Of A New Rexinoid Bound To The Rx | 6e-74 | ||
| 3a9e_A | 240 | Crystal Structure Of A Mixed Agonist-Bound Rar-Alph | 7e-74 | ||
| 3pcu_A | 230 | Crystal Structure Of Human Retinoic X Receptor Alph | 8e-74 | ||
| 1xls_A | 232 | Crystal Structure Of The Mouse CarRXR LBD HETERODIM | 9e-74 | ||
| 3oap_A | 231 | Crystal Structure Of Human Retinoid X Receptor Alph | 9e-74 | ||
| 1xv9_A | 236 | Crystal Structure Of CarRXR HETERODIMER BOUND WITH | 9e-74 | ||
| 3h0a_A | 228 | Crystal Structure Of Peroxisome Proliferator-Activa | 9e-74 | ||
| 1xdk_A | 238 | Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN | 1e-73 | ||
| 2nxx_A | 235 | Crystal Structure Of The Ligand-Binding Domains Of | 4e-73 | ||
| 1uhl_A | 236 | Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero | 9e-73 | ||
| 1dkf_A | 233 | Crystal Structure Of A Heterodimeric Complex Of Rar | 1e-72 | ||
| 1h9u_A | 224 | The Structure Of The Human Retinoid-X-Receptor Beta | 3e-72 | ||
| 2q60_A | 258 | Crystal Structure Of The Ligand Binding Domain Of P | 2e-71 | ||
| 1hg4_A | 279 | Ultraspiracle Ligand Binding Domain From Drosophila | 5e-44 | ||
| 1g2n_A | 264 | Crystal Structure Of The Ligand Binding Domain Of T | 1e-38 | ||
| 1r1k_A | 263 | Crystal Structure Of The Ligand-Binding Domains Of | 1e-38 | ||
| 1r0o_A | 86 | Crystal Structure Of The Heterodimeric Ecdysone Rec | 4e-33 | ||
| 2han_A | 93 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 6e-33 | ||
| 1ynw_B | 99 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 1e-32 | ||
| 1dsz_B | 85 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 6e-28 | ||
| 1rxr_A | 83 | High Resolution Solution Structure Of The Retinoid | 7e-28 | ||
| 1lv2_A | 229 | Hepatocyte Nuclear Factor 4 Is A Transcription Fact | 2e-27 | ||
| 3cjw_A | 244 | Crystal Structure Of The Human Coup-Tfii Ligand Bin | 3e-27 | ||
| 1by4_A | 82 | Structure And Mechanism Of The Homodimeric Assembly | 9e-27 | ||
| 1m7w_A | 250 | Hnf4a Ligand Binding Domain With Bound Fatty Acid L | 2e-26 | ||
| 3fs1_A | 230 | Crystal Structure Of Hnf4a Lbd In Complex With The | 7e-26 | ||
| 1pzl_A | 237 | Crystal Structure Of Hnf4a Lbd In Complex With The | 8e-26 | ||
| 1r0n_A | 81 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 2e-25 | ||
| 4dos_A | 242 | Human Nuclear Receptor Liver Receptor Homologue-1, | 3e-24 | ||
| 1yuc_A | 255 | Human Nuclear Receptor Liver Receptor Homologue-1, | 4e-24 | ||
| 1vjb_A | 251 | Crystal Structure Of The Ligand-Binding Domain Of T | 4e-24 | ||
| 1s9q_A | 251 | Crystal Structure Of The Ligand-Binding Domain Of T | 4e-24 | ||
| 1s9p_A | 227 | Crystal Structure Of The Ligand-Binding Domain Of T | 4e-24 | ||
| 2e2r_A | 244 | Crystal Structure Of Human Estrogen-Related Recepto | 4e-24 | ||
| 2ewp_A | 226 | Crystal Structure Of Estrogen Related Receptor-3 (E | 4e-24 | ||
| 1kv6_A | 230 | X-Ray Structure Of The Orphan Nuclear Receptor Err3 | 4e-24 | ||
| 1zdu_A | 245 | The Crystal Structure Of Human Liver Receptor Homol | 4e-24 | ||
| 3plz_A | 257 | Human Lrh1 Lbd Bound To Gr470 Length = 257 | 5e-24 | ||
| 1yok_A | 256 | Crystal Structure Of Human Lrh-1 Bound With Tif-2 P | 5e-24 | ||
| 3dzu_D | 419 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 6e-24 | ||
| 3tx7_B | 352 | Crystal Structure Of Lrh-1BETA-Catenin Complex Leng | 8e-24 | ||
| 1pk5_A | 248 | Crystal Structure Of The Orphan Nuclear Receptor Lr | 9e-24 | ||
| 1zh7_A | 243 | Structural And Biochemical Basis For Selective Repr | 2e-23 | ||
| 2nll_A | 66 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 4e-20 | ||
| 3cbb_A | 78 | Crystal Structure Of Hepatocyte Nuclear Factor 4alp | 5e-19 | ||
| 3a9e_B | 269 | Crystal Structure Of A Mixed Agonist-Bound Rar-Alph | 1e-18 | ||
| 3p0u_A | 249 | Crystal Structure Of The Ligand Binding Domain Of H | 2e-18 | ||
| 1dkf_B | 235 | Crystal Structure Of A Heterodimeric Complex Of Rar | 2e-18 | ||
| 3kmr_A | 266 | Crystal Structure Of Raralpha Ligand Binding Domain | 2e-18 | ||
| 4dqm_A | 234 | Revealing A Marine Natural Product As A Novel Agoni | 2e-18 | ||
| 1xdk_B | 303 | Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN | 2e-18 | ||
| 1ymt_A | 246 | Mouse Sf-1 Lbd Length = 246 | 5e-18 | ||
| 1xap_A | 267 | Structure Of The Ligand Binding Domain Of The Retin | 5e-18 | ||
| 1yp0_A | 239 | Structure Of The Steroidogenic Factor-1 Ligand Bind | 2e-17 | ||
| 2ebl_A | 89 | Solution Structure Of The Zinc Finger, C4-type Doma | 3e-17 | ||
| 3f7d_A | 244 | Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 | 1e-16 | ||
| 3d24_A | 253 | Crystal Structure Of Ligand-Binding Domain Of Estro | 1e-15 | ||
| 3k6p_A | 248 | Estrogen Related Receptor Alpha In Complex With An | 1e-15 | ||
| 1xb7_A | 247 | X-Ray Structure Of Erralpha Lbd In Complex With A P | 1e-15 | ||
| 3n00_A | 245 | Crystal Structure Of A Deletion Mutant Of Human Rev | 3e-15 | ||
| 1dsz_A | 86 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 4e-15 | ||
| 2a66_A | 113 | Human Liver Receptor Homologue Dna-Binding Domain ( | 1e-14 | ||
| 2xhs_A | 245 | Crystal Structure Of The Ligand Binding Domain Of F | 1e-14 | ||
| 2pjl_A | 247 | Crystal Structure Of Human Estrogen-Related Recepto | 2e-14 | ||
| 1exa_A | 246 | Enantiomer Discrimination Illustrated By Crystal St | 6e-14 | ||
| 2ff0_A | 102 | Solution Structure Of Steroidogenic Factor 1 Dna Bi | 6e-14 | ||
| 1fcx_A | 235 | Isotype Selectivity Of The Human Retinoic Acid Nucl | 6e-14 | ||
| 2lbd_A | 267 | Ligand-Binding Domain Of The Human Retinoic Acid Re | 6e-14 | ||
| 1fcy_A | 236 | Isotype Selectivity Of The Human Retinoic Acid Nucl | 6e-14 | ||
| 3m9e_A | 105 | Thyroid Hormone Beta Dna Binding Domain Homodimer W | 9e-14 | ||
| 1r0n_B | 109 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 1e-13 | ||
| 2acl_B | 244 | Liver X-Receptor Alpha Ligand Binding Domain With S | 1e-13 | ||
| 3fc6_B | 266 | Hrxralpha & Mlxralpha With An Indole Pharmacophore, | 1e-13 | ||
| 2han_B | 119 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 2e-13 | ||
| 1hra_A | 80 | The Solution Structure Of The Human Retinoic Acid R | 2e-13 | ||
| 1qkn_A | 255 | Rat Oestrogen Receptor Beta Ligand-Binding Domain I | 2e-13 | ||
| 2j7x_A | 255 | Structure Of Estradiol-bound Estrogen Receptor Beta | 2e-13 | ||
| 2fsz_A | 246 | A Second Binding Site For Hydroxytamoxifen Within T | 2e-13 | ||
| 1p8d_A | 250 | X-Ray Crystal Structure Of Lxr Ligand Binding Domai | 2e-13 | ||
| 1pq6_A | 253 | Human Lxr Beta Hormone Receptor / Gw3965 Complex Le | 2e-13 | ||
| 1upv_A | 257 | Crystal Structure Of The Human Liver X Receptor Bet | 2e-13 | ||
| 1nav_A | 263 | Thyroid Receptor Alpha In Complex With An Agonist S | 3e-13 | ||
| 4dk8_A | 247 | Crystal Structure Of Lxr Ligand Binding Domain In C | 3e-13 | ||
| 2h77_A | 269 | Crystal Structure Of Human Tr Alpha Bound T3 In Mon | 4e-13 | ||
| 3hzf_A | 269 | Structure Of Tr-alfa Bound To Selective Thyromimeti | 4e-13 | ||
| 2h79_A | 269 | Crystal Structure Of Human Tr Alpha Bound T3 In Ort | 4e-13 | ||
| 3jzb_A | 267 | Crystal Structure Of Tr-Alfa Bound To The Selective | 4e-13 | ||
| 3cqv_A | 199 | Crystal Structure Of Reverb Beta In Complex With He | 5e-13 | ||
| 1cit_A | 89 | Dna-Binding Mechanism Of The Monomeric Orphan Nucle | 5e-13 | ||
| 1yy4_A | 268 | Crystal Structure Of Estrogen Receptor Beta Complex | 5e-13 | ||
| 2v0v_A | 194 | Crystal Structure Of Rev-Erb Beta Length = 194 | 5e-13 | ||
| 1hlz_A | 94 | Crystal Structure Of The Orphan Nuclear Receptor Re | 5e-13 | ||
| 2v7c_A | 194 | Crystal Structure Of Rev-Erb Beta Length = 194 | 6e-13 | ||
| 2yat_A | 252 | Crystal Structure Of Estradiol Derived Metal Chelat | 6e-13 | ||
| 1uom_A | 254 | The Structure Of Estrogen Receptor In Complex With | 6e-13 | ||
| 1qkt_A | 248 | Mutant Estrogen Nuclear Receptor Ligand Binding Dom | 7e-13 | ||
| 1pcg_A | 244 | Helix-Stabilized Cyclic Peptides As Selective Inhib | 7e-13 | ||
| 3ltx_A | 243 | Crystal Structure Of The Pacific Oyster Estrogen Re | 7e-13 | ||
| 1l2j_A | 271 | Human Estrogen Receptor Beta Ligand-Binding Domain | 7e-13 | ||
| 2i0g_A | 257 | Benzopyrans Are Selective Estrogen Receptor Beta Ag | 8e-13 | ||
| 2ocf_A | 298 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 8e-13 | ||
| 1qkm_A | 255 | Human Oestrogen Receptor Beta Ligand-Binding Domain | 8e-13 | ||
| 2nll_B | 103 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 9e-13 | ||
| 2jfa_B | 252 | Estrogen Receptor Alpha Lbd In Complex With An Affi | 9e-13 | ||
| 1nde_A | 255 | Estrogen Receptor Beta With Selective Triazine Modu | 9e-13 | ||
| 1u9e_A | 241 | Crystal Structure Of Estrogen Receptor Beta Complex | 9e-13 | ||
| 1x76_A | 240 | Crystal Structure Of Estrogen Receptor Beta Complex | 9e-13 | ||
| 2nv7_A | 238 | Crystal Structure Of Estrogen Receptor Beta Complex | 1e-12 | ||
| 1l2i_A | 261 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 1e-12 | ||
| 2giu_A | 241 | Human Estrogen Receptor Beta Ligand-Binding Domain | 1e-12 | ||
| 3q95_B | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 1e-12 | ||
| 3uu7_A | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 1e-12 | ||
| 3l0e_A | 253 | X-Ray Crystal Structure Of A Potent Liver X Recepto | 1e-12 | ||
| 2yly_A | 240 | Sulfonamides As Selective Estrogen Receptor Beta Ag | 1e-12 | ||
| 3q97_A | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 1e-12 | ||
| 3oll_A | 240 | Crystal Structure Of Phosphorylated Estrogen Recept | 1e-12 | ||
| 1zky_A | 257 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 1e-12 | ||
| 3uvv_A | 265 | Crystal Structure Of The Ligand Binding Domains Of | 1e-12 | ||
| 3uu7_B | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 1e-12 | ||
| 3hm1_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 1e-12 | ||
| 1zaf_A | 238 | Crystal Structure Of Estrogen Receptor Beta Complex | 1e-12 | ||
| 2bj4_A | 252 | Estrogen Receptor Alpha Lbd In Complex With A Phage | 1e-12 | ||
| 3hlv_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 2e-12 | ||
| 3dt3_A | 255 | Human Estrogen Receptor Alpha Lbd With Gw368 Length | 2e-12 | ||
| 1gwq_A | 248 | Human Oestrogen Receptor Alpha Ligand-Binding Domai | 2e-12 | ||
| 1g50_A | 247 | Crystal Structure Of A Wild Type Her Alpha Lbd At 2 | 2e-12 | ||
| 3q95_A | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 2e-12 | ||
| 2qa8_B | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 2e-12 | ||
| 3erd_A | 261 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 2e-12 | ||
| 3uua_A | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 2e-12 | ||
| 2p15_A | 258 | Crystal Structure Of The Er Alpha Ligand Binding Do | 2e-12 | ||
| 2qxs_A | 258 | Crystal Structure Of Antagonizing Mutant 536s Of Th | 2e-12 | ||
| 1ere_A | 253 | Human Estrogen Receptor Ligand-Binding Domain In Co | 2e-12 | ||
| 1sj0_A | 248 | Human Estrogen Receptor Alpha Ligand-binding Domain | 2e-12 | ||
| 2iok_A | 254 | Human Estrogen Receptor Alpha Ligand-binding Domain | 2e-12 | ||
| 2iog_A | 246 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 2e-12 | ||
| 1err_A | 253 | Human Estrogen Receptor Ligand-Binding Domain In Co | 2e-12 | ||
| 3uuc_A | 251 | Crystal Structure Of Hera-Lbd (Wt) In Complex With | 2e-12 | ||
| 2qa8_A | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 2e-12 | ||
| 1gwr_A | 245 | Human Oestrogen Receptor Alpha Ligand-Binding Domai | 2e-12 | ||
| 3l03_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 2e-12 | ||
| 1qku_A | 250 | Wild Type Estrogen Nuclear Receptor Ligand Binding | 2e-12 | ||
| 2qzo_B | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 2e-12 | ||
| 4dma_A | 247 | Crystal Structure Of Era Lbd In Complex With Ru1001 | 2e-12 | ||
| 3uua_B | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 2e-12 | ||
| 1a52_A | 258 | Estrogen Receptor Alpha Ligand-Binding Domain Compl | 3e-12 | ||
| 1x7e_A | 245 | Crystal Structure Of Estrogen Receptor Alpha Comple | 3e-12 | ||
| 3os8_A | 258 | Estrogen Receptor Length = 258 | 6e-12 | ||
| 1lo1_A | 98 | Estrogen Related Receptor 2 Dna Binding Domain In C | 1e-11 | ||
| 3os8_C | 258 | Estrogen Receptor Length = 258 | 1e-11 | ||
| 2env_A | 88 | Solution Sturcture Of The C4-Type Zinc Finger Domai | 1e-11 | ||
| 1uhl_B | 242 | Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero | 1e-11 | ||
| 1ovl_A | 271 | Crystal Structure Of Nurr1 Lbd Length = 271 | 1e-11 | ||
