Psyllid ID: psy3092


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MKPDTATLLVNFNSGGANSMSSFGSNNHSSSHNNGSSNSSIISPYPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEccEEccEEccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccHHHcccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccEEEHHHHHHHccccHHHHHHHHcHHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHcc
MKPDTATLLVNFnsggansmssfgsnnhssshnngssnssiispyppnhplcgskhlcsicgdrasgkhygvyscegckgffkrTVRKDLSYACREGrnciidkrqrnrcqycrYQKCLNMGMKREAVQEERQrtkerdsnevestsgtliempVERILEAEQrvdmkqepadqdIVNEQQATNICKATDKQLFQLVDWakhiphfttlplEDQVLLLRAGWNELLIASFShrsisvkdgillapgvtvyrssaheagvggIFDRVLTELVSKMREMKMDKTELGCLRTIILfnpdvrglkSQQVVEMLREKVYTSLEEYTrvnhseepGRFAKLLLrlpslrsiev
MKPDTATLLVNFNSGGANSMSSFGSNNHSSSHNNGSSNSSIISPYPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREgrnciidkrqrnrcQYCRYQkclnmgmkREAVQEerqrtkerdsnevestsgtliempvERILEAEQRVDMKQEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSsaheagvggifdRVLTELVSKMREMKMDKTELGCLRTIIlfnpdvrglksQQVVEMLREKVYTSLEEytrvnhseepgrfaklllrlpslrsiev
MKPDTATLLVNFNSGGAnsmssfgsnnhssshnngssnssiisPYPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDkrqrnrcqycryqkcLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV
*************************************************PLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMG***********************************************************ATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRV********FAKLLL**********
**********************************************************SICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKR**********************************************************NICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNH***PGRFAKLLLRLPSLRSIE*
MKPDTATLLVNFNSGGANSMS******************SIISPYPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMK***********************GTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV
****************************************************GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMK****************************MPVERILEAEQRVD**QEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPDTATLLVNFNSGGANSMSSFGSNNHSSSHNNGSSNSSIISPYPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q5I7G2436 Retinoic acid receptor RX N/A N/A 0.939 0.747 0.691 1e-132
Q8T5C6436 Retinoic acid receptor RX N/A N/A 0.982 0.782 0.645 1e-131
A2T929430 Retinoic acid receptor RX yes N/A 0.948 0.765 0.656 1e-129
P28701467 Retinoic acid receptor RX yes N/A 0.864 0.642 0.714 1e-128
P51129470 Retinoic acid receptor RX N/A N/A 0.884 0.653 0.700 1e-127
P19793462 Retinoic acid receptor RX yes N/A 0.933 0.701 0.668 1e-127
Q90416441 Retinoic acid receptor RX no N/A 0.965 0.759 0.660 1e-127
Q05343467 Retinoic acid receptor RX yes N/A 0.927 0.689 0.663 1e-126
P28700467 Retinoic acid receptor RX yes N/A 0.927 0.689 0.663 1e-126
P51128488 Retinoic acid receptor RX N/A N/A 0.899 0.639 0.669 1e-126
>sp|Q5I7G2|RXR_LYMST Retinoic acid receptor RXR OS=Lymnaea stagnalis GN=RXR PE=1 SV=1 Back     alignment and function desciption
 Score =  472 bits (1214), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 267/340 (78%), Gaps = 14/340 (4%)

Query: 14  SGGANSMSSFGSNNHSSSHNNGSSNSSIISPYPPN------HPLCGSKHLCSICGDRASG 67
           S G   M S G   HS + + GS     +SP  P+      H    +KH+C+ICGDRASG
Sbjct: 69  SPGPQQMHSPGM--HSPTSSMGSPPMLCLSPTGPSPSPGLPHSSLHTKHICAICGDRASG 126

Query: 68  KHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREA 127
           KHYGVYSCEGCKGFFKRTVRKDL+YACR+ +NC+IDKRQRNRCQYCRY KCL+MGMKREA
Sbjct: 127 KHYGVYSCEGCKGFFKRTVRKDLTYACRDDKNCMIDKRQRNRCQYCRYMKCLSMGMKREA 186

Query: 128 VQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQ--ATNI 185
           VQEERQR KE+   EVESTSG   +MPVE+ILEAE  VD    P     ++ Q+   TNI
Sbjct: 187 VQEERQRVKEKGDGEVESTSGANNDMPVEQILEAELAVD----PKIDTYIDAQKDPVTNI 242

Query: 186 CKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAP 245
           C+A DKQLF LV+WAK IPHFT LPLEDQV+LLRAGWNELLIA FSHRSI  KDGILLA 
Sbjct: 243 CQAADKQLFTLVEWAKRIPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLAT 302

Query: 246 GVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQV 305
           G+ V+RSSAH+AGVG IFDRVLTELV+KMREMKMDKTELGCLR ++LFNPD +GL + Q 
Sbjct: 303 GLHVHRSSAHQAGVGTIFDRVLTELVAKMREMKMDKTELGCLRAVVLFNPDAKGLTAVQE 362

Query: 306 VEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSI 345
           VE LREKVY SLEEYT+  + EEPGRFAKLLLRLP+LRSI
Sbjct: 363 VEQLREKVYASLEEYTKTRYPEEPGRFAKLLLRLPALRSI 402




Ligand-dependent transcription factor probably involved in the retinoic acid response pathway. Binds 9-cis-retinoic acid (By similarity). Involved in embryo development, in particular eye and shell formation. May play a role in growth cone steering.
Lymnaea stagnalis (taxid: 6523)
>sp|Q8T5C6|RXR_BIOGL Retinoic acid receptor RXR OS=Biomphalaria glabrata GN=RXR PE=1 SV=1 Back     alignment and function description
>sp|A2T929|RXRAA_DANRE Retinoic acid receptor RXR-alpha-A OS=Danio rerio GN=rxraa PE=2 SV=2 Back     alignment and function description
>sp|P28701|RXRG_CHICK Retinoic acid receptor RXR-gamma OS=Gallus gallus GN=RXRG PE=2 SV=1 Back     alignment and function description
>sp|P51129|RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis GN=rxrg PE=2 SV=1 Back     alignment and function description
>sp|P19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha OS=Homo sapiens GN=RXRA PE=1 SV=1 Back     alignment and function description
>sp|Q90416|RXRGA_DANRE Retinoic acid receptor RXR-gamma-A OS=Danio rerio GN=rxrga PE=2 SV=2 Back     alignment and function description
>sp|Q05343|RXRA_RAT Retinoic acid receptor RXR-alpha OS=Rattus norvegicus GN=Rxra PE=2 SV=1 Back     alignment and function description
>sp|P28700|RXRA_MOUSE Retinoic acid receptor RXR-alpha OS=Mus musculus GN=Rxra PE=1 SV=1 Back     alignment and function description
>sp|P51128|RXRA_XENLA Retinoic acid receptor RXR-alpha OS=Xenopus laevis GN=rxra PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
410130138416 retinoid X receptor [Periplaneta america 0.982 0.819 0.736 1e-147
302202572403 retinoid X receptor [Gryllus firmus] 0.988 0.851 0.750 1e-147
314955486403 retinoid X receptor [Gryllus firmus] 0.988 0.851 0.747 1e-147
314955556403 retinoid X receptor [Gryllus firmus] 0.988 0.851 0.747 1e-147
383848789427 PREDICTED: retinoic acid receptor RXR-al 0.985 0.800 0.738 1e-147
242008309420 retinoid X receptor, putative [Pediculus 0.976 0.807 0.740 1e-147
449082861441 ultraspiracle long isoform [Periplaneta 0.991 0.780 0.704 1e-146
380012603440 PREDICTED: retinoic acid receptor RXR-al 0.985 0.777 0.735 1e-145
58585210427 ultraspiracle [Apis mellifera] gi|811861 0.985 0.800 0.735 1e-145
340719093427 PREDICTED: retinoic acid receptor RXR-al 0.985 0.800 0.735 1e-145
>gi|410130138|dbj|BAM63276.2| retinoid X receptor [Periplaneta americana] Back     alignment and taxonomy information
 Score =  528 bits (1361), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 265/360 (73%), Positives = 294/360 (81%), Gaps = 19/360 (5%)

Query: 1   MKPDTATLLVNFNS-----GGANSMSSFG-------SNNHSSSHNNGSSNSSIISPYPPN 48
           MKPDTA LL+   S     GG N+  SF        S +  SS +NGS  SS   PYPPN
Sbjct: 29  MKPDTACLLLGSGSFTPTGGGPNTPGSFCIGQSRVFSKSTGSSQSNGSWGSS---PYPPN 85

Query: 49  HPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRN 108
           HPL GSKHLC+ICGDRA GKHYGVY CEGCKGFFK TVRKDLSYACRE +NCIIDKRQRN
Sbjct: 86  HPLSGSKHLCTICGDRACGKHYGVYCCEGCKGFFKWTVRKDLSYACREDKNCIIDKRQRN 145

Query: 109 RCQYCRYQKCLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMK 168
           RCQYCRYQKCL MGMKREAVQEERQRTKERD NEVESTS    +MPVERILEAE+RV+ K
Sbjct: 146 RCQYCRYQKCLGMGMKREAVQEERQRTKERDQNEVESTSSLHTDMPVERILEAEKRVECK 205

Query: 169 QEPADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIA 228
            E     +  E   TNIC+AT+KQLFQLV+WAKHIPHFT+LPL DQVLLLRAGWNELLIA
Sbjct: 206 TE---HQVEFESAVTNICQATNKQLFQLVEWAKHIPHFTSLPLSDQVLLLRAGWNELLIA 262

Query: 229 SFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLR 288
           +FSHRS+ VKDGI+LA G+TV+R+SAH+AGVG IFDRVLTELV+KMREMKMDKTEL CLR
Sbjct: 263 AFSHRSVEVKDGIVLATGLTVHRNSAHQAGVGTIFDRVLTELVAKMREMKMDKTELVCLR 322

Query: 289 TIILFNPD-VRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIEV 347
           ++ILFNPD VRGLKS+Q VE+LREKVY +LEEYTR  H +EPGRFAKLL  LPSLRSI +
Sbjct: 323 SVILFNPDVVRGLKSRQEVELLREKVYAALEEYTRTTHPDEPGRFAKLLPSLPSLRSISL 382




Source: Periplaneta americana

Species: Periplaneta americana

Genus: Periplaneta

Family: Blattidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|302202572|gb|ADL09403.1| retinoid X receptor [Gryllus firmus] Back     alignment and taxonomy information
>gi|314955486|gb|ADT64884.1| retinoid X receptor [Gryllus firmus] Back     alignment and taxonomy information
>gi|314955556|gb|ADT64885.1| retinoid X receptor [Gryllus firmus] Back     alignment and taxonomy information
>gi|383848789|ref|XP_003700030.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242008309|ref|XP_002424949.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212508563|gb|EEB12211.1| retinoid X receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|449082861|dbj|BAM83567.1| ultraspiracle long isoform [Periplaneta americana] Back     alignment and taxonomy information
>gi|380012603|ref|XP_003690369.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like [Apis florea] Back     alignment and taxonomy information
>gi|58585210|ref|NP_001011634.1| ultraspiracle [Apis mellifera] gi|8118613|gb|AAF73057.1|AF263459_1 ultraspiracle protein [Apis mellifera] gi|30691980|gb|AAP33487.1| ultraspiracle protein [Apis mellifera] Back     alignment and taxonomy information
>gi|340719093|ref|XP_003397991.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like isoform 1 [Bombus terrestris] gi|350396161|ref|XP_003484462.1| PREDICTED: retinoic acid receptor RXR-alpha-A-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
UNIPROTKB|F1NSP3467 RXRG "Retinoic acid receptor R 0.864 0.642 0.668 2e-104
ZFIN|ZDB-GENE-070314-2495 rxraa "retinoid X receptor, al 0.861 0.604 0.667 5.3e-104
ZFIN|ZDB-GENE-980526-36441 rxrga "retinoid x receptor, ga 0.867 0.682 0.664 6.7e-104
UNIPROTKB|P28701467 RXRG "Retinoic acid receptor R 0.864 0.642 0.665 1.1e-103
UNIPROTKB|P51129470 rxrg "Retinoic acid receptor R 0.867 0.640 0.661 3.7e-103
UNIPROTKB|B3KY83365 RXRA "cDNA FLJ16020 fis, clone 0.867 0.824 0.657 1.3e-102
UNIPROTKB|P19793462 RXRA "Retinoic acid receptor R 0.867 0.651 0.657 1.3e-102
UNIPROTKB|F1P6M9486 RXRA "Uncharacterized protein" 0.867 0.619 0.654 2.6e-102
MGI|MGI:98214467 Rxra "retinoid X receptor alph 0.867 0.644 0.654 2.6e-102
UNIPROTKB|P51128488 rxra "Retinoic acid receptor R 0.870 0.618 0.650 3.3e-102
UNIPROTKB|F1NSP3 RXRG "Retinoic acid receptor RXR-gamma" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1034 (369.0 bits), Expect = 2.0e-104, P = 2.0e-104
 Identities = 204/305 (66%), Positives = 236/305 (77%)

Query:    45 YPPNHPLCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDX 104
             YP   P   +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDL Y CR+ ++C+ID 
Sbjct:   130 YPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDK 189

Query:   105 XXXXXXXXXXXXXXLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQR 164
                           L MGMKREAVQEERQR++ER  NE ESTSG   +MPVERILEAE  
Sbjct:   190 RQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERSENEAESTSGGSEDMPVERILEAELA 249

Query:   165 VDMKQEPADQDIVNEQQA----TNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRA 220
             V+ K E A  D+  E       TNIC A DKQLF LV+WAK IPHF+ L LEDQV+LLRA
Sbjct:   250 VEPKTE-AYSDVNTESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRA 308

Query:   221 GWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMD 280
             GWNELLIASFSHRS+SV+DGILLA G+ V+RSSAH AGVG IFDRVLTELVSKM++M+MD
Sbjct:   309 GWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMD 368

Query:   281 KTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLP 340
             K+ELGCLR I+LFNPD +GL S   VE LREKVY +LE YT+  + E+PGRFAKLLLRLP
Sbjct:   369 KSELGCLRAIVLFNPDAKGLSSPSEVESLREKVYATLEAYTKQKYPEQPGRFAKLLLRLP 428

Query:   341 SLRSI 345
             +LRSI
Sbjct:   429 ALRSI 433




GO:0003707 "steroid hormone receptor activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0004886 "9-cis retinoic acid receptor activity" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
ZFIN|ZDB-GENE-070314-2 rxraa "retinoid X receptor, alpha a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-36 rxrga "retinoid x receptor, gamma a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P28701 RXRG "Retinoic acid receptor RXR-gamma" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P51129 rxrg "Retinoic acid receptor RXR-gamma" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|B3KY83 RXRA "cDNA FLJ16020 fis, clone BRAMY2003287, highly similar to RETINOIC ACID RECEPTOR RXR-ALPHA" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P19793 RXRA "Retinoic acid receptor RXR-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6M9 RXRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:98214 Rxra "retinoid X receptor alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P51128 rxra "Retinoic acid receptor RXR-alpha" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51129RXRG_XENLANo assigned EC number0.70060.88470.6531N/AN/A
Q05343RXRA_RATNo assigned EC number0.66370.92790.6895yesN/A
P19793RXRA_HUMANNo assigned EC number0.66860.93370.7012yesN/A
P28701RXRG_CHICKNo assigned EC number0.71470.86450.6423yesN/A
P28700RXRA_MOUSENo assigned EC number0.66370.92790.6895yesN/A
P28705RXRG_MOUSENo assigned EC number0.70060.86740.6501noN/A
Q0GFF6RXRG_PIGNo assigned EC number0.70060.86740.6501yesN/A
Q0VC20RXRG_BOVINNo assigned EC number0.69730.86740.6501yesN/A
A2T929RXRAA_DANRENo assigned EC number0.65630.94810.7651yesN/A
Q5REL6RXRG_PONABNo assigned EC number0.70060.86740.6501yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
cd06943207 cd06943, NR_LBD_RXR_like, The ligand binding domai 1e-123
cd06930165 cd06930, NR_LBD_F2, Ligand-binding domain of nucle 8e-57
cd0695677 cd06956, NR_DBD_RXR, DNA-binding domain of retinoi 2e-53
cd06931222 cd06931, NR_LBD_HNF4_like, The ligand binding doma 2e-49
cd0691672 cd06916, NR_DBD_like, DNA-binding domain of nuclea 2e-47
cd06157168 cd06157, NR_LBD, The ligand binding domain of nucl 3e-45
smart00430163 smart00430, HOLI, Ligand binding domain of hormone 2e-43
pfam0010570 pfam00105, zf-C4, Zinc finger, C4 type (two domain 5e-42
cd0696076 cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto 2e-41
cd0696787 cd06967, NR_DBD_TR2_like, DNA-binding domain of th 3e-40
cd06948236 cd06948, NR_LBD_COUP-TF, Ligand binding domain of 6e-40
cd0696185 cd06961, NR_DBD_TR, DNA-binding domain of thyroid 2e-39
cd0696975 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the 3e-39
cd0716478 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of 3e-39
cd06944237 cd06944, NR_LBD_Ftz-F1_like, The ligand binding do 6e-38
cd07068221 cd07068, NR_LBD_ER_like, The ligand binding domain 2e-37
cd06950206 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d 5e-37
pfam00104186 pfam00104, Hormone_recep, Ligand-binding domain of 7e-37
cd0716793 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain 3e-36
smart0039970 smart00399, ZnF_C4, c4 zinc finger in nuclear horm 4e-36
cd0695873 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi 1e-35
cd0716990 cd07169, NR_DBD_GCNF_like, DNA-binding domain of G 1e-33
cd0696895 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi 4e-33
cd0696584 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi 5e-33
cd0695782 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of 8e-33
cd0696485 cd06964, NR_DBD_RAR, DNA-binding domain of retinoi 8e-33
cd0716890 cd07168, NR_DBD_DHR4_like, DNA-binding domain of e 1e-32
cd0697092 cd06970, NR_DBD_PNR, DNA-binding domain of the pho 3e-32
cd0715473 cd07154, NR_DBD_PNR_like, The DNA-binding domain o 1e-31
cd0715873 cd07158, NR_DBD_Ppar_like, The DNA-binding domain 2e-31
cd0716581 cd07165, NR_DBD_DmE78_like, DNA-binding domain of 3e-31
cd0716392 cd07163, NR_DBD_TLX, DNA-binding domain of Tailles 1e-30
cd0716689 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV 2e-30
cd06929174 cd06929, NR_LBD_F1, Ligand-binding domain of nucle 4e-30
cd07069241 cd07069, NR_LBD_Lrh-1, The ligand binding domain o 7e-30
cd0715575 cd07155, NR_DBD_ER_like, DNA-binding domain of est 4e-29
cd06946221 cd06946, NR_LBD_ERR, The ligand binding domain of 4e-28
cd0717974 cd07179, 2DBD_NR_DBD2, The second DNA-binding doma 5e-28
cd0695973 cd06959, NR_DBD_EcR_like, The DNA-binding domain o 6e-28
cd0717097 cd07170, NR_DBD_ERR, DNA-binding domain of estroge 8e-28
cd0717182 cd07171, NR_DBD_ER, DNA-binding domain of estrogen 2e-27
cd0716191 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson 2e-26
cd06952222 cd06952, NR_LBD_TR2_like, The ligand binding domai 5e-26
cd0715672 cd07156, NR_DBD_VDR_like, The DNA-binding domain o 5e-26
cd07160101 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X 7e-26
cd0696284 cd06962, NR_DBD_FXR, DNA-binding domain of Farneso 3e-24
cd06937231 cd06937, NR_LBD_RAR, The ligand binding domain (LB 6e-24
cd06953213 cd06953, NR_LBD_DHR4_like, The ligand binding doma 1e-23
cd06949235 cd06949, NR_LBD_ER, Ligand binding domain of Estro 5e-23
cd0716287 cd07162, NR_DBD_PXR, DNA-binding domain of pregnan 2e-22
cd0715786 cd07157, 2DBD_NR_DBD1, The first DNA-binding domai 3e-22
cd06955107 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin 2e-21
cd0717278 cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco 3e-21
cd07070237 cd07070, NR_LBD_SF-1, The ligand binding domain of 5e-21
cd06940189 cd06940, NR_LBD_REV_ERB, The ligand binding domain 7e-21
cd06954236 cd06954, NR_LBD_LXR, The ligand binding domain of 2e-20
cd0696373 cd06963, NR_DBD_GR_like, The DNA binding domain of 2e-19
cd0696694 cd06966, NR_DBD_CAR, DNA-binding domain of constit 2e-19
cd06932259 cd06932, NR_LBD_PPAR, The ligand binding domain of 2e-17
cd06951222 cd06951, NR_LBD_Dax1_like, The ligand binding doma 8e-17
cd06935243 cd06935, NR_LBD_TR, The ligand binding domain of t 1e-16
cd07350232 cd07350, NR_LBD_Dax1, The ligand binding domain of 2e-16
cd0717382 cd07173, NR_DBD_AR, DNA-binding domain of androgen 2e-16
cd06945239 cd06945, NR_LBD_Nurr1_like, The ligand binding dom 9e-16
cd06936221 cd06936, NR_LBD_Fxr, The ligand binding domain of 2e-14
cd07348238 cd07348, NR_LBD_NGFI-B, The ligand binding domain 2e-14
cd07071238 cd07071, NR_LBD_Nurr1, The ligand binding domain o 7e-14
cd07349222 cd07349, NR_LBD_SHP, The ligand binding domain of 2e-13
cd06939241 cd06939, NR_LBD_ROR_like, The ligand binding domai 4e-13
cd06938231 cd06938, NR_LBD_EcR, The ligand binding domain (LB 1e-12
cd06941195 cd06941, NR_LBD_DmE78_like, The ligand binding dom 1e-12
cd07072239 cd07072, NR_LBD_DHR38_like, Ligand binding domain 3e-10
cd06934226 cd06934, NR_LBD_PXR_like, The ligand binding domai 1e-09
cd06947246 cd06947, NR_LBD_GR_Like, Ligand binding domain of 3e-08
cd06933238 cd06933, NR_LBD_VDR, The ligand binding domain of 4e-08
cd07076247 cd07076, NR_LBD_GR, Ligand binding domain of the g 1e-07
cd07075248 cd07075, NR_LBD_MR, Ligand binding domain of the m 5e-07
cd07074248 cd07074, NR_LBD_PR, Ligand binding domain of the p 9e-07
cd07073246 cd07073, NR_LBD_AR, Ligand binding domain of the n 3e-06
>gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
 Score =  352 bits (906), Expect = e-123
 Identities = 139/195 (71%), Positives = 164/195 (84%), Gaps = 1/195 (0%)

Query: 152 EMPVERILEAEQRVDMKQEP-ADQDIVNEQQATNICKATDKQLFQLVDWAKHIPHFTTLP 210
           +MP+ERILEAE  V+ K E  A          +NIC+A DKQLFQLV+WAK IPHF+ LP
Sbjct: 1   DMPIERILEAELAVEPKSEAVAMVPPEYRDPVSNICQAADKQLFQLVEWAKRIPHFSELP 60

Query: 211 LEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTEL 270
           L+DQV+LLRAGWNELLIA+F+HRSI+VKDGILLA G+ ++R+SAH+AGVG IFDR+LTEL
Sbjct: 61  LDDQVILLRAGWNELLIAAFAHRSIAVKDGILLATGLHLHRNSAHQAGVGAIFDRILTEL 120

Query: 271 VSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPG 330
           V KMR++KMD+TELGCLR IILFNPDV+GLKS+Q VE LREKVY SLEEY R  H E+PG
Sbjct: 121 VVKMRDLKMDRTELGCLRAIILFNPDVKGLKSRQEVESLREKVYASLEEYCRQKHPEQPG 180

Query: 331 RFAKLLLRLPSLRSI 345
           RFAKLLLRLP+LRSI
Sbjct: 181 RFAKLLLRLPALRSI 195


The ligand binding domain of the retinoid X receptor (RXR) and Ultraspiracle (USP): This family includes two evolutionary related nuclear receptors: retinoid X receptor (RXR) and Ultraspiracle (USP). RXR is a nuclear receptor in mammalian and USP is its counterpart in invertebrates. The native ligand of retinoid X receptor is 9-cis retinoic acid (RA). RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. RXRs can play different roles in these heterodimers. It acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear receptors. Ultraspiracle (USP) plays similar roles as DNA binding partner of other nuclear rec eptors in invertebrates. USP has no known high-affinity ligand and is thought to be a silent component in the heterodimeric complex with partner receptors. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, RXR and USP have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 207