| 1ovl_B | 271 | Crystal Structure Of Nurr1 Lbd Length = 271 | 1e-11 | ||
| 3ipq_A | 283 | X-Ray Structure Of Gw3965 Synthetic Agonist Bound T | 1e-11 | ||
| 1zdt_A | 241 | The Crystal Structure Of Human Steroidogenic Factor | 2e-11 | ||
| 1hcq_A | 84 | The Crystal Structure Of The Estrogen Receptor Dna- | 2e-11 | ||
| 1i7i_A | 292 | Crystal Structure Of The Ligand Binding Domain Of H | 2e-11 | ||
| 1nyx_A | 276 | Ligand Binding Domain Of The Human Peroxisome Proli | 2e-11 | ||
| 3s9s_A | 284 | Ligand Binding Domain Of Ppargamma Complexed With A | 2e-11 | ||
| 2om9_A | 278 | Ajulemic Acid, A Synthetic Cannabinoid Bound To Ppa | 2e-11 | ||
| 4dk7_A | 247 | Crystal Structure Of Lxr Ligand Binding Domain In C | 2e-11 | ||
| 2i4j_A | 286 | Crystal Structure Of The Complex Between Ppargamma | 2e-11 | ||
| 2vsr_A | 276 | Hppargamma Ligand Binding Domain In Complex With 9- | 2e-11 | ||
| 1rdt_D | 284 | Crystal Structure Of A New Rexinoid Bound To The Rx | 2e-11 | ||
| 3osi_A | 285 | Crystal Structure Of Ppargamma Ligand Binding Domai | 2e-11 | ||
| 3ads_A | 287 | Human Ppargamma Ligand-Binding Domain In Complex Wi | 2e-11 | ||
| 3lmp_A | 283 | Crystal Structure Of The Ppargamma-Lbd Complexed Wi | 2e-11 | ||
| 1yow_A | 242 | Human Steroidogenic Factor 1 Lbd With Bound Co-Fact | 2e-11 | ||
| 1k74_D | 283 | The 2.3 Angstrom Resolution Crystal Structure Of Th | 2e-11 | ||
| 1wm0_X | 292 | Ppargamma In Complex With A 2-Baba Compound Length | 2e-11 | ||
| 3vn2_A | 285 | Crystal Structure Of Ppargamma Complexed With Telmi | 2e-11 | ||
| 1zeo_A | 277 | Crystal Structure Of Human Ppar-Gamma Ligand Bindin | 2e-11 | ||
| 3bc5_A | 296 | X-Ray Crystal Structure Of Human Ppar Gamma With 2- | 2e-11 | ||
| 2vv1_B | 276 | Hppargamma Ligand Binding Domain In Complex With 4- | 2e-11 | ||
| 3b0q_A | 274 | Human Ppar Gamma Ligand Binding Domain In Complex W | 2e-11 | ||
| 3cs8_A | 275 | Structural And Biochemical Basis For The Binding Se | 2e-11 | ||
| 2q59_B | 274 | Crystal Structure Of Ppargamma Lbd Bound To Full Ag | 2e-11 | ||
| 3pba_A | 286 | Crystal Structure Of Ppargamma Ligand Binding Domai | 2e-11 | ||
| 3et3_A | 292 | Structure Of Ppargamma With 3-[5-Methoxy-1-(4-Metho | 2e-11 | ||
| 3r8a_A | 282 | X-Ray Crystal Structure Of The Nuclear Hormone Rece | 2e-11 | ||
| 2vv4_B | 276 | Hppargamma Ligand Binding Domain In Complex With 6- | 2e-11 | ||
| 4prg_A | 270 | 0072 Partial Agonist Ppar Gamma Cocrystal Length = | 2e-11 | ||
| 3prg_A | 278 | Ligand Binding Domain Of Human Peroxisome Prolifera | 2e-11 | ||
| 2zvt_A | 286 | Cys285ser Mutant Ppargamma Ligand-Binding Domain Co | 2e-11 | ||
| 1fm6_D | 272 | The 2.1 Angstrom Resolution Crystal Structure Of Th | 2e-11 | ||
| 3cwd_A | 270 | Molecular Recognition Of Nitro-Fatty Acids By Ppar | 2e-11 | ||
| 2prg_A | 271 | Ligand-Binding Domain Of The Human Peroxisome Proli | 2e-11 | ||
| 2hfp_A | 282 | Crystal Structure Of Ppar Gamma With N-Sulfonyl-2-I | 2e-11 | ||
| 1knu_A | 274 | Ligand Binding Domain Of The Human Peroxisome Proli | 2e-11 | ||
| 3t03_A | 284 | Crystal Structure Of Ppar Gamma Ligand Binding Doma | 2e-11 | ||
| 3u9q_A | 269 | Ligand Binding Domain Of Ppargamma Complexed With D | 2e-11 | ||
| 2q59_A | 274 | Crystal Structure Of Ppargamma Lbd Bound To Full Ag | 3e-11 | ||
| 3et0_A | 292 | Structure Of Ppargamma With 3-(5-Methoxy-1h-Indol-3 | 3e-11 | ||
| 4aa6_E | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 9e-11 | ||
| 4aa6_A | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 9e-11 | ||
| 2j4a_A | 253 | Human Thyroid Hormone Receptor Beta Ligand Binding | 9e-11 | ||
| 1hcp_A | 76 | Dna Recognition By The Oestrogen Receptor: From Sol | 9e-11 | ||
| 3hc6_A | 232 | Fxr With Src1 And Gsk088 Length = 232 | 1e-10 | ||
| 3gd2_A | 229 | Isoxazole Ligand Bound To Farnesoid X Receptor (Fxr | 1e-10 | ||
| 1lat_A | 82 | Glucocorticoid Receptor MutantDNA COMPLEX Length = | 1e-10 | ||
| 2b50_A | 272 | Human Nuclear Receptor-Ligand Complex 2 Length = 27 | 1e-10 | ||
| 3p88_A | 229 | Fxr Bound To Isoquinolinecarboxylic Acid Length = 2 | 1e-10 | ||
| 2q5g_A | 283 | Ligand Binding Domain Of Ppar Delta Receptor In Com | 2e-10 | ||
| 2awh_A | 268 | Human Nuclear Receptor-Ligand Complex 1 Length = 26 | 2e-10 | ||
| 3p89_A | 229 | Fxr Bound To A Quinolinecarboxylic Acid Length = 22 | 2e-10 | ||
| 3et2_A | 287 | Structure Of Ppardelta With 3-[5-Methoxy-1-(4-Metho | 2e-10 | ||
| 2j14_A | 285 | 3,4,5-Trisubstituted Isoxazoles As Novel Ppardelta | 2e-10 | ||
| 1osv_A | 230 | Structural Basis For Bile Acid Binding And Activati | 2e-10 | ||
| 2gwx_A | 267 | Molecular Recognition Of Fatty Acids By Peroxisome | 2e-10 | ||
| 1nuo_A | 261 | Two Rth Mutants With Impaired Hormone Binding Lengt | 2e-10 | ||
| 1ot7_A | 229 | Structural Basis For 3-Deoxy-Cdca Binding And Activ | 2e-10 | ||
| 3sp9_A | 281 | Structural Basis For Iloprost As A Dual PparalphaDE | 2e-10 | ||
| 2xyj_A | 288 | Novel Sulfonylthiadiazoles With An Unusual Binding | 2e-10 | ||
| 2znp_A | 276 | Human Pprr Delta Ligand Binding Domain In Complex W | 2e-10 | ||
| 1y0s_A | 272 | Crystal Structure Of Ppar Delta Complexed With Gw23 | 2e-10 | ||
| 1gwx_A | 271 | Molecular Recognition Of Fatty Acids By Peroxisome | 2e-10 | ||
| 3dct_A | 235 | Fxr With Src1 And Gw4064 Length = 235 | 2e-10 | ||
| 1q4x_A | 253 | Crystal Structure Of Human Thyroid Hormone Receptor | 2e-10 | ||
| 1r6g_A | 259 | Crystal Structure Of The Thyroid Hormone Receptor B | 2e-10 | ||
| 3fxv_A | 233 | Identification Of An N-Oxide Pyridine Gw4064 Analog | 2e-10 | ||
| 1bsx_A | 260 | Structure And Specificity Of Nuclear Receptor-Coact | 2e-10 | ||
| 1xzx_X | 281 | Thyroxine-Thyroid Hormone Receptor Interactions Len | 2e-10 | ||
| 3tkm_A | 275 | Crystal Structure Ppar Delta Binding Gw0742 Length | 2e-10 | ||
| 3bej_A | 238 | Structure Of Human Fxr In Complex With Mfa-1 And Co | 2e-10 | ||
| 3g9p_B | 90 | Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 | 2e-10 | ||
| 1nq0_A | 263 | Tr Receptor Mutations Conferring Hormone Resistance | 2e-10 | ||
| 1nax_A | 252 | Thyroid Receptor Beta1 In Complex With A Beta-Selec | 2e-10 | ||
| 1n46_A | 258 | Crystal Structure Of Human Tr Beta Ligand-Binding D | 2e-10 | ||
| 1nq1_A | 263 | Tr Receptor Mutations Conferring Hormone Resistance | 2e-10 | ||
| 3l1b_A | 233 | Complex Structure Of Fxr Ligand-Binding Domain With | 3e-10 | ||
| 1osh_A | 232 | A Chemical, Genetic, And Structural Analysis Of The | 3e-10 | ||
| 3fli_A | 231 | Discovery Of Xl335, A Highly Potent, Selective And | 3e-10 | ||
| 3hc5_A | 232 | Fxr With Src1 And Gsk826 Length = 232 | 3e-10 | ||
| 1nq2_A | 264 | Two Rth Mutants With Impaired Hormone Binding Lengt | 3e-10 | ||
| 3jzc_A | 263 | Crystal Structure Of Tr-Beta Bound To The Selective | 3e-10 | ||
| 3imy_A | 261 | Structure Of Tr-Beta Bound To Selective Thyromimeti | 3e-10 | ||
| 3gws_X | 259 | Crystal Structure Of T3-Bound Thyroid Hormone Recep | 3e-10 | ||
| 3rut_A | 229 | Fxr With Src1 And Gsk359 Length = 229 | 3e-10 | ||
| 3d57_A | 266 | Tr Variant D355r Length = 266 | 3e-10 | ||
| 2pin_A | 253 | Thyroid Receptor Beta In Complex With Inhibitor Len | 4e-10 | ||
| 1ynw_A | 110 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 8e-10 | ||
| 3gz9_A | 269 | Crystal Structure Of Peroxisome Proliferator-Activa | 1e-09 | ||
| 4hn6_A | 114 | Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl | 1e-09 | ||
| 2nxx_E | 248 | Crystal Structure Of The Ligand-Binding Domains Of | 2e-09 | ||
| 3g6t_A | 91 | Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L | 2e-09 | ||
| 1kb2_A | 110 | Crystal Structure Of Vdr Dna-Binding Domain Bound T | 3e-09 | ||
| 1z5x_E | 310 | Hemipteran Ecdysone Receptor Ligand-Binding Domain | 3e-09 | ||
| 1gdc_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 3e-09 | ||
| 2gda_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 4e-09 | ||
| 1r4o_A | 92 | Crystallographic Analysis Of The Interaction Of The | 4e-09 | ||
| 1r4r_B | 92 | Crystallographic Analysis Of The Interaction Of The | 4e-09 | ||
| 1yje_A | 264 | Crystal Structure Of The Rngfi-B Ligand-Binding Dom | 5e-09 | ||
| 3v3e_B | 257 | Crystal Structure Of The Human Nur77 Ligand-Binding | 5e-09 | ||
| 2qw4_A | 273 | Human Nr4a1 Ligand-Binding Domain Length = 273 | 6e-09 | ||
| 2c7a_A | 78 | Structure Of The Progesterone Receptor-Dna Complex | 1e-08 | ||
| 1rgd_A | 71 | Structure Refinement Of The Glucocorticoid Receptor | 1e-08 | ||
| 4hn5_A | 117 | Gr Dna Binding Domain - Tslp Ngre Complex Length = | 1e-08 | ||
| 1glu_A | 81 | Crystallographic Analysis Of The Interaction Of The | 1e-08 | ||
| 1r20_D | 265 | Crystal Structure Of The Ligand-Binding Domains Of | 2e-08 | ||
| 3vhu_A | 294 | Mineralocorticoid Receptor Ligand-Binding Domain Wi | 4e-08 | ||
| 3vhv_A | 260 | Mineralocorticoid Receptor Ligand-Binding Domain Wi | 4e-08 | ||
| 2aa6_A | 275 | Mineralocorticoid Receptor S810l Mutant With Bound | 4e-08 | ||
| 1i7g_A | 287 | Crystal Structure Of The Ligand Binding Domain From | 7e-08 | ||
| 1r1k_D | 266 | Crystal Structure Of The Ligand-Binding Domains Of | 7e-08 | ||
| 2znn_A | 273 | Human Pprr Alpha Ligand Binding Domain In Complex W | 8e-08 | ||
| 2rew_A | 277 | Crystal Structure Of Pparalpha Ligand Binding Domai | 8e-08 | ||
| 1r4i_A | 105 | Crystal Structure Of Androgen Receptor Dna-Binding | 8e-08 | ||
| 3sp6_A | 285 | Structural Basis For Iloprost As A Dual PparalphaDE | 9e-08 | ||
| 3et1_A | 291 | Structure Of Pparalpha With 3-[5-Methoxy-1-(4-Metho | 9e-08 | ||
| 1k7l_A | 288 | The 2.5 Angstrom Resolution Crystal Structure Of Th | 9e-08 | ||
| 2p54_A | 267 | A Crystal Structure Of Ppar Alpha Bound With Src1 P | 9e-08 | ||
| 2npa_A | 270 | The Crystal Structure Of The Human Pparaplpha Ligan | 9e-08 | ||
| 3g8i_A | 270 | Aleglitazar, A New, Potent, And Balanced Ppar Alpha | 1e-07 | ||
| 1kkq_A | 269 | Crystal Structure Of The Human Ppar-Alpha Ligand-Bi | 1e-07 | ||
| 1n4h_A | 259 | Characterization Of Ligands For The Orphan Nuclear | 1e-07 | ||
| 2hbh_A | 302 | Crystal Structure Of Vitamin D Nuclear Receptor Lig | 1e-07 | ||
| 1y9r_A | 255 | Crystal Structure Of The Human Mineralocorticoid Re | 1e-07 | ||
| 2oax_A | 256 | Crystal Structure Of The S810l Mutant Mineralocorti | 1e-07 | ||
| 1ilg_A | 316 | Crystal Structure Of Apo Human Pregnane X Receptor | 2e-07 | ||
| 4fhh_A | 300 | Development Of Synthetically Accessible Non-Secoste | 2e-07 | ||
| 1k4w_A | 252 | X-Ray Structure Of The Orphan Nuclear Receptor Ror | 2e-07 | ||
| 1skx_A | 313 | Structural Disorder In The Complex Of Human Pxr And | 2e-07 | ||
| 1nq7_A | 244 | Characterization Of Ligands For The Orphan Nuclear | 2e-07 | ||
| 3ctb_A | 344 | Tethered Pxr-LbdSRC-1p Apoprotein Length = 344 | 2e-07 | ||
| 3mno_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 2e-07 | ||
| 2o9i_A | 293 | Crystal Structure Of The Human Pregnane X Receptor | 3e-07 | ||
| 3e7c_A | 257 | Glucocorticoid Receptor Lbd Bound To Gsk866 Length | 3e-07 | ||
| 3cld_A | 259 | Ligand Binding Domain Of The Glucocorticoid Recepto | 3e-07 | ||
| 1xv9_B | 246 | Crystal Structure Of CarRXR HETERODIMER BOUND WITH | 3e-07 | ||
| 2aa2_A | 275 | Mineralocorticoid Receptor With Bound Aldosterone L | 3e-07 | ||
| 2a3i_A | 253 | Structural And Biochemical Mechanisms For The Speci | 3e-07 | ||
| 3mnp_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 4e-07 | ||
| 3f5c_B | 268 | Structure Of Dax-1:lrh-1 Complex Length = 268 | 4e-07 | ||
| 3mne_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 6e-07 | ||
| 1i38_A | 260 | Crystal Structure Of The Rat Androgen Receptor Liga | 7e-07 | ||
| 1i37_A | 260 | Crystal Structure Of The Rat Androgen Receptor Liga | 7e-07 | ||
| 3g8o_A | 263 | Progesterone Receptor With Bound Pyrrolidine 1 Leng | 7e-07 | ||
| 1e3k_A | 258 | Human Progesteron Receptor Ligand Binding Domain In | 7e-07 | ||
| 1sr7_A | 259 | Progesterone Receptor Hormone Binding Domain With B | 8e-07 | ||
| 2q7k_A | 257 | The Androgen Receptor Prostate Cancer Mutant H874y | 8e-07 | ||
| 1a28_A | 256 | Hormone-Bound Human Progesterone Receptor Ligand-Bi | 8e-07 | ||
| 2ax6_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 8e-07 | ||
| 1xj7_A | 257 | Complex Androgen Receptor Lbd And Rac3 Peptide Leng | 8e-07 | ||