>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors Back     alignment and domain information
>gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) Back     alignment and domain information
>gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone receptor Back     alignment and domain information
>gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132727 cd06929, NR_LBD_F1, Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132744 cd06946, NR_LBD_ERR, The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132735 cd06937, NR_LBD_RAR, The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132751 cd06953, NR_LBD_DHR4_like, The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>gnl|CDD|132747 cd06949, NR_LBD_ER, Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132755 cd07070, NR_LBD_SF-1, The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132738 cd06940, NR_LBD_REV_ERB, The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132752 cd06954, NR_LBD_LXR, The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132730 cd06932, NR_LBD_PPAR, The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>gnl|CDD|132733 cd06935, NR_LBD_TR, The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>gnl|CDD|132764 cd07350, NR_LBD_Dax1, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132743 cd06945, NR_LBD_Nurr1_like, The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132734 cd06936, NR_LBD_Fxr, The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>gnl|CDD|132762 cd07348, NR_LBD_NGFI-B, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>gnl|CDD|132756 cd07071, NR_LBD_Nurr1, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>gnl|CDD|132737 cd06939, NR_LBD_ROR_like, The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132736 cd06938, NR_LBD_EcR, The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>gnl|CDD|132739 cd06941, NR_LBD_DmE78_like, The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132757 cd07072, NR_LBD_DHR38_like, Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132732 cd06934, NR_LBD_PXR_like, The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>gnl|CDD|132745 cd06947, NR_LBD_GR_Like, Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>gnl|CDD|132731 cd06933, NR_LBD_VDR, The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132761 cd07076, NR_LBD_GR, Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132760 cd07075, NR_LBD_MR, Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132759 cd07074, NR_LBD_PR, Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>gnl|CDD|132758 cd07073, NR_LBD_AR, Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
KOG4215|consensus 432 100.0
KOG4217|consensus605 100.0
KOG4216|consensus479 100.0
KOG4218|consensus475 100.0
KOG4846|consensus 538 100.0
cd06943207 NR_LBD_RXR_like The ligand binding domain of the r 100.0
cd07076247 NR_LBD_GR Ligand binding domain of the glucocortic 100.0
cd06949235 NR_LBD_ER Ligand binding domain of Estrogen recept 100.0
cd06937231 NR_LBD_RAR The ligand binding domain (LBD) of reti 100.0
cd07160101 NR_DBD_LXR DNA-binding domain of Liver X receptors 100.0
cd0695677 NR_DBD_RXR DNA-binding domain of retinoid X recept 99.98
cd06944237 NR_LBD_Ftz-F1_like The ligand binding domain of FT 99.98
cd06935243 NR_LBD_TR The ligand binding domain of thyroid hor 99.98
cd06940189 NR_LBD_REV_ERB The ligand binding domain of REV-ER 99.98
cd0696185 NR_DBD_TR DNA-binding domain of thyroid hormone re 99.97
cd06947246 NR_LBD_GR_Like Ligand binding domain of nuclear ho 99.97
cd07075248 NR_LBD_MR Ligand binding domain of the mineralocor 99.97
cd0696485 NR_DBD_RAR DNA-binding domain of retinoic acid rec 99.97
cd0717097 NR_DBD_ERR DNA-binding domain of estrogen related 99.97
cd0717182 NR_DBD_ER DNA-binding domain of estrogen receptors 99.97
cd0716191 NR_DBD_EcR DNA-binding domain of Ecdysone receptor 99.97
cd07070237 NR_LBD_SF-1 The ligand binding domain of nuclear r 99.97
cd06950206 NR_LBD_Tlx_PNR_like The ligand binding domain of T 99.97
cd07073246 NR_LBD_AR Ligand binding domain of the nuclear rec 99.97
cd06931222 NR_LBD_HNF4_like The ligand binding domain of hept 99.97
cd0715575 NR_DBD_ER_like DNA-binding domain of estrogen rece 99.97
cd07348238 NR_LBD_NGFI-B The ligand binding domain of Nurr1, 99.97
cd0716890 NR_DBD_DHR4_like DNA-binding domain of ecdysone-in 99.97
cd0696284 NR_DBD_FXR DNA-binding domain of Farnesoid X recep 99.97
cd07068221 NR_LBD_ER_like The ligand binding domain of estrog 99.97
cd0696787 NR_DBD_TR2_like DNA-binding domain of the TR2 and 99.97
cd0697092 NR_DBD_PNR DNA-binding domain of the photoreceptor 99.97
cd06929174 NR_LBD_F1 Ligand-binding domain of nuclear recepto 99.97
cd0716478 NR_DBD_PNR_like_1 DNA-binding domain of the photor 99.97
cd06930165 NR_LBD_F2 Ligand-binding domain of nuclear recepto 99.97
cd06946221 NR_LBD_ERR The ligand binding domain of estrogen r 99.97
cd07069241 NR_LBD_Lrh-1 The ligand binding domain of the live 99.97
cd0695782 NR_DBD_PNR_like_2 DNA-binding domain of the photor 99.97
cd07071238 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a 99.97
cd0716392 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is 99.97
cd06954236 NR_LBD_LXR The ligand binding domain of Liver X re 99.97
cd0716581 NR_DBD_DmE78_like DNA-binding domain of Drosophila 99.97
cd0716689 NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep 99.97
cd0716793 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 99.97
cd0716990 NR_DBD_GCNF_like DNA-binding domain of Germ cell n 99.97
cd06941195 NR_LBD_DmE78_like The ligand binding domain of Dro 99.97
cd0696694 NR_DBD_CAR DNA-binding domain of constitutive andr 99.97
cd06951222 NR_LBD_Dax1_like The ligand binding domain of DAX1 99.97
cd06945239 NR_LBD_Nurr1_like The ligand binding domain of Nur 99.97
cd0696076 NR_DBD_HNF4A DNA-binding domain of heptocyte nucle 99.97
cd0695973 NR_DBD_EcR_like The DNA-binding domain of Ecdysone 99.97
cd07074248 NR_LBD_PR Ligand binding domain of the progesteron 99.97
cd0695873 NR_DBD_COUP_TF DNA-binding domain of chicken ovalb 99.97
cd0696975 NR_DBD_NGFI-B DNA-binding domain of the orphan nuc 99.97
cd0715672 NR_DBD_VDR_like The DNA-binding domain of vitamin 99.97
cd06955107 NR_DBD_VDR DNA-binding domain of vitamin D recepto 99.97
cd0716287 NR_DBD_PXR DNA-binding domain of pregnane X recept 99.97
cd0717382 NR_DBD_AR DNA-binding domain of androgen receptor 99.97
cd06948236 NR_LBD_COUP-TF Ligand binding domain of chicken ov 99.97
cd0717974 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o 99.97
cd0696895 NR_DBD_ROR DNA-binding domain of Retinoid-related 99.97
cd07349222 NR_LBD_SHP The ligand binding domain of DAX1 prote 99.97
cd0696373 NR_DBD_GR_like The DNA binding domain of GR_like n 99.97
cd07072239 NR_LBD_DHR38_like Ligand binding domain of DHR38_l 99.97
cd0717278 NR_DBD_GR_PR DNA-binding domain of glucocorticoid 99.97
cd0715873 NR_DBD_Ppar_like The DNA-binding domain of peroxis 99.97
cd06934226 NR_LBD_PXR_like The ligand binding domain of xenob 99.97
cd0715473 NR_DBD_PNR_like The DNA-binding domain of the phot 99.97
cd07350232 NR_LBD_Dax1 The ligand binding domain of DAX1 prot 99.97
cd0691672 NR_DBD_like DNA-binding domain of nuclear receptor 99.97
cd06939241 NR_LBD_ROR_like The ligand binding domain of Retin 99.96
cd06953213 NR_LBD_DHR4_like The ligand binding domain of orph 99.96
cd0715786 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of 99.96
cd0696584 NR_DBD_Ppar DNA-binding domain of peroxisome proli 99.96
cd06933238 NR_LBD_VDR The ligand binding domain of vitamin D 99.96
cd06936221 NR_LBD_Fxr The ligand binding domain of Farnesoid 99.96
cd06938231 NR_LBD_EcR The ligand binding domain (LBD) of the 99.96
cd06932259 NR_LBD_PPAR The ligand binding domain of peroxisom 99.96
smart0039970 ZnF_C4 c4 zinc finger in nuclear hormone receptors 99.96
cd06942191 NR_LBD_Sex_1_like The ligand binding domain of Cae 99.96
cd06952222 NR_LBD_TR2_like The ligand binding domain of the o 99.96
PF0010570 zf-C4: Zinc finger, C4 type (two domains); InterPr 99.95
cd06157168 NR_LBD The ligand binding domain of nuclear recept 99.94
smart00430163 HOLI Ligand binding domain of hormone receptors. 99.94
PF00104203 Hormone_recep: Ligand-binding domain of nuclear ho 99.93
KOG3277|consensus165 82.23
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 80.7
PF01412116 ArfGap: Putative GTPase activating protein for Arf 80.45
>KOG4215|consensus Back     alignment and domain information
Probab=100.00  E-value=3.6e-70  Score=474.63  Aligned_cols=289  Identities=41%  Similarity=0.776  Sum_probs=247.1

Q ss_pred             CCcCcccCCCCCCcccccccchhhHHHHHhhhcCCCcccccCCCCcccccccccCchhhhhHHHHhcCcchhHHHHHHhh
Q psy3092          55 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEERQR  134 (347)
Q Consensus        55 ~~~C~VCg~~a~g~HyGv~sC~~Ck~FFRR~v~~~~~~~C~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~r~~  134 (347)
                      ...|.||||+|+|+||||.+|.||||||||+|+++..|.|+.+.+|.|||+.|+.||+|||+||+.+||++++||.+||+
T Consensus        19 ~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERDr   98 (432)
T KOG4215|consen   19 AEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERDR   98 (432)
T ss_pred             cchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhccccc
Confidence            35799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccccccccCCCCCCCCCcHHHHHHHHHhccCCCC------CCcc-c------cchhHHHhhhhHHHHHHHHHHHHHHh
Q psy3092         135 TKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQE------PADQ-D------IVNEQQATNICKATDKQLFQLVDWAK  201 (347)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~------~~~~-~------~~~~~~~~~~~~~~~~~l~~~~~w~k  201 (347)
                      +..+.+....   +...+..++.++.++..+.....      +... +      .-......++++....++..+|||||
T Consensus        99 Ig~Rr~~~~~---~n~~~~~id~L~~aE~~~~q~~~srs~~~~~~~~d~r~~~~n~~~at~~Dv~eSm~qqLlllVEWAK  175 (432)
T KOG4215|consen   99 IGSRRPSYEA---GNENSPSIDALVQAEALVRQLRSSRSGGVPGIDGDIRQGPPNKKIATENDVCESMKQQLLLLVEWAK  175 (432)
T ss_pred             ccccCCCCCC---CCCCchhHHHHHhHHHHHhhhhccccccCcCcchhhhcCccccccccHHHHHHHHHHHHHHHHHHHH
Confidence            8775432211   11233345666666654432211      1000 0      11224567889999999999999999


Q ss_pred             hCCCCCCCCHHHHHHHHHHHHHHHHHHHhhcccccCCCceEecCCccccccchhhcCchhhHHhhHHHHHHHHHhcCCCH
Q psy3092         202 HIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDK  281 (347)
Q Consensus       202 ~~p~F~~L~~~dq~~Llk~~~~~~~~l~~a~~s~~~~~~~~~~~g~~i~~~~~~~~~~~~~~~~~~~~l~~~l~~L~l~~  281 (347)
                      .+|.|.+|+.+||+.|||+...+.+++..++|++..++..++.+...+..+..+......+..|+++|++.||++|++|+
T Consensus       176 ~i~~F~el~l~DqvaLLk~~a~~hllLg~a~RSm~l~~v~ll~N~~v~~~~~~~~~eis~v~~RIiDElv~Pmr~L~md~  255 (432)
T KOG4215|consen  176 YIPPFCELPLDDQVALLKAHAGQHLLLGAAFRSMHLKDVCLLNNTYVLHRHAPDLPEISRVAPRIIDELVNPMRRLQMDE  255 (432)
T ss_pred             hccchhcCCchhHHHHHHccchhhhhhhhhhccccccceEEecCceeeccCCCChHHHHHHHHHHHHHHhhHHHHhccch
Confidence            99999999999999999999999999999999999989888888887777666555566788899999999999999999


Q ss_pred             hHHHHHHHHHhhcCCCCCCCCH--HHHHHHHHHHHHHHHHHHHhcCC-CCchHHHHHHhhhhhhhccC
Q psy3092         282 TELGCLRTIILFNPDVRGLKSQ--QVVEMLREKVYTSLEEYTRVNHS-EEPGRFAKLLLRLPSLRSIE  346 (347)
Q Consensus       282 ~E~~lL~ai~l~~p~~~~l~~~--~~i~~~r~~~~~~L~~y~~~~~~-~~~~Rf~~LL~ll~~lr~i~  346 (347)
                      .||++||||+||+|+..||++.  ..|+++|++++..|+.|+..+.+ +.+.|||+||++||+|++|+
T Consensus       256 ~Ey~cLKAi~FfdP~akGis~~s~~~I~~aR~~vl~sLe~yi~d~q~~d~~~R~g~LLLllPsLqsIt  323 (432)
T KOG4215|consen  256 IEYVCLKAIAFFDPDAKGLSDPSQIRIREARNRVLKSLEAYISDRQPYDAPGRFGNLLLLLPSLQSIT  323 (432)
T ss_pred             HHHHHHHHHHhcCccccccCCchHhHHHHHHHHHHHHHHHHHhhcCccccccchhhHHHHHHHHHHHH
Confidence            9999999999999999999984  48999999999999999998875 78999999999999999874



>KOG4217|consensus Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>smart00430 HOLI Ligand binding domain of hormone receptors Back     alignment and domain information
>PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>KOG3277|consensus Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
3dzu_A467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 1e-114
1z5x_U262 Hemipteran Ecdysone Receptor Ligand-Binding Domain 2e-88
1lbd_A282 Ligand-Binding Domain Of The Human Nuclear Receptor 2e-84
1xiu_A230 Crystal Structure Of The Agonist-Bound Ligand-Bindi 7e-77
2gl8_A241 Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi 8e-75
3eyb_A219 Structural And Functional Insights Into The Ligand 2e-74
1mv9_A240 Crystal Structure Of The Human Rxr Alpha Ligand Bin 4e-74
3e94_A244 Crystal Structure Of Rxralpha Ligand Binding Domain 4e-74
3uvv_B244 Crystal Structure Of The Ligand Binding Domains Of 5e-74
1fby_A239 Crystal Structure Of The Human Rxr Alpha Ligand Bin 6e-74
1fm6_A238 The 2.1 Angstrom Resolution Crystal Structure Of Th 6e-74
1rdt_A242 Crystal Structure Of A New Rexinoid Bound To The Rx 6e-74
3a9e_A240 Crystal Structure Of A Mixed Agonist-Bound Rar-Alph 7e-74
3pcu_A230 Crystal Structure Of Human Retinoic X Receptor Alph 8e-74
1xls_A232 Crystal Structure Of The Mouse CarRXR LBD HETERODIM 9e-74
3oap_A231 Crystal Structure Of Human Retinoid X Receptor Alph 9e-74
1xv9_A236 Crystal Structure Of CarRXR HETERODIMER BOUND WITH 9e-74
3h0a_A228 Crystal Structure Of Peroxisome Proliferator-Activa 9e-74
1xdk_A238 Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN 1e-73
2nxx_A235 Crystal Structure Of The Ligand-Binding Domains Of 4e-73
1uhl_A236 Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero 9e-73
1dkf_A233 Crystal Structure Of A Heterodimeric Complex Of Rar 1e-72
1h9u_A224 The Structure Of The Human Retinoid-X-Receptor Beta 3e-72
2q60_A258 Crystal Structure Of The Ligand Binding Domain Of P 2e-71
1hg4_A279 Ultraspiracle Ligand Binding Domain From Drosophila 5e-44
1g2n_A264 Crystal Structure Of The Ligand Binding Domain Of T 1e-38
1r1k_A263 Crystal Structure Of The Ligand-Binding Domains Of 1e-38
1r0o_A86 Crystal Structure Of The Heterodimeric Ecdysone Rec 4e-33
2han_A93 Structural Basis Of Heterodimeric Ecdysteroid Recep 6e-33
1ynw_B99 Crystal Structure Of Vitamin D Receptor And 9-Cis R 1e-32
1dsz_B85 Structure Of The RxrRAR DNA-Binding Domain Heterodi 6e-28
1rxr_A83 High Resolution Solution Structure Of The Retinoid 7e-28
1lv2_A229 Hepatocyte Nuclear Factor 4 Is A Transcription Fact 2e-27
3cjw_A244 Crystal Structure Of The Human Coup-Tfii Ligand Bin 3e-27
1by4_A82 Structure And Mechanism Of The Homodimeric Assembly 9e-27
1m7w_A250 Hnf4a Ligand Binding Domain With Bound Fatty Acid L 2e-26
3fs1_A230 Crystal Structure Of Hnf4a Lbd In Complex With The 7e-26
1pzl_A237 Crystal Structure Of Hnf4a Lbd In Complex With The 8e-26
1r0n_A81 Crystal Structure Of Heterodimeric Ecdsyone Recepto 2e-25
4dos_A242 Human Nuclear Receptor Liver Receptor Homologue-1, 3e-24
1yuc_A255 Human Nuclear Receptor Liver Receptor Homologue-1, 4e-24
1vjb_A251 Crystal Structure Of The Ligand-Binding Domain Of T 4e-24
1s9q_A251 Crystal Structure Of The Ligand-Binding Domain Of T 4e-24
1s9p_A227 Crystal Structure Of The Ligand-Binding Domain Of T 4e-24
2e2r_A244 Crystal Structure Of Human Estrogen-Related Recepto 4e-24
2ewp_A226 Crystal Structure Of Estrogen Related Receptor-3 (E 4e-24
1kv6_A230 X-Ray Structure Of The Orphan Nuclear Receptor Err3 4e-24
1zdu_A245 The Crystal Structure Of Human Liver Receptor Homol 4e-24
3plz_A257 Human Lrh1 Lbd Bound To Gr470 Length = 257 5e-24
1yok_A256 Crystal Structure Of Human Lrh-1 Bound With Tif-2 P 5e-24
3dzu_D419 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 6e-24
3tx7_B352 Crystal Structure Of Lrh-1BETA-Catenin Complex Leng 8e-24
1pk5_A248 Crystal Structure Of The Orphan Nuclear Receptor Lr 9e-24
1zh7_A243 Structural And Biochemical Basis For Selective Repr 2e-23
2nll_A66 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 4e-20
3cbb_A78 Crystal Structure Of Hepatocyte Nuclear Factor 4alp 5e-19
3a9e_B269 Crystal Structure Of A Mixed Agonist-Bound Rar-Alph 1e-18
3p0u_A249 Crystal Structure Of The Ligand Binding Domain Of H 2e-18
1dkf_B235 Crystal Structure Of A Heterodimeric Complex Of Rar 2e-18
3kmr_A266 Crystal Structure Of Raralpha Ligand Binding Domain 2e-18
4dqm_A234 Revealing A Marine Natural Product As A Novel Agoni 2e-18
1xdk_B303 Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN 2e-18
1ymt_A246 Mouse Sf-1 Lbd Length = 246 5e-18
1xap_A267 Structure Of The Ligand Binding Domain Of The Retin 5e-18
1yp0_A239 Structure Of The Steroidogenic Factor-1 Ligand Bind 2e-17
2ebl_A89 Solution Structure Of The Zinc Finger, C4-type Doma 3e-17
3f7d_A244 Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 1e-16
3d24_A253 Crystal Structure Of Ligand-Binding Domain Of Estro 1e-15
3k6p_A248 Estrogen Related Receptor Alpha In Complex With An 1e-15
1xb7_A247 X-Ray Structure Of Erralpha Lbd In Complex With A P 1e-15
3n00_A245 Crystal Structure Of A Deletion Mutant Of Human Rev 3e-15
1dsz_A86 Structure Of The RxrRAR DNA-Binding Domain Heterodi 4e-15
2a66_A113 Human Liver Receptor Homologue Dna-Binding Domain ( 1e-14
2xhs_A245 Crystal Structure Of The Ligand Binding Domain Of F 1e-14
2pjl_A247 Crystal Structure Of Human Estrogen-Related Recepto 2e-14
1exa_A246 Enantiomer Discrimination Illustrated By Crystal St 6e-14
2ff0_A102 Solution Structure Of Steroidogenic Factor 1 Dna Bi 6e-14
1fcx_A235 Isotype Selectivity Of The Human Retinoic Acid Nucl 6e-14
2lbd_A267 Ligand-Binding Domain Of The Human Retinoic Acid Re 6e-14
1fcy_A236 Isotype Selectivity Of The Human Retinoic Acid Nucl 6e-14
3m9e_A105 Thyroid Hormone Beta Dna Binding Domain Homodimer W 9e-14
1r0n_B109 Crystal Structure Of Heterodimeric Ecdsyone Recepto 1e-13
2acl_B244 Liver X-Receptor Alpha Ligand Binding Domain With S 1e-13
3fc6_B266 Hrxralpha & Mlxralpha With An Indole Pharmacophore, 1e-13
2han_B119 Structural Basis Of Heterodimeric Ecdysteroid Recep 2e-13
1hra_A80 The Solution Structure Of The Human Retinoic Acid R 2e-13
1qkn_A255 Rat Oestrogen Receptor Beta Ligand-Binding Domain I 2e-13
2j7x_A255 Structure Of Estradiol-bound Estrogen Receptor Beta 2e-13
2fsz_A246 A Second Binding Site For Hydroxytamoxifen Within T 2e-13
1p8d_A250 X-Ray Crystal Structure Of Lxr Ligand Binding Domai 2e-13
1pq6_A253 Human Lxr Beta Hormone Receptor / Gw3965 Complex Le 2e-13
1upv_A257 Crystal Structure Of The Human Liver X Receptor Bet 2e-13
1nav_A263 Thyroid Receptor Alpha In Complex With An Agonist S 3e-13
4dk8_A247 Crystal Structure Of Lxr Ligand Binding Domain In C 3e-13
2h77_A269 Crystal Structure Of Human Tr Alpha Bound T3 In Mon 4e-13
3hzf_A269 Structure Of Tr-alfa Bound To Selective Thyromimeti 4e-13
2h79_A269 Crystal Structure Of Human Tr Alpha Bound T3 In Ort 4e-13
3jzb_A267 Crystal Structure Of Tr-Alfa Bound To The Selective 4e-13
3cqv_A199 Crystal Structure Of Reverb Beta In Complex With He 5e-13
1cit_A89 Dna-Binding Mechanism Of The Monomeric Orphan Nucle 5e-13
1yy4_A268 Crystal Structure Of Estrogen Receptor Beta Complex 5e-13
2v0v_A194 Crystal Structure Of Rev-Erb Beta Length = 194 5e-13
1hlz_A94 Crystal Structure Of The Orphan Nuclear Receptor Re 5e-13
2v7c_A194 Crystal Structure Of Rev-Erb Beta Length = 194 6e-13
2yat_A252 Crystal Structure Of Estradiol Derived Metal Chelat 6e-13
1uom_A254 The Structure Of Estrogen Receptor In Complex With 6e-13
1qkt_A248 Mutant Estrogen Nuclear Receptor Ligand Binding Dom 7e-13
1pcg_A244 Helix-Stabilized Cyclic Peptides As Selective Inhib 7e-13
3ltx_A243 Crystal Structure Of The Pacific Oyster Estrogen Re 7e-13
1l2j_A271 Human Estrogen Receptor Beta Ligand-Binding Domain 7e-13
2i0g_A257 Benzopyrans Are Selective Estrogen Receptor Beta Ag 8e-13
2ocf_A298 Human Estrogen Receptor Alpha Ligand-Binding Domain 8e-13
1qkm_A255 Human Oestrogen Receptor Beta Ligand-Binding Domain 8e-13
2nll_B103 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 9e-13
2jfa_B252 Estrogen Receptor Alpha Lbd In Complex With An Affi 9e-13
1nde_A255 Estrogen Receptor Beta With Selective Triazine Modu 9e-13
1u9e_A241 Crystal Structure Of Estrogen Receptor Beta Complex 9e-13