| 1t73_A | 269 | Crystal Structure Of The Androgen Receptor Ligand B | 8e-07 | ||
| 3h52_A | 254 | Crystal Structure Of The Antagonist Form Of Human G | 8e-07 | ||
| 2am9_A | 266 | Crystal Structure Of Human Androgen Receptor Ligand | 8e-07 | ||
| 1t5z_A | 251 | Crystal Structure Of The Androgen Receptor Ligand B | 8e-07 | ||
| 2ax9_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 8e-07 | ||
| 1e3g_A | 263 | Human Androgen Receptor Ligand Binding In Complex W | 8e-07 | ||
| 1pdu_A | 244 | Ligand-Binding Domain Of Drosophila Orphan Nuclear | 9e-07 | ||
| 2w8y_A | 260 | Ru486 Bound To The Progesterone Receptor In A Desta | 9e-07 | ||
| 2hvc_A | 250 | The Crystal Structure Of Ligand-Binding Domain (Lbd | 9e-07 | ||
| 1sqn_A | 261 | Progesterone Receptor Ligand Binding Domain With Bo | 9e-07 | ||
| 1nhz_A | 280 | Crystal Structure Of The Antagonist Form Of Glucoco | 9e-07 | ||
| 2abi_A | 256 | Crystal Structure Of The Human Mineralocorticoid Re | 9e-07 | ||
| 3a2i_A | 263 | Crystal Structure Of The Human Vitamin D Receptor ( | 1e-06 | ||
| 3a2j_A | 263 | Crystal Structure Of The Human Vitamin D Receptor ( | 1e-06 | ||
| 3kba_A | 253 | Progesterone Receptor Bound To Sulfonamide Pyrrolid | 1e-06 | ||
| 1gs4_A | 248 | Structural Basis For The Glucocorticoid Response In | 1e-06 | ||
| 2z4j_A | 248 | Crystal Structure Of Ar Lbd With Shp Peptide Nr Box | 1e-06 | ||
| 3rlj_A | 247 | Crystal Structure Of The Androgen Receptor Ligand B | 1e-06 | ||
| 2oz7_A | 249 | Crystal Structure Of The Human Androgen Receptor T8 | 1e-06 | ||
| 1xow_A | 249 | Crystal Structure Of The Human Androgen Receptor Li | 1e-06 | ||
| 3rll_A | 247 | Crystal Structure Of The T877a Androgen Receptor Li | 1e-06 | ||
| 3l3x_A | 250 | Crystal Structure Of Dht-Bound Androgen Receptor In | 1e-06 | ||
| 1n83_A | 270 | Crystal Structure Of The Complex Between The Orphan | 1e-06 | ||
| 3bqd_A | 255 | Doubling The Size Of The Glucocorticoid Receptor Li | 1e-06 | ||
| 1m2z_A | 257 | Crystal Structure Of A Dimer Complex Of The Human G | 2e-06 | ||
| 3m7r_A | 253 | Crystal Structure Of Vdr H305q Mutant Length = 253 | 2e-06 | ||
| 2zl9_A | 271 | 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26 | 2e-06 | ||
| 1db1_A | 259 | Crystal Structure Of The Nuclear Receptor For Vitam | 2e-06 | ||
| 4e2j_A | 250 | X-Ray Crystal Structure Of The Ancestral Glucocorti | 2e-06 | ||
| 1s0z_A | 263 | Crystal Structure Of The Vdr Lbd Complexed To Seoca | 2e-06 | ||
| 3gn8_A | 249 | X-Ray Crystal Structure Of Ancgr2 In Complex With D | 2e-06 | ||
| 3p8x_A | 280 | Synthesis, Structure, And Biological Activity Of De | 2e-06 | ||
| 2zfx_A | 265 | Crystal Structure Of The Rat Vitamin D Receptor Lig | 3e-06 | ||
| 1rjk_A | 292 | Crystal Structure Of The Rat Vitamin D Receptor Lig | 3e-06 | ||
| 3b0t_A | 254 | Human Vdr Ligand Binding Domain In Complex With Max | 3e-06 | ||
| 3az1_A | 253 | Crystal Structure Analysis Of Vitamin D Receptor Le | 3e-06 | ||
| 4fne_A | 254 | X-Ray Crystal Structure Of The Ancestral 3-Keto Ste | 5e-06 | ||
| 2q3y_A | 249 | Ancestral Corticiod Receptor In Complex With Doc Le | 8e-06 | ||
| 1xnx_A | 256 | Crystal Structure Of Constitutive Androstane Recept | 9e-06 | ||
| 2q1h_A | 250 | Ancestral Corticoid Receptor In Complex With Aldost | 9e-06 | ||
| 1xls_E | 242 | Crystal Structure Of The Mouse CarRXR LBD HETERODIM | 1e-05 | ||
| 3ry9_A | 250 | Crystal Structure Of The Resurrected Ancestral Gluc | 2e-05 | ||
| 2ax8_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 4e-05 | ||
| 1z95_A | 246 | Crystal Structure Of The Androgen Receptor Ligand-B | 5e-05 |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
|
| >pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 | Back alignment and structure |
| >pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 | Back alignment and structure |
| >pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 | Back alignment and structure |
| >pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 | Back alignment and structure |
| >pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 | Back alignment and structure |
| >pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 | Back alignment and structure |
| >pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 | Back alignment and structure |
| >pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 | Back alignment and structure |
| >pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 | Back alignment and structure |
| >pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 | Back alignment and structure |
| >pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 | Back alignment and structure |
| >pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 | Back alignment and structure |
| >pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 | Back alignment and structure |
| >pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 | Back alignment and structure |
| >pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 | Back alignment and structure |
| >pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 | Back alignment and structure |
| >pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 | Back alignment and structure |
| >pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 | Back alignment and structure |
| >pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 | Back alignment and structure |
| >pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 | Back alignment and structure |
| >pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 | Back alignment and structure |
| >pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 | Back alignment and structure |
| >pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 | Back alignment and structure |
| >pdb|1HG4|A Chain A, Ultraspiracle Ligand Binding Domain From Drosophila Melanogaster Length = 279 | Back alignment and structure |
| >pdb|1G2N|A Chain A, Crystal Structure Of The Ligand Binding Domain Of The Ultraspiracle Protein Usp, The Ortholog Of Rxrs In Insects Length = 264 | Back alignment and structure |
| >pdb|1R1K|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 263 | Back alignment and structure |
| >pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 | Back alignment and structure |
| >pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 | Back alignment and structure |
| >pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 | Back alignment and structure |
| >pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 | Back alignment and structure |
| >pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 | Back alignment and structure |
| >pdb|1LV2|A Chain A, Hepatocyte Nuclear Factor 4 Is A Transcription Factor That Constitutively Binds Fatty Acids Length = 229 | Back alignment and structure |
| >pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 | Back alignment and structure |
| >pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 | Back alignment and structure |
| >pdb|1M7W|A Chain A, Hnf4a Ligand Binding Domain With Bound Fatty Acid Length = 250 | Back alignment and structure |
| >pdb|3FS1|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Pgc-1a Fragment Length = 230 | Back alignment and structure |
| >pdb|1PZL|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Src-1 Peptide Length = 237 | Back alignment and structure |
| >pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 | Back alignment and structure |
| >pdb|4DOS|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Dlpc And A Fragment Of Tif-2 Length = 242 | Back alignment and structure |
| >pdb|1YUC|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Phospholipid And A Fragment Of Human Shp Length = 255 | Back alignment and structure |
| >pdb|1VJB|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4- Hydroxytamoxifen Length = 251 | Back alignment and structure |
| >pdb|1S9Q|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4-Hydroxytamoxifen Length = 251 | Back alignment and structure |
| >pdb|1S9P|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With Diethylstilbestrol Length = 227 | Back alignment and structure |
| >pdb|2E2R|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Gamma Ligand Binding Domain Complex With Bisphenol A Length = 244 | Back alignment and structure |
| >pdb|2EWP|A Chain A, Crystal Structure Of Estrogen Related Receptor-3 (Err-Gamma) Ligand Binding Domaind With Tamoxifen Analog Gsk5182 Length = 226 | Back alignment and structure |
| >pdb|1KV6|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Err3 Ligand- Binding Domain In The Constitutively Active Conformation Length = 230 | Back alignment and structure |
| >pdb|1ZDU|A Chain A, The Crystal Structure Of Human Liver Receptor Homologue-1 Length = 245 | Back alignment and structure |
| >pdb|3PLZ|A Chain A, Human Lrh1 Lbd Bound To Gr470 Length = 257 | Back alignment and structure |
| >pdb|1YOK|A Chain A, Crystal Structure Of Human Lrh-1 Bound With Tif-2 Peptide And Phosphatidylglycerol Length = 256 | Back alignment and structure |
| >pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 | Back alignment and structure |
| >pdb|3TX7|B Chain B, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 352 | Back alignment and structure |
| >pdb|1PK5|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Lrh-1 Length = 248 | Back alignment and structure |
| >pdb|1ZH7|A Chain A, Structural And Biochemical Basis For Selective Repression Of The Orphan Nuclear Receptor Lrh-1 By Shp Length = 243 | Back alignment and structure |
| >pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 | Back alignment and structure |
| >pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 | Back alignment and structure |
| >pdb|3A9E|B Chain B, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 269 | Back alignment and structure |
| >pdb|3P0U|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Testicular Receptor 4 Length = 249 | Back alignment and structure |
| >pdb|1DKF|B Chain B, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 235 | Back alignment and structure |
| >pdb|3KMR|A Chain A, Crystal Structure Of Raralpha Ligand Binding Domain In Complex With An Agonist Ligand (Am580) And A Coactivator Fragment Length = 266 | Back alignment and structure |
| >pdb|4DQM|A Chain A, Revealing A Marine Natural Product As A Novel Agonist For Retinoic Acid Receptors With A Unique Binding Mode And Antitumor Activity Length = 234 | Back alignment and structure |
| >pdb|1XDK|B Chain B, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 303 | Back alignment and structure |
| >pdb|1YMT|A Chain A, Mouse Sf-1 Lbd Length = 246 | Back alignment and structure |
| >pdb|1XAP|A Chain A, Structure Of The Ligand Binding Domain Of The Retinoic Acid Receptor Beta Length = 267 | Back alignment and structure |
| >pdb|1YP0|A Chain A, Structure Of The Steroidogenic Factor-1 Ligand Binding Domain Bound To Phospholipid And A Shp Peptide Motif Length = 239 | Back alignment and structure |
| >pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 | Back alignment and structure |
| >pdb|3F7D|A Chain A, Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 | Back alignment and structure |
| >pdb|3D24|A Chain A, Crystal Structure Of Ligand-Binding Domain Of Estrogen- Related Receptor Alpha (Erralpha) In Complex With The Peroxisome Proliferators-Activated Receptor Coactivator- 1alpha Box3 Peptide (Pgc-1alpha) Length = 253 | Back alignment and structure |
| >pdb|3K6P|A Chain A, Estrogen Related Receptor Alpha In Complex With An Ether Based Ligand Length = 248 | Back alignment and structure |
| >pdb|1XB7|A Chain A, X-Ray Structure Of Erralpha Lbd In Complex With A Pgc- 1alpha Peptide At 2.5a Resolution Length = 247 | Back alignment and structure |
| >pdb|3N00|A Chain A, Crystal Structure Of A Deletion Mutant Of Human Reverba Ligand Binding Domain Bound With An Ncor Id1 Peptide Determined To 2.60a Length = 245 | Back alignment and structure |
| >pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 | Back alignment and structure |
| >pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 | Back alignment and structure |
| >pdb|2XHS|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Fushi Tarazu Factor 1 Of Drosophila Melanogaster Length = 245 | Back alignment and structure |
| >pdb|2PJL|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Alpha In Complex With A Synthetic Inverse Agonist Reveals Its Novel Molecular Mechanism Length = 247 | Back alignment and structure |
| >pdb|1EXA|A Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Active R-Enantiomer Bms270394. Length = 246 | Back alignment and structure |
| >pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 | Back alignment and structure |
| >pdb|1FCX|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Bms184394 Length = 235 | Back alignment and structure |
| >pdb|2LBD|A Chain A, Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To All-Trans Retinoic Acid Length = 267 | Back alignment and structure |
| >pdb|1FCY|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The RarbetaGAMMA- Selective Retinoid Cd564 Length = 236 | Back alignment and structure |
| >pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 | Back alignment and structure |
| >pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 | Back alignment and structure |
| >pdb|2ACL|B Chain B, Liver X-Receptor Alpha Ligand Binding Domain With Sb313987 Length = 244 | Back alignment and structure |
| >pdb|3FC6|B Chain B, Hrxralpha & Mlxralpha With An Indole Pharmacophore, Sb786875 Length = 266 | Back alignment and structure |
| >pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 | Back alignment and structure |
| >pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 | Back alignment and structure |
| >pdb|1QKN|A Chain A, Rat Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Antagonist Raloxifene Length = 255 | Back alignment and structure |
| >pdb|2J7X|A Chain A, Structure Of Estradiol-bound Estrogen Receptor Beta Lbd In Complex With Lxxll Motif From Ncoa5 Length = 255 | Back alignment and structure |
| >pdb|2FSZ|A Chain A, A Second Binding Site For Hydroxytamoxifen Within The Coactivator-Binding Groove Of Estrogen Receptor Beta Length = 246 | Back alignment and structure |
| >pdb|1P8D|A Chain A, X-Ray Crystal Structure Of Lxr Ligand Binding Domain With 24(S),25- Epoxycholesterol Length = 250 | Back alignment and structure |
| >pdb|1PQ6|A Chain A, Human Lxr Beta Hormone Receptor / Gw3965 Complex Length = 253 | Back alignment and structure |
| >pdb|1UPV|A Chain A, Crystal Structure Of The Human Liver X Receptor Beta Ligand Binding Domain In Complex With A Synthetic Agonist Length = 257 | Back alignment and structure |
| >pdb|1NAV|A Chain A, Thyroid Receptor Alpha In Complex With An Agonist Selective For Thyroid Receptor Beta1 Length = 263 | Back alignment and structure |
| >pdb|4DK8|A Chain A, Crystal Structure Of Lxr Ligand Binding Domain In Complex With Partial Agonist 5 Length = 247 | Back alignment and structure |
| >pdb|2H77|A Chain A, Crystal Structure Of Human Tr Alpha Bound T3 In Monoclinic Space Group Length = 269 | Back alignment and structure |
| >pdb|3HZF|A Chain A, Structure Of Tr-alfa Bound To Selective Thyromimetic Gc-1 In C2 Space Group Length = 269 | Back alignment and structure |
| >pdb|2H79|A Chain A, Crystal Structure Of Human Tr Alpha Bound T3 In Orthorhombic Space Group Length = 269 | Back alignment and structure |
| >pdb|3JZB|A Chain A, Crystal Structure Of Tr-Alfa Bound To The Selective Thyromimetic Triac Length = 267 | Back alignment and structure |
| >pdb|3CQV|A Chain A, Crystal Structure Of Reverb Beta In Complex With Heme Length = 199 | Back alignment and structure |
| >pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 | Back alignment and structure |
| >pdb|1YY4|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 1-Chloro-6-(4-Hydroxy-Phenyl)-Naphthalen-2-Ol Length = 268 | Back alignment and structure |
| >pdb|2V0V|A Chain A, Crystal Structure Of Rev-Erb Beta Length = 194 | Back alignment and structure |
| >pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 | Back alignment and structure |
| >pdb|2V7C|A Chain A, Crystal Structure Of Rev-Erb Beta Length = 194 | Back alignment and structure |
| >pdb|2YAT|A Chain A, Crystal Structure Of Estradiol Derived Metal Chelate And Estrogen Receptor-Ligand Binding Domain Complex Length = 252 | Back alignment and structure |
| >pdb|1UOM|A Chain A, The Structure Of Estrogen Receptor In Complex With A Selective And Potent Tetrahydroisochiolin Ligand. Length = 254 | Back alignment and structure |
| >pdb|1QKT|A Chain A, Mutant Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 248 | Back alignment and structure |
| >pdb|1PCG|A Chain A, Helix-Stabilized Cyclic Peptides As Selective Inhibitors Of Steroid Receptor-Coactivator Interactions Length = 244 | Back alignment and structure |
| >pdb|3LTX|A Chain A, Crystal Structure Of The Pacific Oyster Estrogen Receptor Ligand Binding Domain Length = 243 | Back alignment and structure |
| >pdb|1L2J|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With (R, R)-5,11-Cis-Diethyl-5,6,11,12-Tetrahydrochrysene-2, 8-Diol Length = 271 | Back alignment and structure |
| >pdb|2I0G|A Chain A, Benzopyrans Are Selective Estrogen Receptor Beta Agonists (Serbas) With Novel Activity In Models Of Benign Prostatic Hyperplasia Length = 257 | Back alignment and structure |
| >pdb|2OCF|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Estradiol And The E2#23 Fn3 Monobody Length = 298 | Back alignment and structure |
| >pdb|1QKM|A Chain A, Human Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Partial Agonist Genistein Length = 255 | Back alignment and structure |
| >pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 | Back alignment and structure |
| >pdb|2JFA|B Chain B, Estrogen Receptor Alpha Lbd In Complex With An Affinity- Selected Corepressor Peptide Length = 252 | Back alignment and structure |
| >pdb|1NDE|A Chain A, Estrogen Receptor Beta With Selective Triazine Modulator Length = 255 | Back alignment and structure |
| >pdb|1U9E|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-397 Length = 241 | Back alignment and structure |
| >pdb|1X76|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-697 Length = 240 | Back alignment and structure |
| >pdb|2NV7|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-555 Length = 238 | Back alignment and structure |
| >pdb|1L2I|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With (R,R)-5,11-Cis-Diethyl-5,6,11,12- Tetrahydrochrysene-2,8-Diol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 | Back alignment and structure |
| >pdb|2GIU|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With Compound 45 Length = 241 | Back alignment and structure |
| >pdb|3Q95|B Chain B, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 | Back alignment and structure |
| >pdb|3UU7|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 | Back alignment and structure |
| >pdb|3L0E|A Chain A, X-Ray Crystal Structure Of A Potent Liver X Receptor Modulator Length = 253 | Back alignment and structure |
| >pdb|2YLY|A Chain A, Sulfonamides As Selective Estrogen Receptor Beta Agonists. Length = 240 | Back alignment and structure |
| >pdb|3Q97|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Two Isomers Of Ethoxy Triphenylethylene Length = 260 | Back alignment and structure |
| >pdb|3OLL|A Chain A, Crystal Structure Of Phosphorylated Estrogen Receptor Beta Ligand Binding Domain Length = 240 | Back alignment and structure |
| >pdb|1ZKY|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Obcp-3m And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 257 | Back alignment and structure |
| >pdb|3UVV|A Chain A, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 265 | Back alignment and structure |
| >pdb|3UU7|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 | Back alignment and structure |
| >pdb|3HM1|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And Estrone ((8r,9s,13s,14s)-3-Hydroxy- 7,8,9,11,12,14,15, 16-Octahydro-6h-Cyclopenta[a]phenanthren- Length = 253 | Back alignment and structure |
| >pdb|1ZAF|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 3-Bromo-6-Hydroxy-2-(4-Hydroxy-Phenyl)-Inden-1-One Length = 238 | Back alignment and structure |
| >pdb|2BJ4|A Chain A, Estrogen Receptor Alpha Lbd In Complex With A Phage-Display Derived Peptide Antagonist Length = 252 | Back alignment and structure |
| >pdb|3HLV|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And 16-Alpha-Hydroxy-Estrone ((8s,9r,13 16r)-3,16-Dihydroxy-13-Methyl-7,8,9,11,12,14,15, 16-Octahyd Cyclopenta[a]phenanthren-17-One Length = 253 | Back alignment and structure |
| >pdb|3DT3|A Chain A, Human Estrogen Receptor Alpha Lbd With Gw368 Length = 255 | Back alignment and structure |
| >pdb|1GWQ|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With Raloxifene Core And Tif2 Nrbox2 Peptide Length = 248 | Back alignment and structure |
| >pdb|1G50|A Chain A, Crystal Structure Of A Wild Type Her Alpha Lbd At 2.9 Angstrom Resolution Length = 247 | Back alignment and structure |
| >pdb|3Q95|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 | Back alignment and structure |
| >pdb|2QA8|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 | Back alignment and structure |
| >pdb|3ERD|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Diethylstilbestrol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 | Back alignment and structure |
| >pdb|3UUA|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 | Back alignment and structure |
| >pdb|2P15|A Chain A, Crystal Structure Of The Er Alpha Ligand Binding Domain With The Agonist Ortho-Trifluoromethylphenylvinyl Estradiol Length = 258 | Back alignment and structure |
| >pdb|2QXS|A Chain A, Crystal Structure Of Antagonizing Mutant 536s Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed To Raloxifene Length = 258 | Back alignment and structure |
| >pdb|1ERE|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With 17beta-Estradiol Length = 253 | Back alignment and structure |
| >pdb|1SJ0|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With The Antagonist Ligand 4-d Length = 248 | Back alignment and structure |
| >pdb|2IOK|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With Compound 1d Length = 254 | Back alignment and structure |
| >pdb|2IOG|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Compound 11f Length = 246 | Back alignment and structure |
| >pdb|1ERR|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With Raloxifene Length = 253 | Back alignment and structure |
| >pdb|3UUC|A Chain A, Crystal Structure Of Hera-Lbd (Wt) In Complex With Bisphenol-C Length = 251 | Back alignment and structure |
| >pdb|2QA8|A Chain A, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 | Back alignment and structure |
| >pdb|1GWR|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With 17beta-Oestradiol And Tif2 Nrbox3 Peptide Length = 245 | Back alignment and structure |
| >pdb|3L03|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide And Estetrol (Estra-1,3,5(10)-Triene-3,15 Alpha, 16alpha,17beta-Tetrol) Length = 253 | Back alignment and structure |
| >pdb|1QKU|A Chain A, Wild Type Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 250 | Back alignment and structure |
| >pdb|2QZO|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed With Way-169916 Length = 258 | Back alignment and structure |
| >pdb|4DMA|A Chain A, Crystal Structure Of Era Lbd In Complex With Ru100132 Length = 247 | Back alignment and structure |
| >pdb|3UUA|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 | Back alignment and structure |
| >pdb|1A52|A Chain A, Estrogen Receptor Alpha Ligand-Binding Domain Complexed To Estradiol Length = 258 | Back alignment and structure |
| >pdb|1X7E|A Chain A, Crystal Structure Of Estrogen Receptor Alpha Complexed With Way-244 Length = 245 | Back alignment and structure |
| >pdb|3OS8|A Chain A, Estrogen Receptor Length = 258 | Back alignment and structure |
| >pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 | Back alignment and structure |
| >pdb|3OS8|C Chain C, Estrogen Receptor Length = 258 | Back alignment and structure |
| >pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 | Back alignment and structure |
| >pdb|1UHL|B Chain B, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 242 | Back alignment and structure |
| >pdb|1OVL|A Chain A, Crystal Structure Of Nurr1 Lbd Length = 271 | Back alignment and structure |