1x76_A240 Crystal Structure Of Estrogen Receptor Beta Complex 9e-13
2nv7_A238 Crystal Structure Of Estrogen Receptor Beta Complex 1e-12
1l2i_A261 Human Estrogen Receptor Alpha Ligand-Binding Domain 1e-12
2giu_A241 Human Estrogen Receptor Beta Ligand-Binding Domain 1e-12
3q95_B260 Crystal Structure Of Human Estrogen Receptor Alpha 1e-12
3uu7_A251 Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi 1e-12
3l0e_A253 X-Ray Crystal Structure Of A Potent Liver X Recepto 1e-12
2yly_A240 Sulfonamides As Selective Estrogen Receptor Beta Ag 1e-12
3q97_A260 Crystal Structure Of Human Estrogen Receptor Alpha 1e-12
3oll_A240 Crystal Structure Of Phosphorylated Estrogen Recept 1e-12
1zky_A257 Human Estrogen Receptor Alpha Ligand-Binding Domain 1e-12
3uvv_A265 Crystal Structure Of The Ligand Binding Domains Of 1e-12
3uu7_B251 Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi 1e-12
3hm1_A253 Crystal Structure Of Human Estrogen Receptor Alpha 1e-12
1zaf_A238 Crystal Structure Of Estrogen Receptor Beta Complex 1e-12
2bj4_A252 Estrogen Receptor Alpha Lbd In Complex With A Phage 1e-12
3hlv_A253 Crystal Structure Of Human Estrogen Receptor Alpha 2e-12
3dt3_A255 Human Estrogen Receptor Alpha Lbd With Gw368 Length 2e-12
1gwq_A248 Human Oestrogen Receptor Alpha Ligand-Binding Domai 2e-12
1g50_A247 Crystal Structure Of A Wild Type Her Alpha Lbd At 2 2e-12
3q95_A260 Crystal Structure Of Human Estrogen Receptor Alpha 2e-12
2qa8_B258 Crystal Structure Of The Estrogen Receptor Alpha Li 2e-12
3erd_A261 Human Estrogen Receptor Alpha Ligand-Binding Domain 2e-12
3uua_A251 Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi 2e-12
2p15_A258 Crystal Structure Of The Er Alpha Ligand Binding Do 2e-12
2qxs_A258 Crystal Structure Of Antagonizing Mutant 536s Of Th 2e-12
1ere_A253 Human Estrogen Receptor Ligand-Binding Domain In Co 2e-12
1sj0_A248 Human Estrogen Receptor Alpha Ligand-binding Domain 2e-12
2iok_A254 Human Estrogen Receptor Alpha Ligand-binding Domain 2e-12
2iog_A246 Human Estrogen Receptor Alpha Ligand-Binding Domain 2e-12
1err_A253 Human Estrogen Receptor Ligand-Binding Domain In Co 2e-12
3uuc_A251 Crystal Structure Of Hera-Lbd (Wt) In Complex With 2e-12
2qa8_A258 Crystal Structure Of The Estrogen Receptor Alpha Li 2e-12
1gwr_A245 Human Oestrogen Receptor Alpha Ligand-Binding Domai 2e-12
3l03_A253 Crystal Structure Of Human Estrogen Receptor Alpha 2e-12
1qku_A250 Wild Type Estrogen Nuclear Receptor Ligand Binding 2e-12
2qzo_B258 Crystal Structure Of The Estrogen Receptor Alpha Li 2e-12
4dma_A247 Crystal Structure Of Era Lbd In Complex With Ru1001 2e-12
3uua_B251 Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi 2e-12
1a52_A258 Estrogen Receptor Alpha Ligand-Binding Domain Compl 3e-12
1x7e_A245 Crystal Structure Of Estrogen Receptor Alpha Comple 3e-12
3os8_A258 Estrogen Receptor Length = 258 6e-12
1lo1_A98 Estrogen Related Receptor 2 Dna Binding Domain In C 1e-11
3os8_C258 Estrogen Receptor Length = 258 1e-11
2env_A88 Solution Sturcture Of The C4-Type Zinc Finger Domai 1e-11
1uhl_B242 Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero 1e-11
1ovl_A271 Crystal Structure Of Nurr1 Lbd Length = 271 1e-11
1ovl_B271 Crystal Structure Of Nurr1 Lbd Length = 271 1e-11
3ipq_A283 X-Ray Structure Of Gw3965 Synthetic Agonist Bound T 1e-11
1zdt_A241 The Crystal Structure Of Human Steroidogenic Factor 2e-11
1hcq_A84 The Crystal Structure Of The Estrogen Receptor Dna- 2e-11
1i7i_A292 Crystal Structure Of The Ligand Binding Domain Of H 2e-11
1nyx_A276 Ligand Binding Domain Of The Human Peroxisome Proli 2e-11
3s9s_A284 Ligand Binding Domain Of Ppargamma Complexed With A 2e-11
2om9_A278 Ajulemic Acid, A Synthetic Cannabinoid Bound To Ppa 2e-11
4dk7_A247 Crystal Structure Of Lxr Ligand Binding Domain In C 2e-11
2i4j_A286 Crystal Structure Of The Complex Between Ppargamma 2e-11
2vsr_A276 Hppargamma Ligand Binding Domain In Complex With 9- 2e-11
1rdt_D284 Crystal Structure Of A New Rexinoid Bound To The Rx 2e-11
3osi_A285 Crystal Structure Of Ppargamma Ligand Binding Domai 2e-11
3ads_A287 Human Ppargamma Ligand-Binding Domain In Complex Wi 2e-11
3lmp_A283 Crystal Structure Of The Ppargamma-Lbd Complexed Wi 2e-11
1yow_A242 Human Steroidogenic Factor 1 Lbd With Bound Co-Fact 2e-11
1k74_D283 The 2.3 Angstrom Resolution Crystal Structure Of Th 2e-11
1wm0_X292 Ppargamma In Complex With A 2-Baba Compound Length 2e-11
3vn2_A285 Crystal Structure Of Ppargamma Complexed With Telmi 2e-11
1zeo_A277 Crystal Structure Of Human Ppar-Gamma Ligand Bindin 2e-11
3bc5_A296 X-Ray Crystal Structure Of Human Ppar Gamma With 2- 2e-11
2vv1_B276 Hppargamma Ligand Binding Domain In Complex With 4- 2e-11
3b0q_A274 Human Ppar Gamma Ligand Binding Domain In Complex W 2e-11
3cs8_A275 Structural And Biochemical Basis For The Binding Se 2e-11
2q59_B274 Crystal Structure Of Ppargamma Lbd Bound To Full Ag 2e-11
3pba_A286 Crystal Structure Of Ppargamma Ligand Binding Domai 2e-11
3et3_A292 Structure Of Ppargamma With 3-[5-Methoxy-1-(4-Metho 2e-11
3r8a_A282 X-Ray Crystal Structure Of The Nuclear Hormone Rece 2e-11
2vv4_B276 Hppargamma Ligand Binding Domain In Complex With 6- 2e-11
4prg_A270 0072 Partial Agonist Ppar Gamma Cocrystal Length = 2e-11
3prg_A278 Ligand Binding Domain Of Human Peroxisome Prolifera 2e-11
2zvt_A286 Cys285ser Mutant Ppargamma Ligand-Binding Domain Co 2e-11
1fm6_D272 The 2.1 Angstrom Resolution Crystal Structure Of Th 2e-11
3cwd_A270 Molecular Recognition Of Nitro-Fatty Acids By Ppar 2e-11
2prg_A271 Ligand-Binding Domain Of The Human Peroxisome Proli 2e-11
2hfp_A282 Crystal Structure Of Ppar Gamma With N-Sulfonyl-2-I 2e-11
1knu_A274 Ligand Binding Domain Of The Human Peroxisome Proli 2e-11
3t03_A284 Crystal Structure Of Ppar Gamma Ligand Binding Doma 2e-11
3u9q_A269 Ligand Binding Domain Of Ppargamma Complexed With D 2e-11
2q59_A274 Crystal Structure Of Ppargamma Lbd Bound To Full Ag 3e-11
3et0_A292 Structure Of Ppargamma With 3-(5-Methoxy-1h-Indol-3 3e-11
4aa6_E71 The Oestrogen Receptor Recognizes An Imperfectly Pa 9e-11
4aa6_A71 The Oestrogen Receptor Recognizes An Imperfectly Pa 9e-11
2j4a_A253 Human Thyroid Hormone Receptor Beta Ligand Binding 9e-11
1hcp_A76 Dna Recognition By The Oestrogen Receptor: From Sol 9e-11
3hc6_A232 Fxr With Src1 And Gsk088 Length = 232 1e-10
3gd2_A229 Isoxazole Ligand Bound To Farnesoid X Receptor (Fxr 1e-10
1lat_A82 Glucocorticoid Receptor MutantDNA COMPLEX Length = 1e-10
2b50_A272 Human Nuclear Receptor-Ligand Complex 2 Length = 27 1e-10
3p88_A229 Fxr Bound To Isoquinolinecarboxylic Acid Length = 2 1e-10
2q5g_A283 Ligand Binding Domain Of Ppar Delta Receptor In Com 2e-10
2awh_A268 Human Nuclear Receptor-Ligand Complex 1 Length = 26 2e-10
3p89_A229 Fxr Bound To A Quinolinecarboxylic Acid Length = 22 2e-10
3et2_A287 Structure Of Ppardelta With 3-[5-Methoxy-1-(4-Metho 2e-10
2j14_A285 3,4,5-Trisubstituted Isoxazoles As Novel Ppardelta 2e-10
1osv_A230 Structural Basis For Bile Acid Binding And Activati 2e-10
2gwx_A267 Molecular Recognition Of Fatty Acids By Peroxisome 2e-10
1nuo_A261 Two Rth Mutants With Impaired Hormone Binding Lengt 2e-10
1ot7_A229 Structural Basis For 3-Deoxy-Cdca Binding And Activ 2e-10
3sp9_A281 Structural Basis For Iloprost As A Dual PparalphaDE 2e-10
2xyj_A288 Novel Sulfonylthiadiazoles With An Unusual Binding 2e-10
2znp_A276 Human Pprr Delta Ligand Binding Domain In Complex W 2e-10
1y0s_A272 Crystal Structure Of Ppar Delta Complexed With Gw23 2e-10
1gwx_A271 Molecular Recognition Of Fatty Acids By Peroxisome 2e-10
3dct_A235 Fxr With Src1 And Gw4064 Length = 235 2e-10
1q4x_A253 Crystal Structure Of Human Thyroid Hormone Receptor 2e-10
1r6g_A259 Crystal Structure Of The Thyroid Hormone Receptor B 2e-10
3fxv_A233 Identification Of An N-Oxide Pyridine Gw4064 Analog 2e-10
1bsx_A260 Structure And Specificity Of Nuclear Receptor-Coact 2e-10
1xzx_X281 Thyroxine-Thyroid Hormone Receptor Interactions Len 2e-10
3tkm_A275 Crystal Structure Ppar Delta Binding Gw0742 Length 2e-10
3bej_A238 Structure Of Human Fxr In Complex With Mfa-1 And Co 2e-10
3g9p_B90 Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 2e-10
1nq0_A263 Tr Receptor Mutations Conferring Hormone Resistance 2e-10