| >pdb|1OVL|B Chain B, Crystal Structure Of Nurr1 Lbd Length = 271 | Back alignment and structure |
| >pdb|3IPQ|A Chain A, X-Ray Structure Of Gw3965 Synthetic Agonist Bound To The Lxr Length = 283 | Back alignment and structure |
| >pdb|1ZDT|A Chain A, The Crystal Structure Of Human Steroidogenic Factor-1 Length = 241 | Back alignment and structure |
| >pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 | Back alignment and structure |
| >pdb|1I7I|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Ppar-Gamma In Complex With The Agonist Az 242 Length = 292 | Back alignment and structure |
| >pdb|1NYX|A Chain A, Ligand Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma In Complex With An Agonist Length = 276 | Back alignment and structure |
| >pdb|3S9S|A Chain A, Ligand Binding Domain Of Ppargamma Complexed With A Benzimidazole Partial Agonist Length = 284 | Back alignment and structure |
| >pdb|2OM9|A Chain A, Ajulemic Acid, A Synthetic Cannabinoid Bound To Ppar Gamma Length = 278 | Back alignment and structure |
| >pdb|4DK7|A Chain A, Crystal Structure Of Lxr Ligand Binding Domain In Complex With Full Agonist 1 Length = 247 | Back alignment and structure |
| >pdb|2I4J|A Chain A, Crystal Structure Of The Complex Between Ppargamma And The Agonist Lt160 (Ureidofibrate Derivative) Length = 286 | Back alignment and structure |
| >pdb|2VSR|A Chain A, Hppargamma Ligand Binding Domain In Complex With 9-(S)-Hode Length = 276 | Back alignment and structure |
| >pdb|1RDT|D Chain D, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 284 | Back alignment and structure |
| >pdb|3OSI|A Chain A, Crystal Structure Of Ppargamma Ligand Binding Domain In Complex With Tetrachloro-Bisphenol A (Tcbpa) Length = 285 | Back alignment and structure |
| >pdb|3ADS|A Chain A, Human Ppargamma Ligand-Binding Domain In Complex With Indomethacin Length = 287 | Back alignment and structure |
| >pdb|3LMP|A Chain A, Crystal Structure Of The Ppargamma-Lbd Complexed With A Cercosporamide Derivative Modulator Length = 283 | Back alignment and structure |
| >pdb|1YOW|A Chain A, Human Steroidogenic Factor 1 Lbd With Bound Co-Factor Peptide Length = 242 | Back alignment and structure |
| >pdb|1K74|D Chain D, The 2.3 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Ppargamma And Rxralpha Ligand Binding Domains Respectively Bound With Gw409544 And 9-Cis Retinoic Acid And Co-Activator Peptides Length = 283 | Back alignment and structure |
| >pdb|1WM0|X Chain X, Ppargamma In Complex With A 2-Baba Compound Length = 292 | Back alignment and structure |
| >pdb|3VN2|A Chain A, Crystal Structure Of Ppargamma Complexed With Telmisartan Length = 285 | Back alignment and structure |
| >pdb|1ZEO|A Chain A, Crystal Structure Of Human Ppar-Gamma Ligand Binding Domain Complexed With An Alpha-Aryloxyphenylacetic Acid Agonist Length = 277 | Back alignment and structure |
| >pdb|3BC5|A Chain A, X-Ray Crystal Structure Of Human Ppar Gamma With 2-(5-(3-(2- (5-Methyl-2-Phenyloxazol-4-Yl)ethoxy)benzyl)-2-Phenyl- 2h-1, 2,3-Triazol-4-Yl)acetic Acid Length = 296 | Back alignment and structure |
| >pdb|2VV1|B Chain B, Hppargamma Ligand Binding Domain In Complex With 4-Hdha Length = 276 | Back alignment and structure |
| >pdb|3B0Q|A Chain A, Human Ppar Gamma Ligand Binding Domain In Complex With Mcc555 Length = 274 | Back alignment and structure |
| >pdb|3CS8|A Chain A, Structural And Biochemical Basis For The Binding Selectivity Of Pparg To Pgc-1a Length = 275 | Back alignment and structure |
| >pdb|2Q59|B Chain B, Crystal Structure Of Ppargamma Lbd Bound To Full Agonist Mrl20 Length = 274 | Back alignment and structure |
| >pdb|3PBA|A Chain A, Crystal Structure Of Ppargamma Ligand Binding Domain In Complex With Monosulfate Tetrabromo-Bisphenol A (Monotbbpa) Length = 286 | Back alignment and structure |
| >pdb|3ET3|A Chain A, Structure Of Ppargamma With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 292 | Back alignment and structure |
| >pdb|3R8A|A Chain A, X-Ray Crystal Structure Of The Nuclear Hormone Receptor Ppar-Gamma In A Complex With A Compound With Dual Ppar Gamma Agonism And Angiotensin Ii Type I Receptor Antagonism Activity Length = 282 | Back alignment and structure |
| >pdb|2VV4|B Chain B, Hppargamma Ligand Binding Domain In Complex With 6-Oxoote Length = 276 | Back alignment and structure |
| >pdb|4PRG|A Chain A, 0072 Partial Agonist Ppar Gamma Cocrystal Length = 270 | Back alignment and structure |
| >pdb|3PRG|A Chain A, Ligand Binding Domain Of Human Peroxisome Proliferator Activated Receptor Length = 278 | Back alignment and structure |
| >pdb|2ZVT|A Chain A, Cys285ser Mutant Ppargamma Ligand-Binding Domain Complexed With 15-Deoxy-Delta12,14-Prostaglandin J2 Length = 286 | Back alignment and structure |
| >pdb|1FM6|D Chain D, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 272 | Back alignment and structure |
| >pdb|3CWD|A Chain A, Molecular Recognition Of Nitro-Fatty Acids By Ppar Gamma Length = 270 | Back alignment and structure |
| >pdb|2PRG|A Chain A, Ligand-Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma Length = 271 | Back alignment and structure |
| >pdb|2HFP|A Chain A, Crystal Structure Of Ppar Gamma With N-Sulfonyl-2-Indole Carboxamide Ligands Length = 282 | Back alignment and structure |
| >pdb|1KNU|A Chain A, Ligand Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma In Complex With A Synthetic Agonist Length = 274 | Back alignment and structure |
| >pdb|3T03|A Chain A, Crystal Structure Of Ppar Gamma Ligand Binding Domain In Complex With A Novel Partial Agonist Gq-16 Length = 284 | Back alignment and structure |
| >pdb|3U9Q|A Chain A, Ligand Binding Domain Of Ppargamma Complexed With Decanoic Acid And Pgc-1a Peptide Length = 269 | Back alignment and structure |
| >pdb|2Q59|A Chain A, Crystal Structure Of Ppargamma Lbd Bound To Full Agonist Mrl20 Length = 274 | Back alignment and structure |
| >pdb|3ET0|A Chain A, Structure Of Ppargamma With 3-(5-Methoxy-1h-Indol-3-Yl)- Propionic Acid Length = 292 | Back alignment and structure |
| >pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|2J4A|A Chain A, Human Thyroid Hormone Receptor Beta Ligand Binding Domain In Complex With Kb131084 Length = 253 | Back alignment and structure |
| >pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 | Back alignment and structure |
| >pdb|3HC6|A Chain A, Fxr With Src1 And Gsk088 Length = 232 | Back alignment and structure |
| >pdb|3GD2|A Chain A, Isoxazole Ligand Bound To Farnesoid X Receptor (Fxr) Length = 229 | Back alignment and structure |
| >pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 | Back alignment and structure |
| >pdb|2B50|A Chain A, Human Nuclear Receptor-Ligand Complex 2 Length = 272 | Back alignment and structure |
| >pdb|3P88|A Chain A, Fxr Bound To Isoquinolinecarboxylic Acid Length = 229 | Back alignment and structure |
| >pdb|2Q5G|A Chain A, Ligand Binding Domain Of Ppar Delta Receptor In Complex With A Partial Agonist Length = 283 | Back alignment and structure |
| >pdb|2AWH|A Chain A, Human Nuclear Receptor-Ligand Complex 1 Length = 268 | Back alignment and structure |
| >pdb|3P89|A Chain A, Fxr Bound To A Quinolinecarboxylic Acid Length = 229 | Back alignment and structure |
| >pdb|3ET2|A Chain A, Structure Of Ppardelta With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 287 | Back alignment and structure |
| >pdb|2J14|A Chain A, 3,4,5-Trisubstituted Isoxazoles As Novel Ppardelta Agonists: Part2 Length = 285 | Back alignment and structure |
| >pdb|1OSV|A Chain A, Structural Basis For Bile Acid Binding And Activation Of The Nuclear Receptor Fxr Length = 230 | Back alignment and structure |
| >pdb|2GWX|A Chain A, Molecular Recognition Of Fatty Acids By Peroxisome Proliferator-Activated Receptors Length = 267 | Back alignment and structure |
| >pdb|1NUO|A Chain A, Two Rth Mutants With Impaired Hormone Binding Length = 261 | Back alignment and structure |
| >pdb|1OT7|A Chain A, Structural Basis For 3-Deoxy-Cdca Binding And Activation Of Fxr Length = 229 | Back alignment and structure |
| >pdb|3SP9|A Chain A, Structural Basis For Iloprost As A Dual PparalphaDELTA AGONIST Length = 281 | Back alignment and structure |
| >pdb|2XYJ|A Chain A, Novel Sulfonylthiadiazoles With An Unusual Binding Mode As Partial Dual Peroxisome Proliferator-Activated Receptor (Ppar) Gamma-Delta Agonists With High Potency And In-Vivo Efficacy Length = 288 | Back alignment and structure |
| >pdb|2ZNP|A Chain A, Human Pprr Delta Ligand Binding Domain In Complex With A Synthetic Agonist Tipp204 Length = 276 | Back alignment and structure |
| >pdb|1Y0S|A Chain A, Crystal Structure Of Ppar Delta Complexed With Gw2331 Length = 272 | Back alignment and structure |
| >pdb|1GWX|A Chain A, Molecular Recognition Of Fatty Acids By Peroxisome Proliferator-Activated Receptors Length = 271 | Back alignment and structure |
| >pdb|3DCT|A Chain A, Fxr With Src1 And Gw4064 Length = 235 | Back alignment and structure |
| >pdb|1Q4X|A Chain A, Crystal Structure Of Human Thyroid Hormone Receptor Beta Lbd In Complex With Specific Agonist Gc-24 Length = 253 | Back alignment and structure |
| >pdb|1R6G|A Chain A, Crystal Structure Of The Thyroid Hormone Receptor Beta Ligand Binding Domain In Complex With A Beta Selective Compound Length = 259 | Back alignment and structure |
| >pdb|3FXV|A Chain A, Identification Of An N-Oxide Pyridine Gw4064 Analogue As A Potent Fxr Agonist Length = 233 | Back alignment and structure |
| >pdb|1BSX|A Chain A, Structure And Specificity Of Nuclear Receptor-Coactivator Interactions Length = 260 | Back alignment and structure |
| >pdb|1XZX|X Chain X, Thyroxine-Thyroid Hormone Receptor Interactions Length = 281 | Back alignment and structure |
| >pdb|3TKM|A Chain A, Crystal Structure Ppar Delta Binding Gw0742 Length = 275 | Back alignment and structure |
| >pdb|3BEJ|A Chain A, Structure Of Human Fxr In Complex With Mfa-1 And Co- Activator Peptide Length = 238 | Back alignment and structure |
| >pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 | Back alignment and structure |
| >pdb|1NQ0|A Chain A, Tr Receptor Mutations Conferring Hormone Resistance And Reduced Corepressor Release Exhibit Decreased Stability In The Nterminal Lbd Length = 263 | Back alignment and structure |
| >pdb|1NAX|A Chain A, Thyroid Receptor Beta1 In Complex With A Beta-Selective Ligand Length = 252 | Back alignment and structure |
| >pdb|1N46|A Chain A, Crystal Structure Of Human Tr Beta Ligand-Binding Domain Complexed With A Potent Subtype-Selective Thyromimetic Length = 258 | Back alignment and structure |
| >pdb|1NQ1|A Chain A, Tr Receptor Mutations Conferring Hormone Resistance And Reduced Corepressor Release Exhibit Decreased Stability In The Nterminal Lbd Length = 263 | Back alignment and structure |
| >pdb|3L1B|A Chain A, Complex Structure Of Fxr Ligand-Binding Domain With A Tetrahydroazepinoindole Compound Length = 233 | Back alignment and structure |
| >pdb|1OSH|A Chain A, A Chemical, Genetic, And Structural Analysis Of The Nuclear Bile Acid Receptor Fxr Length = 232 | Back alignment and structure |
| >pdb|3FLI|A Chain A, Discovery Of Xl335, A Highly Potent, Selective And Orally- Active Agonist Of The Farnesoid X Receptor (Fxr) Length = 231 | Back alignment and structure |
| >pdb|3HC5|A Chain A, Fxr With Src1 And Gsk826 Length = 232 | Back alignment and structure |
| >pdb|1NQ2|A Chain A, Two Rth Mutants With Impaired Hormone Binding Length = 264 | Back alignment and structure |
| >pdb|3JZC|A Chain A, Crystal Structure Of Tr-Beta Bound To The Selective Thyromimetic Triac Length = 263 | Back alignment and structure |
| >pdb|3IMY|A Chain A, Structure Of Tr-Beta Bound To Selective Thyromimetic Gc-1 Length = 261 | Back alignment and structure |
| >pdb|3GWS|X Chain X, Crystal Structure Of T3-Bound Thyroid Hormone Receptor Length = 259 | Back alignment and structure |
| >pdb|3RUT|A Chain A, Fxr With Src1 And Gsk359 Length = 229 | Back alignment and structure |
| >pdb|3D57|A Chain A, Tr Variant D355r Length = 266 | Back alignment and structure |
| >pdb|2PIN|A Chain A, Thyroid Receptor Beta In Complex With Inhibitor Length = 253 | Back alignment and structure |
| >pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 | Back alignment and structure |
| >pdb|3GZ9|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Delta (Ppard) In Complex With A Full Agonist Length = 269 | Back alignment and structure |
| >pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 | Back alignment and structure |
| >pdb|2NXX|E Chain E, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 248 | Back alignment and structure |
| >pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 | Back alignment and structure |
| >pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 | Back alignment and structure |
| >pdb|1Z5X|E Chain E, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 310 | Back alignment and structure |
| >pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1YJE|A Chain A, Crystal Structure Of The Rngfi-B Ligand-Binding Domain Length = 264 | Back alignment and structure |
| >pdb|3V3E|B Chain B, Crystal Structure Of The Human Nur77 Ligand-Binding Domain Length = 257 | Back alignment and structure |
| >pdb|2QW4|A Chain A, Human Nr4a1 Ligand-Binding Domain Length = 273 | Back alignment and structure |
| >pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 | Back alignment and structure |
| >pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 | Back alignment and structure |
| >pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 | Back alignment and structure |
| >pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 | Back alignment and structure |
| >pdb|1R20|D Chain D, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO THE SYNTHETIC AGONIST BYI06830 Length = 265 | Back alignment and structure |
| >pdb|3VHU|A Chain A, Mineralocorticoid Receptor Ligand-Binding Domain With Spironolactone Length = 294 | Back alignment and structure |
| >pdb|3VHV|A Chain A, Mineralocorticoid Receptor Ligand-Binding Domain With Non-Steroidal Antagonist Length = 260 | Back alignment and structure |
| >pdb|2AA6|A Chain A, Mineralocorticoid Receptor S810l Mutant With Bound Progesterone Length = 275 | Back alignment and structure |
| >pdb|1I7G|A Chain A, Crystal Structure Of The Ligand Binding Domain From Human Ppar-Alpha In Complex With The Agonist Az 242 Length = 287 | Back alignment and structure |
| >pdb|1R1K|D Chain D, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 266 | Back alignment and structure |
| >pdb|2ZNN|A Chain A, Human Pprr Alpha Ligand Binding Domain In Complex With A Synthetic Agonist Tipp703 Length = 273 | Back alignment and structure |
| >pdb|2REW|A Chain A, Crystal Structure Of Pparalpha Ligand Binding Domain With Bms-631707 Length = 277 | Back alignment and structure |
| >pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 | Back alignment and structure |
| >pdb|3SP6|A Chain A, Structural Basis For Iloprost As A Dual PparalphaDELTA AGONIST Length = 285 | Back alignment and structure |
| >pdb|3ET1|A Chain A, Structure Of Pparalpha With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 291 | Back alignment and structure |
| >pdb|1K7L|A Chain A, The 2.5 Angstrom Resolution Crystal Structure Of The Human Pparalpha Ligand Binding Domain Bound With Gw409544 And A Co-Activator Peptide. Length = 288 | Back alignment and structure |
| >pdb|2P54|A Chain A, A Crystal Structure Of Ppar Alpha Bound With Src1 Peptide And Gw735 Length = 267 | Back alignment and structure |
| >pdb|2NPA|A Chain A, The Crystal Structure Of The Human Pparaplpha Ligand Binding Domain In Complex With A A-Hydroxyimino Phenylpropanoic Acid Length = 270 | Back alignment and structure |
| >pdb|3G8I|A Chain A, Aleglitazar, A New, Potent, And Balanced Ppar AlphaGAMMA Agonist For The Treatment Of Type Ii Diabetes Length = 270 | Back alignment and structure |
| >pdb|1KKQ|A Chain A, Crystal Structure Of The Human Ppar-Alpha Ligand-Binding Domain In Complex With An Antagonist Gw6471 And A Smrt Corepressor Motif Length = 269 | Back alignment and structure |
| >pdb|1N4H|A Chain A, Characterization Of Ligands For The Orphan Nuclear Receptor Rorbeta Length = 259 | Back alignment and structure |
| >pdb|2HBH|A Chain A, Crystal Structure Of Vitamin D Nuclear Receptor Ligand Binding Domain Bound To A Locked Side-Chain Analog Of Calcitriol And Src-1 Peptide Length = 302 | Back alignment and structure |
| >pdb|1Y9R|A Chain A, Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone And Harboring The S810l Mutation Responsible For A Severe Form Of Hypertension Length = 255 | Back alignment and structure |
| >pdb|2OAX|A Chain A, Crystal Structure Of The S810l Mutant Mineralocorticoid Receptor Associated With Sc9420 Length = 256 | Back alignment and structure |
| >pdb|1ILG|A Chain A, Crystal Structure Of Apo Human Pregnane X Receptor Ligand Binding Domain Length = 316 | Back alignment and structure |
| >pdb|4FHH|A Chain A, Development Of Synthetically Accessible Non-Secosteroidal Hybrid Molecules Combining Vitamin D Receptor Agonism And Histone Deacetylase Inhibition Length = 300 | Back alignment and structure |
| >pdb|1K4W|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Ror Beta Ligand-Binding Domain In The Active Conformation Length = 252 | Back alignment and structure |
| >pdb|1SKX|A Chain A, Structural Disorder In The Complex Of Human Pxr And The Macrolide Antibiotic Rifampicin Length = 313 | Back alignment and structure |
| >pdb|1NQ7|A Chain A, Characterization Of Ligands For The Orphan Nuclear Receptor Rorbeta Length = 244 | Back alignment and structure |
| >pdb|3CTB|A Chain A, Tethered Pxr-LbdSRC-1p Apoprotein Length = 344 | Back alignment and structure |
| >pdb|3MNO|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, F608s) Mutations At 1.55a Length = 261 | Back alignment and structure |
| >pdb|2O9I|A Chain A, Crystal Structure Of The Human Pregnane X Receptor Lbd In Complex With An Src-1 Coactivator Peptide And T0901317 Length = 293 | Back alignment and structure |
| >pdb|3E7C|A Chain A, Glucocorticoid Receptor Lbd Bound To Gsk866 Length = 257 | Back alignment and structure |
| >pdb|3CLD|A Chain A, Ligand Binding Domain Of The Glucocorticoid Receptor Complexed With Fluticazone Furoate Length = 259 | Back alignment and structure |
| >pdb|1XV9|B Chain B, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 246 | Back alignment and structure |
| >pdb|2AA2|A Chain A, Mineralocorticoid Receptor With Bound Aldosterone Length = 275 | Back alignment and structure |
| >pdb|2A3I|A Chain A, Structural And Biochemical Mechanisms For The Specificity Of Hormone Binding And Coactivator Assembly By Mineralocorticoid Receptor Length = 253 | Back alignment and structure |
| >pdb|3MNP|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, V708a, E711g) Mutations At 1.50a Length = 261 | Back alignment and structure |
| >pdb|3F5C|B Chain B, Structure Of Dax-1:lrh-1 Complex Length = 268 | Back alignment and structure |
| >pdb|3MNE|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By F608s Mutation At 1.96a Length = 261 | Back alignment and structure |
| >pdb|1I38|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain T877a Mutant Complex With Dihydrotestosterone Length = 260 | Back alignment and structure |
| >pdb|1I37|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain Complex With Dihydrotestosterone Length = 260 | Back alignment and structure |
| >pdb|3G8O|A Chain A, Progesterone Receptor With Bound Pyrrolidine 1 Length = 263 | Back alignment and structure |
| >pdb|1E3K|A Chain A, Human Progesteron Receptor Ligand Binding Domain In Complex With The Ligand Metribolone (R1881) Length = 258 | Back alignment and structure |
| >pdb|1SR7|A Chain A, Progesterone Receptor Hormone Binding Domain With Bound Mometasone Furoate Length = 259 | Back alignment and structure |
| >pdb|2Q7K|A Chain A, The Androgen Receptor Prostate Cancer Mutant H874y Ligand Binding Domain Bound With Testosterone And An Ar 20-30 Peptide Length = 257 | Back alignment and structure |
| >pdb|1A28|A Chain A, Hormone-Bound Human Progesterone Receptor Ligand-Binding Domain Length = 256 | Back alignment and structure |
| >pdb|2AX6|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877a Mutant In Complex With Hydroxyflutamide Length = 256 | Back alignment and structure |
| >pdb|1XJ7|A Chain A, Complex Androgen Receptor Lbd And Rac3 Peptide Length = 257 | Back alignment and structure |
| >pdb|1T73|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With A Fxxff Motif Length = 269 | Back alignment and structure |
| >pdb|3H52|A Chain A, Crystal Structure Of The Antagonist Form Of Human Glucocorticoid Receptor Length = 254 | Back alignment and structure |
| >pdb|2AM9|A Chain A, Crystal Structure Of Human Androgen Receptor Ligand Binding Domain In Complex With Testosterone Length = 266 | Back alignment and structure |
| >pdb|1T5Z|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain (Lbd) With Dht And A Peptide Derived From Its Physiological Coactivator Ara70 Length = 251 | Back alignment and structure |
| >pdb|2AX9|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3 Length = 256 | Back alignment and structure |
| >pdb|1E3G|A Chain A, Human Androgen Receptor Ligand Binding In Complex With The Ligand Metribolone (R1881) Length = 263 | Back alignment and structure |
| >pdb|1PDU|A Chain A, Ligand-Binding Domain Of Drosophila Orphan Nuclear Receptor Dhr38 Length = 244 | Back alignment and structure |
| >pdb|2W8Y|A Chain A, Ru486 Bound To The Progesterone Receptor In A Destabilized Agonistic Conformation Length = 260 | Back alignment and structure |
| >pdb|2HVC|A Chain A, The Crystal Structure Of Ligand-Binding Domain (Lbd) Of Human Androgen Receptor In Complex With A Selective Modulator Lgd2226 Length = 250 | Back alignment and structure |
| >pdb|1SQN|A Chain A, Progesterone Receptor Ligand Binding Domain With Bound Norethindrone Length = 261 | Back alignment and structure |
| >pdb|1NHZ|A Chain A, Crystal Structure Of The Antagonist Form Of Glucocorticoid Receptor Length = 280 | Back alignment and structure |
| >pdb|2ABI|A Chain A, Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone Length = 256 | Back alignment and structure |
| >pdb|3A2I|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305f) Ligand Binding Domain Complexed With Tei-9647 Length = 263 | Back alignment and structure |
| >pdb|3A2J|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305fH397F) LIGAND Binding Domain Complexed With Tei-9647 Length = 263 | Back alignment and structure |
| >pdb|3KBA|A Chain A, Progesterone Receptor Bound To Sulfonamide Pyrrolidine Partial Agonist Length = 253 | Back alignment and structure |
| >pdb|1GS4|A Chain A, Structural Basis For The Glucocorticoid Response In A Mutant Human Androgen Receptor (Arccr) Derived From An Androgen-Independent Prostate Cancer Length = 248 | Back alignment and structure |
| >pdb|2Z4J|A Chain A, Crystal Structure Of Ar Lbd With Shp Peptide Nr Box 2 Length = 248 | Back alignment and structure |
| >pdb|3RLJ|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With Sarm S-22 Length = 247 | Back alignment and structure |
| >pdb|2OZ7|A Chain A, Crystal Structure Of The Human Androgen Receptor T877a Mutant Ligand- Binding Domain With Cyproterone Acetate Length = 249 | Back alignment and structure |
| >pdb|1XOW|A Chain A, Crystal Structure Of The Human Androgen Receptor Ligand Binding Domain Bound With An Androgen Receptor Nh2- Terminal Peptide, Ar20-30, And R1881 Length = 249 | Back alignment and structure |
| >pdb|3RLL|A Chain A, Crystal Structure Of The T877a Androgen Receptor Ligand Binding Domain In Complex With (S)-N-(4-Cyano-3-(Trifluoromethyl)phenyl)-3-(4- Cyanonaphthalen-1-Yloxy)-2-Hydroxy-2-Methylpropanamide Length = 247 | Back alignment and structure |
| >pdb|3L3X|A Chain A, Crystal Structure Of Dht-Bound Androgen Receptor In Complex With The First Motif Of Steroid Receptor Coactivator 3 Length = 250 | Back alignment and structure |
| >pdb|1N83|A Chain A, Crystal Structure Of The Complex Between The Orphan Nuclear Hormone Receptor Ror(Alpha)-Lbd And Cholesterol Length = 270 | Back alignment and structure |
| >pdb|3BQD|A Chain A, Doubling The Size Of The Glucocorticoid Receptor Ligand Binding Pocket By Deacylcortivazol Length = 255 | Back alignment and structure |
| >pdb|1M2Z|A Chain A, Crystal Structure Of A Dimer Complex Of The Human Glucocorticoid Receptor Ligand-Binding Domain Bound To Dexamethasone And A Tif2 Coactivator Motif Length = 257 | Back alignment and structure |