1nax_A252 Thyroid Receptor Beta1 In Complex With A Beta-Selec 2e-10
1n46_A258 Crystal Structure Of Human Tr Beta Ligand-Binding D 2e-10
1nq1_A263 Tr Receptor Mutations Conferring Hormone Resistance 2e-10
3l1b_A233 Complex Structure Of Fxr Ligand-Binding Domain With 3e-10
1osh_A232 A Chemical, Genetic, And Structural Analysis Of The 3e-10
3fli_A231 Discovery Of Xl335, A Highly Potent, Selective And 3e-10
3hc5_A232 Fxr With Src1 And Gsk826 Length = 232 3e-10
1nq2_A264 Two Rth Mutants With Impaired Hormone Binding Lengt 3e-10
3jzc_A263 Crystal Structure Of Tr-Beta Bound To The Selective 3e-10
3imy_A261 Structure Of Tr-Beta Bound To Selective Thyromimeti 3e-10
3gws_X259 Crystal Structure Of T3-Bound Thyroid Hormone Recep 3e-10
3rut_A229 Fxr With Src1 And Gsk359 Length = 229 3e-10
3d57_A266 Tr Variant D355r Length = 266 3e-10
2pin_A253 Thyroid Receptor Beta In Complex With Inhibitor Len 4e-10
1ynw_A110 Crystal Structure Of Vitamin D Receptor And 9-Cis R 8e-10
3gz9_A269 Crystal Structure Of Peroxisome Proliferator-Activa 1e-09
4hn6_A114 Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl 1e-09
2nxx_E248 Crystal Structure Of The Ligand-Binding Domains Of 2e-09
3g6t_A91 Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L 2e-09
1kb2_A110 Crystal Structure Of Vdr Dna-Binding Domain Bound T 3e-09
1z5x_E310 Hemipteran Ecdysone Receptor Ligand-Binding Domain 3e-09
1gdc_A72 Refined Solution Structure Of The Glucocorticoid Re 3e-09
2gda_A72 Refined Solution Structure Of The Glucocorticoid Re 4e-09
1r4o_A92 Crystallographic Analysis Of The Interaction Of The 4e-09
1r4r_B92 Crystallographic Analysis Of The Interaction Of The 4e-09
1yje_A264 Crystal Structure Of The Rngfi-B Ligand-Binding Dom 5e-09
3v3e_B257 Crystal Structure Of The Human Nur77 Ligand-Binding 5e-09
2qw4_A273 Human Nr4a1 Ligand-Binding Domain Length = 273 6e-09
2c7a_A78 Structure Of The Progesterone Receptor-Dna Complex 1e-08
1rgd_A71 Structure Refinement Of The Glucocorticoid Receptor 1e-08
4hn5_A117 Gr Dna Binding Domain - Tslp Ngre Complex Length = 1e-08
1glu_A81 Crystallographic Analysis Of The Interaction Of The 1e-08
1r20_D265 Crystal Structure Of The Ligand-Binding Domains Of 2e-08
3vhu_A294 Mineralocorticoid Receptor Ligand-Binding Domain Wi 4e-08
3vhv_A260 Mineralocorticoid Receptor Ligand-Binding Domain Wi 4e-08
2aa6_A275 Mineralocorticoid Receptor S810l Mutant With Bound 4e-08
1i7g_A287 Crystal Structure Of The Ligand Binding Domain From 7e-08
1r1k_D266 Crystal Structure Of The Ligand-Binding Domains Of 7e-08
2znn_A273 Human Pprr Alpha Ligand Binding Domain In Complex W 8e-08
2rew_A277 Crystal Structure Of Pparalpha Ligand Binding Domai 8e-08
1r4i_A105 Crystal Structure Of Androgen Receptor Dna-Binding 8e-08
3sp6_A285 Structural Basis For Iloprost As A Dual PparalphaDE 9e-08
3et1_A291 Structure Of Pparalpha With 3-[5-Methoxy-1-(4-Metho 9e-08
1k7l_A288 The 2.5 Angstrom Resolution Crystal Structure Of Th 9e-08
2p54_A267 A Crystal Structure Of Ppar Alpha Bound With Src1 P 9e-08
2npa_A270 The Crystal Structure Of The Human Pparaplpha Ligan 9e-08
3g8i_A270 Aleglitazar, A New, Potent, And Balanced Ppar Alpha 1e-07
1kkq_A269 Crystal Structure Of The Human Ppar-Alpha Ligand-Bi 1e-07
1n4h_A259 Characterization Of Ligands For The Orphan Nuclear 1e-07
2hbh_A302 Crystal Structure Of Vitamin D Nuclear Receptor Lig 1e-07
1y9r_A255 Crystal Structure Of The Human Mineralocorticoid Re 1e-07
2oax_A256 Crystal Structure Of The S810l Mutant Mineralocorti 1e-07
1ilg_A316 Crystal Structure Of Apo Human Pregnane X Receptor 2e-07
4fhh_A300 Development Of Synthetically Accessible Non-Secoste 2e-07
1k4w_A252 X-Ray Structure Of The Orphan Nuclear Receptor Ror 2e-07
1skx_A313 Structural Disorder In The Complex Of Human Pxr And 2e-07
1nq7_A244 Characterization Of Ligands For The Orphan Nuclear 2e-07
3ctb_A344 Tethered Pxr-LbdSRC-1p Apoprotein Length = 344 2e-07
3mno_A261 Crystal Structure Of The Agonist Form Of Mouse Gluc 2e-07
2o9i_A293 Crystal Structure Of The Human Pregnane X Receptor 3e-07
3e7c_A257 Glucocorticoid Receptor Lbd Bound To Gsk866 Length 3e-07
3cld_A259 Ligand Binding Domain Of The Glucocorticoid Recepto 3e-07
1xv9_B246 Crystal Structure Of CarRXR HETERODIMER BOUND WITH 3e-07
2aa2_A275 Mineralocorticoid Receptor With Bound Aldosterone L 3e-07
2a3i_A253 Structural And Biochemical Mechanisms For The Speci 3e-07
3mnp_A261 Crystal Structure Of The Agonist Form Of Mouse Gluc 4e-07
3f5c_B268 Structure Of Dax-1:lrh-1 Complex Length = 268 4e-07
3mne_A261 Crystal Structure Of The Agonist Form Of Mouse Gluc 6e-07
1i38_A260 Crystal Structure Of The Rat Androgen Receptor Liga 7e-07
1i37_A260 Crystal Structure Of The Rat Androgen Receptor Liga 7e-07
3g8o_A263 Progesterone Receptor With Bound Pyrrolidine 1 Leng 7e-07
1e3k_A258 Human Progesteron Receptor Ligand Binding Domain In 7e-07
1sr7_A259 Progesterone Receptor Hormone Binding Domain With B 8e-07
2q7k_A257 The Androgen Receptor Prostate Cancer Mutant H874y 8e-07
1a28_A256 Hormone-Bound Human Progesterone Receptor Ligand-Bi 8e-07
2ax6_A256 Crystal Structure Of The Androgen Receptor Ligand B 8e-07
1xj7_A257 Complex Androgen Receptor Lbd And Rac3 Peptide Leng 8e-07
1t73_A269 Crystal Structure Of The Androgen Receptor Ligand B 8e-07
3h52_A254 Crystal Structure Of The Antagonist Form Of Human G 8e-07
2am9_A266 Crystal Structure Of Human Androgen Receptor Ligand 8e-07
1t5z_A251 Crystal Structure Of The Androgen Receptor Ligand B 8e-07
2ax9_A256 Crystal Structure Of The Androgen Receptor Ligand B 8e-07
1e3g_A263 Human Androgen Receptor Ligand Binding In Complex W 8e-07
1pdu_A244 Ligand-Binding Domain Of Drosophila Orphan Nuclear 9e-07
2w8y_A260 Ru486 Bound To The Progesterone Receptor In A Desta 9e-07
2hvc_A250 The Crystal Structure Of Ligand-Binding Domain (Lbd 9e-07
1sqn_A261 Progesterone Receptor Ligand Binding Domain With Bo 9e-07
1nhz_A280 Crystal Structure Of The Antagonist Form Of Glucoco 9e-07
2abi_A256 Crystal Structure Of The Human Mineralocorticoid Re 9e-07
3a2i_A263 Crystal Structure Of The Human Vitamin D Receptor ( 1e-06
3a2j_A263 Crystal Structure Of The Human Vitamin D Receptor ( 1e-06
3kba_A253 Progesterone Receptor Bound To Sulfonamide Pyrrolid 1e-06
1gs4_A248 Structural Basis For The Glucocorticoid Response In 1e-06
2z4j_A248 Crystal Structure Of Ar Lbd With Shp Peptide Nr Box 1e-06
3rlj_A247 Crystal Structure Of The Androgen Receptor Ligand B 1e-06
2oz7_A249 Crystal Structure Of The Human Androgen Receptor T8 1e-06
1xow_A249 Crystal Structure Of The Human Androgen Receptor Li 1e-06
3rll_A247 Crystal Structure Of The T877a Androgen Receptor Li 1e-06
3l3x_A250 Crystal Structure Of Dht-Bound Androgen Receptor In 1e-06
1n83_A270 Crystal Structure Of The Complex Between The Orphan 1e-06
3bqd_A255 Doubling The Size Of The Glucocorticoid Receptor Li 1e-06
1m2z_A257 Crystal Structure Of A Dimer Complex Of The Human G 2e-06
3m7r_A253 Crystal Structure Of Vdr H305q Mutant Length = 253 2e-06
2zl9_A271 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26 2e-06
1db1_A259 Crystal Structure Of The Nuclear Receptor For Vitam 2e-06
4e2j_A250 X-Ray Crystal Structure Of The Ancestral Glucocorti 2e-06
1s0z_A263 Crystal Structure Of The Vdr Lbd Complexed To Seoca 2e-06
3gn8_A249 X-Ray Crystal Structure Of Ancgr2 In Complex With D 2e-06
3p8x_A280 Synthesis, Structure, And Biological Activity Of De 2e-06
2zfx_A265 Crystal Structure Of The Rat Vitamin D Receptor Lig 3e-06
1rjk_A292 Crystal Structure Of The Rat Vitamin D Receptor Lig 3e-06
3b0t_A254 Human Vdr Ligand Binding Domain In Complex With Max 3e-06
3az1_A253 Crystal Structure Analysis Of Vitamin D Receptor Le 3e-06
4fne_A254 X-Ray Crystal Structure Of The Ancestral 3-Keto Ste 5e-06
2q3y_A249 Ancestral Corticiod Receptor In Complex With Doc Le 8e-06
1xnx_A256 Crystal Structure Of Constitutive Androstane Recept 9e-06
2q1h_A250 Ancestral Corticoid Receptor In Complex With Aldost 9e-06
1xls_E242 Crystal Structure Of The Mouse CarRXR LBD HETERODIM 1e-05
3ry9_A250 Crystal Structure Of The Resurrected Ancestral Gluc 2e-05
2ax8_A256 Crystal Structure Of The Androgen Receptor Ligand B 4e-05
1z95_A246 Crystal Structure Of The Androgen Receptor Ligand-B 5e-05
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure

Iteration: 1

Score = 409 bits (1050), Expect = e-114, Method: Compositional matrix adjust. Identities = 203/309 (65%), Positives = 236/309 (76%), Gaps = 10/309 (3%) Query: 47 PNHP----LCGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCII 102 P HP +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDL+Y CR+ ++C+I Sbjct: 125 PAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLI 184 Query: 103 DXXXXXXXXXXXXXXXLNMGMKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAE 162 D L MGMKREAVQEERQR K+R+ NEVESTS +MPVERILEAE Sbjct: 185 DKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAE 244 Query: 163 QRVDMKQEPADQDIVN------EQQATNICKATDKQLFQLVDWAKHIPHFTTLPLEDQVL 216 V+ K E + + TNIC+A DKQLF LV+WAK IPHF+ LPL+DQV+ Sbjct: 245 LAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVI 304 Query: 217 LLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMRE 276 LLRAGWNELLIASFSHRSI+VKDGILLA G+ V+R+SAH AGVG IFDRVLTELVSKMR+ Sbjct: 305 LLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRD 364 Query: 277 MKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLL 336 M+MDKTELGCLR I+LFNPD +GL + VE LREKVY SLE Y + + E+PGRFAKLL Sbjct: 365 MQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLL 424 Query: 337 LRLPSLRSI 345 LRLP+LRSI Sbjct: 425 LRLPALRSI 433
>pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 Back     alignment and structure
>pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 Back     alignment and structure
>pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 Back     alignment and structure
>pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 Back     alignment and structure
>pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 Back     alignment and structure
>pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 Back     alignment and structure
>pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 Back     alignment and structure
>pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 Back     alignment and structure
>pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 Back     alignment and structure
>pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 Back     alignment and structure
>pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 Back     alignment and structure
>pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 Back     alignment and structure
>pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 Back     alignment and structure
>pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 Back     alignment and structure
>pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 Back     alignment and structure
>pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 Back     alignment and structure
>pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 Back     alignment and structure
>pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 Back     alignment and structure
>pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 Back     alignment and structure
>pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 Back     alignment and structure
>pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 Back     alignment and structure
>pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 Back     alignment and structure
>pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 Back     alignment and structure
>pdb|1HG4|A Chain A, Ultraspiracle Ligand Binding Domain From Drosophila Melanogaster Length = 279 Back     alignment and structure
>pdb|1G2N|A Chain A, Crystal Structure Of The Ligand Binding Domain Of The Ultraspiracle Protein Usp, The Ortholog Of Rxrs In Insects Length = 264 Back     alignment and structure
>pdb|1R1K|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 263 Back     alignment and structure
>pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 Back     alignment and structure
>pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 Back     alignment and structure
>pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 Back     alignment and structure
>pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 Back     alignment and structure
>pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 Back     alignment and structure
>pdb|1LV2|A Chain A, Hepatocyte Nuclear Factor 4 Is A Transcription Factor That Constitutively Binds Fatty Acids Length = 229 Back     alignment and structure
>pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 Back     alignment and structure
>pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 Back     alignment and structure
>pdb|1M7W|A Chain A, Hnf4a Ligand Binding Domain With Bound Fatty Acid Length = 250 Back     alignment and structure
>pdb|3FS1|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Pgc-1a Fragment Length = 230 Back     alignment and structure
>pdb|1PZL|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Src-1 Peptide Length = 237 Back     alignment and structure
>pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 Back     alignment and structure
>pdb|4DOS|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Dlpc And A Fragment Of Tif-2 Length = 242 Back     alignment and structure
>pdb|1YUC|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Phospholipid And A Fragment Of Human Shp Length = 255 Back     alignment and structure
>pdb|1VJB|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4- Hydroxytamoxifen Length = 251 Back     alignment and structure
>pdb|1S9Q|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4-Hydroxytamoxifen Length = 251 Back     alignment and structure
>pdb|1S9P|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With Diethylstilbestrol Length = 227 Back     alignment and structure
>pdb|2E2R|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Gamma Ligand Binding Domain Complex With Bisphenol A Length = 244 Back     alignment and structure
>pdb|2EWP|A Chain A, Crystal Structure Of Estrogen Related Receptor-3 (Err-Gamma) Ligand Binding Domaind With Tamoxifen Analog Gsk5182 Length = 226 Back     alignment and structure
>pdb|1KV6|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Err3 Ligand- Binding Domain In The Constitutively Active Conformation Length = 230 Back     alignment and structure
>pdb|1ZDU|A Chain A, The Crystal Structure Of Human Liver Receptor Homologue-1 Length = 245 Back     alignment and structure
>pdb|3PLZ|A Chain A, Human Lrh1 Lbd Bound To Gr470 Length = 257 Back     alignment and structure
>pdb|1YOK|A Chain A, Crystal Structure Of Human Lrh-1 Bound With Tif-2 Peptide And Phosphatidylglycerol Length = 256 Back     alignment and structure
>pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 Back     alignment and structure
>pdb|3TX7|B Chain B, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 352 Back     alignment and structure
>pdb|1PK5|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Lrh-1 Length = 248 Back     alignment and structure
>pdb|1ZH7|A Chain A, Structural And Biochemical Basis For Selective Repression Of The Orphan Nuclear Receptor Lrh-1 By Shp Length = 243 Back     alignment and structure
>pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 Back     alignment and structure
>pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 Back     alignment and structure
>pdb|3A9E|B Chain B, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 269 Back     alignment and structure
>pdb|3P0U|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Testicular Receptor 4 Length = 249 Back     alignment and structure
>pdb|1DKF|B Chain B, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 235 Back     alignment and structure
>pdb|3KMR|A Chain A, Crystal Structure Of Raralpha Ligand Binding Domain In Complex With An Agonist Ligand (Am580) And A Coactivator Fragment Length = 266 Back     alignment and structure
>pdb|4DQM|A Chain A, Revealing A Marine Natural Product As A Novel Agonist For Retinoic Acid Receptors With A Unique Binding Mode And Antitumor Activity Length = 234 Back     alignment and structure
>pdb|1XDK|B Chain B, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 303 Back     alignment and structure
>pdb|1YMT|A Chain A, Mouse Sf-1 Lbd Length = 246 Back     alignment and structure
>pdb|1XAP|A Chain A, Structure Of The Ligand Binding Domain Of The Retinoic Acid Receptor Beta Length = 267 Back     alignment and structure
>pdb|1YP0|A Chain A, Structure Of The Steroidogenic Factor-1 Ligand Binding Domain Bound To Phospholipid And A Shp Peptide Motif Length = 239 Back     alignment and structure
>pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 Back     alignment and structure
>pdb|3F7D|A Chain A, Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 Back     alignment and structure
>pdb|3D24|A Chain A, Crystal Structure Of Ligand-Binding Domain Of Estrogen- Related Receptor Alpha (Erralpha) In Complex With The Peroxisome Proliferators-Activated Receptor Coactivator- 1alpha Box3 Peptide (Pgc-1alpha) Length = 253 Back     alignment and structure
>pdb|3K6P|A Chain A, Estrogen Related Receptor Alpha In Complex With An Ether Based Ligand Length = 248 Back     alignment and structure
>pdb|1XB7|A Chain A, X-Ray Structure Of Erralpha Lbd In Complex With A Pgc- 1alpha Peptide At 2.5a Resolution Length = 247 Back     alignment and structure
>pdb|3N00|A Chain A, Crystal Structure Of A Deletion Mutant Of Human Reverba Ligand Binding Domain Bound With An Ncor Id1 Peptide Determined To 2.60a Length = 245 Back     alignment and structure
>pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 Back     alignment and structure
>pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 Back     alignment and structure
>pdb|2XHS|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Fushi Tarazu Factor 1 Of Drosophila Melanogaster Length = 245 Back     alignment and structure
>pdb|2PJL|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Alpha In Complex With A Synthetic Inverse Agonist Reveals Its Novel Molecular Mechanism Length = 247 Back     alignment and structure
>pdb|1EXA|A Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Active R-Enantiomer Bms270394. Length = 246 Back     alignment and structure
>pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 Back     alignment and structure
>pdb|1FCX|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Bms184394 Length = 235 Back     alignment and structure
>pdb|2LBD|A Chain A, Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To All-Trans Retinoic Acid Length = 267 Back     alignment and structure
>pdb|1FCY|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The RarbetaGAMMA- Selective Retinoid Cd564 Length = 236 Back     alignment and structure
>pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 Back     alignment and structure
>pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 Back     alignment and structure
>pdb|2ACL|B Chain B, Liver X-Receptor Alpha Ligand Binding Domain With Sb313987 Length = 244 Back     alignment and structure
>pdb|3FC6|B Chain B, Hrxralpha & Mlxralpha With An Indole Pharmacophore, Sb786875 Length = 266 Back     alignment and structure
>pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 Back     alignment and structure
>pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 Back     alignment and structure
>pdb|1QKN|A Chain A, Rat Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Antagonist Raloxifene Length = 255 Back     alignment and structure
>pdb|2J7X|A Chain A, Structure Of Estradiol-bound Estrogen Receptor Beta Lbd In Complex With Lxxll Motif From Ncoa5 Length = 255 Back     alignment and structure
>pdb|2FSZ|A Chain A, A Second Binding Site For Hydroxytamoxifen Within The Coactivator-Binding Groove Of Estrogen Receptor Beta Length = 246 Back     alignment and structure
>pdb|1P8D|A Chain A, X-Ray Crystal Structure Of Lxr Ligand Binding Domain With 24(S),25- Epoxycholesterol Length = 250 Back     alignment and structure
>pdb|1PQ6|A Chain A, Human Lxr Beta Hormone Receptor / Gw3965 Complex Length = 253 Back     alignment and structure
>pdb|1UPV|A Chain A, Crystal Structure Of The Human Liver X Receptor Beta Ligand Binding Domain In Complex With A Synthetic Agonist Length = 257 Back     alignment and structure
>pdb|1NAV|A Chain A, Thyroid Receptor Alpha In Complex With An Agonist Selective For Thyroid Receptor Beta1 Length = 263 Back     alignment and structure
>pdb|4DK8|A Chain A, Crystal Structure Of Lxr Ligand Binding Domain In Complex With Partial Agonist 5 Length = 247 Back     alignment and structure
>pdb|2H77|A Chain A, Crystal Structure Of Human Tr Alpha Bound T3 In Monoclinic Space Group Length = 269 Back     alignment and structure
>pdb|3HZF|A Chain A, Structure Of Tr-alfa Bound To Selective Thyromimetic Gc-1 In C2 Space Group Length = 269 Back     alignment and structure
>pdb|2H79|A Chain A, Crystal Structure Of Human Tr Alpha Bound T3 In Orthorhombic Space Group Length = 269 Back     alignment and structure
>pdb|3JZB|A Chain A, Crystal Structure Of Tr-Alfa Bound To The Selective Thyromimetic Triac Length = 267 Back     alignment and structure
>pdb|3CQV|A Chain A, Crystal Structure Of Reverb Beta In Complex With Heme Length = 199 Back     alignment and structure
>pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 Back     alignment and structure
>pdb|1YY4|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 1-Chloro-6-(4-Hydroxy-Phenyl)-Naphthalen-2-Ol Length = 268 Back     alignment and structure
>pdb|2V0V|A Chain A, Crystal Structure Of Rev-Erb Beta Length = 194 Back     alignment and structure
>pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 Back     alignment and structure
>pdb|2V7C|A Chain A, Crystal Structure Of Rev-Erb Beta Length = 194 Back     alignment and structure
>pdb|2YAT|A Chain A, Crystal Structure Of Estradiol Derived Metal Chelate And Estrogen Receptor-Ligand Binding Domain Complex Length = 252 Back     alignment and structure
>pdb|1UOM|A Chain A, The Structure Of Estrogen Receptor In Complex With A Selective And Potent Tetrahydroisochiolin Ligand. Length = 254 Back     alignment and structure
>pdb|1QKT|A Chain A, Mutant Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 248 Back     alignment and structure
>pdb|1PCG|A Chain A, Helix-Stabilized Cyclic Peptides As Selective Inhibitors Of Steroid Receptor-Coactivator Interactions Length = 244 Back     alignment and structure
>pdb|3LTX|A Chain A, Crystal Structure Of The Pacific Oyster Estrogen Receptor Ligand Binding Domain Length = 243 Back     alignment and structure
>pdb|1L2J|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With (R, R)-5,11-Cis-Diethyl-5,6,11,12-Tetrahydrochrysene-2, 8-Diol Length = 271 Back     alignment and structure
>pdb|2I0G|A Chain A, Benzopyrans Are Selective Estrogen Receptor Beta Agonists (Serbas) With Novel Activity In Models Of Benign Prostatic Hyperplasia Length = 257 Back     alignment and structure
>pdb|2OCF|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Estradiol And The E2#23 Fn3 Monobody Length = 298 Back     alignment and structure
>pdb|1QKM|A Chain A, Human Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Partial Agonist Genistein Length = 255 Back     alignment and structure
>pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 Back     alignment and structure
>pdb|2JFA|B Chain B, Estrogen Receptor Alpha Lbd In Complex With An Affinity- Selected Corepressor Peptide Length = 252 Back     alignment and structure
>pdb|1NDE|A Chain A, Estrogen Receptor Beta With Selective Triazine Modulator Length = 255 Back     alignment and structure
>pdb|1U9E|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-397 Length = 241 Back     alignment and structure
>pdb|1X76|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-697 Length = 240 Back     alignment and structure
>pdb|2NV7|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-555 Length = 238 Back     alignment and structure
>pdb|1L2I|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With (R,R)-5,11-Cis-Diethyl-5,6,11,12- Tetrahydrochrysene-2,8-Diol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 Back     alignment and structure
>pdb|2GIU|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With Compound 45 Length = 241 Back     alignment and structure