| >pdb|3M7R|A Chain A, Crystal Structure Of Vdr H305q Mutant Length = 253 | Back alignment and structure |
| >pdb|2ZL9|A Chain A, 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26,27- Dimethyl-19-Norvitamin D3 Analogs: Synthesis, Biological Evaluation And Crystal Structure Length = 271 | Back alignment and structure |
| >pdb|1DB1|A Chain A, Crystal Structure Of The Nuclear Receptor For Vitamin D Complexed To Vitamin D Length = 259 | Back alignment and structure |
| >pdb|4E2J|A Chain A, X-Ray Crystal Structure Of The Ancestral Glucocorticoid Receptor 2 Ligand Binding Domain In Complex With Mometasone Furoate And Tif-2 Coactivator Fragment Length = 250 | Back alignment and structure |
| >pdb|1S0Z|A Chain A, Crystal Structure Of The Vdr Lbd Complexed To Seocalcitol. Length = 263 | Back alignment and structure |
| >pdb|3GN8|A Chain A, X-Ray Crystal Structure Of Ancgr2 In Complex With Dexamethasone Length = 249 | Back alignment and structure |
| >pdb|3P8X|A Chain A, Synthesis, Structure, And Biological Activity Of Des-Side Chain Analogues Of 1alpha,25-Dihydroxyvitamin D3 With Substituents At C-18 Length = 280 | Back alignment and structure |
| >pdb|2ZFX|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With Yr301 And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 265 | Back alignment and structure |
| >pdb|1RJK|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With 2md And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 292 | Back alignment and structure |
| >pdb|3B0T|A Chain A, Human Vdr Ligand Binding Domain In Complex With Maxacalcitol Length = 254 | Back alignment and structure |
| >pdb|3AZ1|A Chain A, Crystal Structure Analysis Of Vitamin D Receptor Length = 253 | Back alignment and structure |
| >pdb|4FNE|A Chain A, X-Ray Crystal Structure Of The Ancestral 3-Keto Steroid Receptor - Doc Complex Length = 254 | Back alignment and structure |
| >pdb|2Q3Y|A Chain A, Ancestral Corticiod Receptor In Complex With Doc Length = 249 | Back alignment and structure |
| >pdb|1XNX|A Chain A, Crystal Structure Of Constitutive Androstane Receptor Length = 256 | Back alignment and structure |
| >pdb|2Q1H|A Chain A, Ancestral Corticoid Receptor In Complex With Aldosterone Length = 250 | Back alignment and structure |
| >pdb|1XLS|E Chain E, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 242 | Back alignment and structure |
| >pdb|3RY9|A Chain A, Crystal Structure Of The Resurrected Ancestral Glucocorticoid Receptor 1 In Complex With Doc Length = 250 | Back alignment and structure |
| >pdb|2AX8|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain W741l Mutant In Complex With S-1 Length = 256 | Back alignment and structure |
| >pdb|1Z95|A Chain A, Crystal Structure Of The Androgen Receptor Ligand-Binding Domain W741l Mutant Complex With R-Bicalutamide Length = 246 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 347 | |||
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-135 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 1e-104 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 1e-100 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 8e-90 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 3e-86 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 1e-84 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 4e-83 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 1e-82 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 4e-81 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 2e-79 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 5e-79 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 2e-78 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 6e-78 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 7e-78 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 2e-77 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 3e-76 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 1e-75 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 2e-75 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 6e-75 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 9e-75 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 9e-74 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 6e-73 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 1e-72 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 1e-72 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 4e-72 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 2e-70 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 2e-70 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 4e-70 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 9e-70 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 1e-69 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 1e-69 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 1e-69 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 3e-68 | |
| 2p54_A | 267 | PPAR-alpha, peroxisome proliferator-activated rece | 9e-68 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 2e-67 | |
| 1yje_A | 264 | Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga | 3e-67 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 3e-67 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 8e-67 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 9e-67 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 2e-66 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 3e-66 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 6e-66 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 2e-65 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 1e-63 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 1e-62 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 1e-62 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 2e-62 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 7e-62 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 9e-62 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 7e-61 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 3e-57 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 5e-57 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 2e-56 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 2e-56 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 3e-55 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 6e-55 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 1e-54 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 1e-54 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 1e-54 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 2e-54 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 3e-54 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 1e-53 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 2e-53 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 3e-53 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 5e-52 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 1e-51 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 1e-51 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 3e-51 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 3e-51 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 2e-46 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-08 |
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
Score = 392 bits (1007), Expect = e-135
Identities = 223/349 (63%), Positives = 267/349 (76%), Gaps = 6/349 (1%)
Query: 3 PDTATLLVNFNSGGANSMSSFGSNNHSSSHNNGSSNSSIISPYPPNHPLCGSKHLCSICG 62
P T TL + S +S + S++ G + + +P + +KH+C+ICG
Sbjct: 85 PTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICG 144
Query: 63 DRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMG 122
DR+SGKHYGVYSCEGCKGFFKRTVRKDL+Y CR+ ++C+IDKRQRNRCQYCRYQKCL MG
Sbjct: 145 DRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMG 204
Query: 123 MKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQA 182
MKREAVQEERQR K+R+ NEVESTS +MPVERILEAE V+ K E + + +
Sbjct: 205 MKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPS 264
Query: 183 T------NICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSIS 236
+ NIC+A DKQLF LV+WAK IPHF+ LPL+DQV+LLRAGWNELLIASFSHRSI+
Sbjct: 265 SPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIA 324
Query: 237 VKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPD 296
VKDGILLA G+ V+R+SAH AGVG IFDRVLTELVSKMR+M+MDKTELGCLR I+LFNPD
Sbjct: 325 VKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPD 384
Query: 297 VRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSI 345
+GL + VE LREKVY SLE Y + + E+PGRFAKLLLRLP+LRSI
Sbjct: 385 SKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSI 433
|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 | Back alignment and structure |
|---|
| >2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 | Back alignment and structure |
|---|
| >1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 347 | |||
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 100.0 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 100.0 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 100.0 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 100.0 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 100.0 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 100.0 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 100.0 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 100.0 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 100.0 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 100.0 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 100.0 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 100.0 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 100.0 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 100.0 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 100.0 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 100.0 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 100.0 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 100.0 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 100.0 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 100.0 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 100.0 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 100.0 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 100.0 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 100.0 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 100.0 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 100.0 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 100.0 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 100.0 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 100.0 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 100.0 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.98 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 99.97 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 99.97 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 99.97 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 99.97 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.97 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 99.97 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 99.97 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 99.97 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 99.97 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 99.97 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.97 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 99.97 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 99.97 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.97 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.97 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.97 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.97 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.97 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 99.97 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 99.97 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 99.97 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 99.97 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.97 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 99.97 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 99.97 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 99.97 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.97 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.97 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 99.97 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 99.97 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 99.97 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 99.97 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 99.97 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 99.96 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 99.96 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 99.96 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 99.96 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 99.96 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 99.96 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 99.94 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 99.86 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 93.89 |
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.9e-69 Score=512.82 Aligned_cols=294 Identities=73% Similarity=1.194 Sum_probs=251.4
Q ss_pred CCCCcCcccCCCCCCcccccccchhhHHHHHhhhcCCCcccccCCCCcccccccccCchhhhhHHHHhcCcchhHHHHHH
Q psy3092 53 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEER 132 (347)
Q Consensus 53 ~~~~~C~VCg~~a~g~HyGv~sC~~Ck~FFRR~v~~~~~~~C~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~r 132 (347)
.....|.||||+|+|+||||.+|+|||+||||+|+++..|.|+++++|.+++..|++||+|||+||+++||++++||.+|
T Consensus 135 ~~~~~C~VCg~~a~g~hygv~sC~~Ck~FFrR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~r 214 (467)
T 3dzy_A 135 FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEER 214 (467)
T ss_dssp --CEECTTTSSEECSEETTEECCHHHHHHHHHHHHTTCCCCCSSSSCCCCCSSSSSSCHHHHHHHHHHTTCCGGGCCCCS
T ss_pred CCCCcceeCCCCCCCCcCCCcchhhhhHhccccccCCCceeCCCCCCCCCCcccccccccchhhhhhhccccchhhhccc
Confidence 34567999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred hhhhccccccccCCCCCCCCCcHHHHHHHHHhccCCCCCCcc------ccchhHHHhhhhHHHHHHHHHHHHHHhhCCCC
Q psy3092 133 QRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQ------DIVNEQQATNICKATDKQLFQLVDWAKHIPHF 206 (347)
Q Consensus 133 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~l~~~~~w~k~~p~F 206 (347)
++.+.+.....+.+.....+.++++++++...+......... ..........++++.+.+++.+++|+|+||+|
T Consensus 215 ~~~k~r~~~~~~~~~~~~~~~~~~~ll~a~~~~e~~~~~~~~~~~~~~~~~~~~~~~~l~e~a~~~L~~vVeWAK~iP~F 294 (467)
T 3dzy_A 215 QRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHF 294 (467)
T ss_dssp CCCCCCSCSSCTTSTTCSCSSCHHHHHHHHHC----------------------CCTTHHHHHHHHHHHHHHHHHHSTTS
T ss_pred cccccccccccccccccCCCCchhhhhhhhhhhcccchhhhhhcccCCCCcccchHHHHHHHHHHHHHHHHHHHHhCcch
Confidence 876554333333333344566788888776544332211110 01112234567888999999999999999999
Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHhhcccccCCCceEecCCccccccchhhcCchhhHHhhHHHHHHHHHhcCCCHhHHHH
Q psy3092 207 TTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGC 286 (347)
Q Consensus 207 ~~L~~~dq~~Llk~~~~~~~~l~~a~~s~~~~~~~~~~~g~~i~~~~~~~~~~~~~~~~~~~~l~~~l~~L~l~~~E~~l 286 (347)
++|+.+||+.|||++|.+++++.++++++..++.+++++|..++++.....++..++++++.+++.+|++|++|++||++
T Consensus 295 ~~L~~~DQi~LLK~~w~elliL~~a~rs~~~~~~~ll~~g~~i~~~~~~~~~~~~~~~~il~~lv~~l~~L~ld~~E~~l 374 (467)
T 3dzy_A 295 SELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGC 374 (467)
T ss_dssp TTSCHHHHHHHHHHHHHHHHHHHHHHHTSSSTTBCCCSSSCCCBTHHHHTTTCHHHHHHHHHHTHHHHHHHTCCHHHHHH
T ss_pred hcCCHHHHHHHHHhHHHHHHHHHHHHHhccCCCceEecCCceechhhhhhhcchHHHHHHHHHHHHHHHHhcCCHHHHHH
Confidence 99999999999999999999999999999888999999999998888777777888899998999999999999999999
Q ss_pred HHHHHhhcCCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHhhhhhhhccC
Q psy3092 287 LRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIE 346 (347)
Q Consensus 287 L~ai~l~~p~~~~l~~~~~i~~~r~~~~~~L~~y~~~~~~~~~~Rf~~LL~ll~~lr~i~ 346 (347)
|+||+||+||+++|++.+.|+++|++++.+|++|++.++++++.||++||++||+||+|+
T Consensus 375 LkAIvLfnpd~~gL~~~~~Ve~lQe~~~~aL~~Y~~~~~p~~p~Rf~kLLl~Lp~LRsi~ 434 (467)
T 3dzy_A 375 LRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIG 434 (467)
T ss_dssp HHHHHHSCTTSTTCSCHHHHHHHHHHHHHHHHHHHHHHCTTCTTHHHHHHTHHHHHHHHH
T ss_pred HHHHHHhCcCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999885
|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 347 | ||||
| d2p1ta1 | 230 | a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R | 1e-64 | |
| d1pzla_ | 233 | a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { | 3e-59 | |
| d1hg4a_ | 265 | a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph | 6e-57 | |
| d1g2na_ | 256 | a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth | 2e-56 | |
| d1n46a_ | 251 | a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b | 2e-55 | |
| d1pq9a_ | 239 | a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human | 5e-54 | |
| d1fcya_ | 236 | a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g | 2e-53 | |
| d1pk5a_ | 242 | a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- | 1e-51 | |
| d1osha_ | 231 | a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo | 1e-51 | |
| d2p54a1 | 267 | a.123.1.1 (A:202-468) Peroxisome proliferator acti | 8e-51 | |
| d1xpca_ | 245 | a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom | 7e-50 | |
| d2e2ra1 | 223 | a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 | 2e-49 | |
| d2b50b1 | 265 | a.123.1.1 (B:211-475) Peroxisome proliferator-acti | 9e-49 | |
| d2j7ya1 | 236 | a.123.1.1 (A:217-452) Estrogen receptor beta {Rat | 2e-48 | |
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 1e-47 | |
| d1xvpb_ | 246 | a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) | 2e-47 | |
| d2fvja1 | 271 | a.123.1.1 (A:207-477) Peroxisome proliferator acti | 8e-47 | |
| d2r40d1 | 243 | a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m | 1e-46 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 6e-46 | |
| d1nrla_ | 292 | a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho | 2e-45 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 4e-44 | |
| d1ie9a_ | 255 | a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( | 1e-43 | |
| d1t7ra_ | 250 | a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan | 2e-43 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 3e-43 | |
| d1xnxa_ | 232 | a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) | 4e-43 | |
| d2qw4a1 | 233 | a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 | 7e-43 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 1e-40 | |
| d1n83a_ | 251 | a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { | 7e-40 | |
| d1dszb_ | 84 | g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- | 2e-39 | |
| d1nq7a_ | 244 | a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R | 1e-38 | |
| d2hanb1 | 83 | g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do | 5e-36 | |
| d1kb2a_ | 89 | g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin | 3e-35 | |
| d1lo1a_ | 90 | g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi | 2e-34 | |
| d1cita_ | 89 | g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b | 3e-33 | |
| d1a6ya_ | 78 | g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b | 4e-33 | |
| d1dsza_ | 75 | g.39.1.2 (A:) Retinoic acid receptor DNA-binding d | 1e-32 | |
| d1r4ia_ | 74 | g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve | 3e-30 | |
| d1hcqa_ | 74 | g.39.1.2 (A:) Estrogen receptor DNA-binding domain | 1e-29 | |
| d1lata_ | 71 | g.39.1.2 (A:) Glucocorticoid receptor DNA-binding | 5e-28 | |
| d2nllb_ | 103 | g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D | 8e-27 |
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Retinoid-X receptor alpha (RXR-alpha) species: Human (Homo sapiens) [TaxId: 9606]
Score = 202 bits (515), Expect = 1e-64
Identities = 137/200 (68%), Positives = 157/200 (78%), Gaps = 6/200 (3%)
Query: 152 EMPVERILEAEQRVDMKQEP------ADQDIVNEQQATNICKATDKQLFQLVDWAKHIPH 205
+MPVERILEAE V+ K E TNIC+A DKQLF LV+WAK IPH
Sbjct: 1 DMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPH 60
Query: 206 FTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDR 265
F+ LPL+DQV+LLRAGWNELLIASFSHRSI+VKDGILLA G+ V+R+SAH AGVG IFDR
Sbjct: 61 FSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDR 120
Query: 266 VLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNH 325
VLTELVSKMR+M+MDKTELGCLR I+LFNPD +GL + VE LREKVY SLE Y + +
Sbjct: 121 VLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKY 180
Query: 326 SEEPGRFAKLLLRLPSLRSI 345
E+PGRFAKLLLRLP+LRSI
Sbjct: 181 PEQPGRFAKLLLRLPALRSI 200
|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 347 | |||
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 100.0 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 100.0 | |
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 100.0 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 100.0 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 100.0 | |
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 100.0 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 100.0 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 100.0 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 100.0 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 100.0 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 100.0 | |
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 99.98 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 99.98 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 99.98 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 99.98 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 99.97 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 99.97 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.97 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 99.97 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 99.97 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 99.97 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 99.97 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 99.97 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 99.97 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 99.96 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 99.96 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 99.96 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.96 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 99.96 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.96 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 99.96 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 99.96 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.96 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.96 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 99.96 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 99.96 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 99.96 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 99.96 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 99.96 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 99.95 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 85.67 |
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Retinoid X receptor (RXR-alpha) DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.9e-37 Score=217.44 Aligned_cols=80 Identities=86% Similarity=1.634 Sum_probs=76.4
Q ss_pred CCcCcccCCCCCCcccccccchhhHHHHHhhhcCCCcccccCCCCcccccccccCchhhhhHHHHhcCcchhHHHHHHhh
Q psy3092 55 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEERQR 134 (347)
Q Consensus 55 ~~~C~VCg~~a~g~HyGv~sC~~Ck~FFRR~v~~~~~~~C~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~r~~ 134 (347)
+++|.|||++|+|+||||.+|+|||+||||+|.++..|.|..+++|.+++..|..||+|||+|||++||++++||.+|++
T Consensus 5 ~~~C~VC~~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~c~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~Rdr 84 (84)
T d1dszb_ 5 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR 84 (84)
T ss_dssp CEECTTTCCEESSEETTEECCHHHHHHHHHHHHHTCCCCCSSCSCCCCCTTTTTTCHHHHHHHHHHTTCCGGGSCCCCCC
T ss_pred CCcCccCCCcCCccCCCHHHHHHhHHHHHHHHhcCCCeeccCCCCcccCCCCCccCCCCccHHHHHcCCChHHcccccCC
Confidence 46799999999999999999999999999999999999999999999999999999999999999999999999988763
|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|