>pdb|3Q95|B Chain B, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 Back     alignment and structure
>pdb|3UU7|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 Back     alignment and structure
>pdb|3L0E|A Chain A, X-Ray Crystal Structure Of A Potent Liver X Receptor Modulator Length = 253 Back     alignment and structure
>pdb|2YLY|A Chain A, Sulfonamides As Selective Estrogen Receptor Beta Agonists. Length = 240 Back     alignment and structure
>pdb|3Q97|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Two Isomers Of Ethoxy Triphenylethylene Length = 260 Back     alignment and structure
>pdb|3OLL|A Chain A, Crystal Structure Of Phosphorylated Estrogen Receptor Beta Ligand Binding Domain Length = 240 Back     alignment and structure
>pdb|1ZKY|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Obcp-3m And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 257 Back     alignment and structure
>pdb|3UVV|A Chain A, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 265 Back     alignment and structure
>pdb|3UU7|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 Back     alignment and structure
>pdb|3HM1|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And Estrone ((8r,9s,13s,14s)-3-Hydroxy- 7,8,9,11,12,14,15, 16-Octahydro-6h-Cyclopenta[a]phenanthren- Length = 253 Back     alignment and structure
>pdb|1ZAF|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 3-Bromo-6-Hydroxy-2-(4-Hydroxy-Phenyl)-Inden-1-One Length = 238 Back     alignment and structure
>pdb|2BJ4|A Chain A, Estrogen Receptor Alpha Lbd In Complex With A Phage-Display Derived Peptide Antagonist Length = 252 Back     alignment and structure
>pdb|3HLV|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And 16-Alpha-Hydroxy-Estrone ((8s,9r,13 16r)-3,16-Dihydroxy-13-Methyl-7,8,9,11,12,14,15, 16-Octahyd Cyclopenta[a]phenanthren-17-One Length = 253 Back     alignment and structure
>pdb|3DT3|A Chain A, Human Estrogen Receptor Alpha Lbd With Gw368 Length = 255 Back     alignment and structure
>pdb|1GWQ|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With Raloxifene Core And Tif2 Nrbox2 Peptide Length = 248 Back     alignment and structure
>pdb|1G50|A Chain A, Crystal Structure Of A Wild Type Her Alpha Lbd At 2.9 Angstrom Resolution Length = 247 Back     alignment and structure
>pdb|3Q95|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 Back     alignment and structure
>pdb|2QA8|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 Back     alignment and structure
>pdb|3ERD|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Diethylstilbestrol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 Back     alignment and structure
>pdb|3UUA|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 Back     alignment and structure
>pdb|2P15|A Chain A, Crystal Structure Of The Er Alpha Ligand Binding Domain With The Agonist Ortho-Trifluoromethylphenylvinyl Estradiol Length = 258 Back     alignment and structure
>pdb|2QXS|A Chain A, Crystal Structure Of Antagonizing Mutant 536s Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed To Raloxifene Length = 258 Back     alignment and structure
>pdb|1ERE|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With 17beta-Estradiol Length = 253 Back     alignment and structure
>pdb|1SJ0|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With The Antagonist Ligand 4-d Length = 248 Back     alignment and structure
>pdb|2IOK|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With Compound 1d Length = 254 Back     alignment and structure
>pdb|2IOG|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Compound 11f Length = 246 Back     alignment and structure
>pdb|1ERR|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With Raloxifene Length = 253 Back     alignment and structure
>pdb|3UUC|A Chain A, Crystal Structure Of Hera-Lbd (Wt) In Complex With Bisphenol-C Length = 251 Back     alignment and structure
>pdb|2QA8|A Chain A, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 Back     alignment and structure
>pdb|1GWR|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With 17beta-Oestradiol And Tif2 Nrbox3 Peptide Length = 245 Back     alignment and structure
>pdb|3L03|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide And Estetrol (Estra-1,3,5(10)-Triene-3,15 Alpha, 16alpha,17beta-Tetrol) Length = 253 Back     alignment and structure
>pdb|1QKU|A Chain A, Wild Type Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 250 Back     alignment and structure
>pdb|2QZO|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed With Way-169916 Length = 258 Back     alignment and structure
>pdb|4DMA|A Chain A, Crystal Structure Of Era Lbd In Complex With Ru100132 Length = 247 Back     alignment and structure
>pdb|3UUA|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 Back     alignment and structure
>pdb|1A52|A Chain A, Estrogen Receptor Alpha Ligand-Binding Domain Complexed To Estradiol Length = 258 Back     alignment and structure
>pdb|1X7E|A Chain A, Crystal Structure Of Estrogen Receptor Alpha Complexed With Way-244 Length = 245 Back     alignment and structure
>pdb|3OS8|A Chain A, Estrogen Receptor Length = 258 Back     alignment and structure
>pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 Back     alignment and structure
>pdb|3OS8|C Chain C, Estrogen Receptor Length = 258 Back     alignment and structure
>pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 Back     alignment and structure
>pdb|1UHL|B Chain B, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 242 Back     alignment and structure
>pdb|1OVL|A Chain A, Crystal Structure Of Nurr1 Lbd Length = 271 Back     alignment and structure
>pdb|1OVL|B Chain B, Crystal Structure Of Nurr1 Lbd Length = 271 Back     alignment and structure
>pdb|3IPQ|A Chain A, X-Ray Structure Of Gw3965 Synthetic Agonist Bound To The Lxr Length = 283 Back     alignment and structure
>pdb|1ZDT|A Chain A, The Crystal Structure Of Human Steroidogenic Factor-1 Length = 241 Back     alignment and structure
>pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 Back     alignment and structure
>pdb|1I7I|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Ppar-Gamma In Complex With The Agonist Az 242 Length = 292 Back     alignment and structure
>pdb|1NYX|A Chain A, Ligand Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma In Complex With An Agonist Length = 276 Back     alignment and structure
>pdb|3S9S|A Chain A, Ligand Binding Domain Of Ppargamma Complexed With A Benzimidazole Partial Agonist Length = 284 Back     alignment and structure
>pdb|2OM9|A Chain A, Ajulemic Acid, A Synthetic Cannabinoid Bound To Ppar Gamma Length = 278 Back     alignment and structure
>pdb|4DK7|A Chain A, Crystal Structure Of Lxr Ligand Binding Domain In Complex With Full Agonist 1 Length = 247 Back     alignment and structure
>pdb|2I4J|A Chain A, Crystal Structure Of The Complex Between Ppargamma And The Agonist Lt160 (Ureidofibrate Derivative) Length = 286 Back     alignment and structure
>pdb|2VSR|A Chain A, Hppargamma Ligand Binding Domain In Complex With 9-(S)-Hode Length = 276 Back     alignment and structure
>pdb|1RDT|D Chain D, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 284 Back     alignment and structure
>pdb|3OSI|A Chain A, Crystal Structure Of Ppargamma Ligand Binding Domain In Complex With Tetrachloro-Bisphenol A (Tcbpa) Length = 285 Back     alignment and structure
>pdb|3ADS|A Chain A, Human Ppargamma Ligand-Binding Domain In Complex With Indomethacin Length = 287 Back     alignment and structure
>pdb|3LMP|A Chain A, Crystal Structure Of The Ppargamma-Lbd Complexed With A Cercosporamide Derivative Modulator Length = 283 Back     alignment and structure
>pdb|1YOW|A Chain A, Human Steroidogenic Factor 1 Lbd With Bound Co-Factor Peptide Length = 242 Back     alignment and structure
>pdb|1K74|D Chain D, The 2.3 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Ppargamma And Rxralpha Ligand Binding Domains Respectively Bound With Gw409544 And 9-Cis Retinoic Acid And Co-Activator Peptides Length = 283 Back     alignment and structure
>pdb|1WM0|X Chain X, Ppargamma In Complex With A 2-Baba Compound Length = 292 Back     alignment and structure
>pdb|3VN2|A Chain A, Crystal Structure Of Ppargamma Complexed With Telmisartan Length = 285 Back     alignment and structure
>pdb|1ZEO|A Chain A, Crystal Structure Of Human Ppar-Gamma Ligand Binding Domain Complexed With An Alpha-Aryloxyphenylacetic Acid Agonist Length = 277 Back     alignment and structure
>pdb|3BC5|A Chain A, X-Ray Crystal Structure Of Human Ppar Gamma With 2-(5-(3-(2- (5-Methyl-2-Phenyloxazol-4-Yl)ethoxy)benzyl)-2-Phenyl- 2h-1, 2,3-Triazol-4-Yl)acetic Acid Length = 296 Back     alignment and structure
>pdb|2VV1|B Chain B, Hppargamma Ligand Binding Domain In Complex With 4-Hdha Length = 276 Back     alignment and structure
>pdb|3B0Q|A Chain A, Human Ppar Gamma Ligand Binding Domain In Complex With Mcc555 Length = 274 Back     alignment and structure
>pdb|3CS8|A Chain A, Structural And Biochemical Basis For The Binding Selectivity Of Pparg To Pgc-1a Length = 275 Back     alignment and structure
>pdb|2Q59|B Chain B, Crystal Structure Of Ppargamma Lbd Bound To Full Agonist Mrl20 Length = 274 Back     alignment and structure
>pdb|3PBA|A Chain A, Crystal Structure Of Ppargamma Ligand Binding Domain In Complex With Monosulfate Tetrabromo-Bisphenol A (Monotbbpa) Length = 286 Back     alignment and structure
>pdb|3ET3|A Chain A, Structure Of Ppargamma With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 292 Back     alignment and structure
>pdb|3R8A|A Chain A, X-Ray Crystal Structure Of The Nuclear Hormone Receptor Ppar-Gamma In A Complex With A Compound With Dual Ppar Gamma Agonism And Angiotensin Ii Type I Receptor Antagonism Activity Length = 282 Back     alignment and structure
>pdb|2VV4|B Chain B, Hppargamma Ligand Binding Domain In Complex With 6-Oxoote Length = 276 Back     alignment and structure
>pdb|4PRG|A Chain A, 0072 Partial Agonist Ppar Gamma Cocrystal Length = 270 Back     alignment and structure
>pdb|3PRG|A Chain A, Ligand Binding Domain Of Human Peroxisome Proliferator Activated Receptor Length = 278 Back     alignment and structure
>pdb|2ZVT|A Chain A, Cys285ser Mutant Ppargamma Ligand-Binding Domain Complexed With 15-Deoxy-Delta12,14-Prostaglandin J2 Length = 286 Back     alignment and structure
>pdb|1FM6|D Chain D, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 272 Back     alignment and structure
>pdb|3CWD|A Chain A, Molecular Recognition Of Nitro-Fatty Acids By Ppar Gamma Length = 270 Back     alignment and structure
>pdb|2PRG|A Chain A, Ligand-Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma Length = 271 Back     alignment and structure
>pdb|2HFP|A Chain A, Crystal Structure Of Ppar Gamma With N-Sulfonyl-2-Indole Carboxamide Ligands Length = 282 Back     alignment and structure
>pdb|1KNU|A Chain A, Ligand Binding Domain Of The Human Peroxisome Proliferator Activated Receptor Gamma In Complex With A Synthetic Agonist Length = 274 Back     alignment and structure
>pdb|3T03|A Chain A, Crystal Structure Of Ppar Gamma Ligand Binding Domain In Complex With A Novel Partial Agonist Gq-16 Length = 284 Back     alignment and structure
>pdb|3U9Q|A Chain A, Ligand Binding Domain Of Ppargamma Complexed With Decanoic Acid And Pgc-1a Peptide Length = 269 Back     alignment and structure
>pdb|2Q59|A Chain A, Crystal Structure Of Ppargamma Lbd Bound To Full Agonist Mrl20 Length = 274 Back     alignment and structure
>pdb|3ET0|A Chain A, Structure Of Ppargamma With 3-(5-Methoxy-1h-Indol-3-Yl)- Propionic Acid Length = 292 Back     alignment and structure
>pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|2J4A|A Chain A, Human Thyroid Hormone Receptor Beta Ligand Binding Domain In Complex With Kb131084 Length = 253 Back     alignment and structure
>pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 Back     alignment and structure
>pdb|3HC6|A Chain A, Fxr With Src1 And Gsk088 Length = 232 Back     alignment and structure
>pdb|3GD2|A Chain A, Isoxazole Ligand Bound To Farnesoid X Receptor (Fxr) Length = 229 Back     alignment and structure
>pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 Back     alignment and structure
>pdb|2B50|A Chain A, Human Nuclear Receptor-Ligand Complex 2 Length = 272 Back     alignment and structure
>pdb|3P88|A Chain A, Fxr Bound To Isoquinolinecarboxylic Acid Length = 229 Back     alignment and structure
>pdb|2Q5G|A Chain A, Ligand Binding Domain Of Ppar Delta Receptor In Complex With A Partial Agonist Length = 283 Back     alignment and structure
>pdb|2AWH|A Chain A, Human Nuclear Receptor-Ligand Complex 1 Length = 268 Back     alignment and structure
>pdb|3P89|A Chain A, Fxr Bound To A Quinolinecarboxylic Acid Length = 229 Back     alignment and structure
>pdb|3ET2|A Chain A, Structure Of Ppardelta With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 287 Back     alignment and structure
>pdb|2J14|A Chain A, 3,4,5-Trisubstituted Isoxazoles As Novel Ppardelta Agonists: Part2 Length = 285 Back     alignment and structure
>pdb|1OSV|A Chain A, Structural Basis For Bile Acid Binding And Activation Of The Nuclear Receptor Fxr Length = 230 Back     alignment and structure
>pdb|2GWX|A Chain A, Molecular Recognition Of Fatty Acids By Peroxisome Proliferator-Activated Receptors Length = 267 Back     alignment and structure
>pdb|1NUO|A Chain A, Two Rth Mutants With Impaired Hormone Binding Length = 261 Back     alignment and structure
>pdb|1OT7|A Chain A, Structural Basis For 3-Deoxy-Cdca Binding And Activation Of Fxr Length = 229 Back     alignment and structure
>pdb|3SP9|A Chain A, Structural Basis For Iloprost As A Dual PparalphaDELTA AGONIST Length = 281 Back     alignment and structure
>pdb|2XYJ|A Chain A, Novel Sulfonylthiadiazoles With An Unusual Binding Mode As Partial Dual Peroxisome Proliferator-Activated Receptor (Ppar) Gamma-Delta Agonists With High Potency And In-Vivo Efficacy Length = 288 Back     alignment and structure
>pdb|2ZNP|A Chain A, Human Pprr Delta Ligand Binding Domain In Complex With A Synthetic Agonist Tipp204 Length = 276 Back     alignment and structure
>pdb|1Y0S|A Chain A, Crystal Structure Of Ppar Delta Complexed With Gw2331 Length = 272 Back     alignment and structure
>pdb|1GWX|A Chain A, Molecular Recognition Of Fatty Acids By Peroxisome Proliferator-Activated Receptors Length = 271 Back     alignment and structure
>pdb|3DCT|A Chain A, Fxr With Src1 And Gw4064 Length = 235 Back     alignment and structure
>pdb|1Q4X|A Chain A, Crystal Structure Of Human Thyroid Hormone Receptor Beta Lbd In Complex With Specific Agonist Gc-24 Length = 253 Back     alignment and structure
>pdb|1R6G|A Chain A, Crystal Structure Of The Thyroid Hormone Receptor Beta Ligand Binding Domain In Complex With A Beta Selective Compound Length = 259 Back     alignment and structure
>pdb|3FXV|A Chain A, Identification Of An N-Oxide Pyridine Gw4064 Analogue As A Potent Fxr Agonist Length = 233 Back     alignment and structure
>pdb|1BSX|A Chain A, Structure And Specificity Of Nuclear Receptor-Coactivator Interactions Length = 260 Back     alignment and structure
>pdb|1XZX|X Chain X, Thyroxine-Thyroid Hormone Receptor Interactions Length = 281 Back     alignment and structure
>pdb|3TKM|A Chain A, Crystal Structure Ppar Delta Binding Gw0742 Length = 275 Back     alignment and structure
>pdb|3BEJ|A Chain A, Structure Of Human Fxr In Complex With Mfa-1 And Co- Activator Peptide Length = 238 Back     alignment and structure
>pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 Back     alignment and structure
>pdb|1NQ0|A Chain A, Tr Receptor Mutations Conferring Hormone Resistance And Reduced Corepressor Release Exhibit Decreased Stability In The Nterminal Lbd Length = 263 Back     alignment and structure
>pdb|1NAX|A Chain A, Thyroid Receptor Beta1 In Complex With A Beta-Selective Ligand Length = 252 Back     alignment and structure
>pdb|1N46|A Chain A, Crystal Structure Of Human Tr Beta Ligand-Binding Domain Complexed With A Potent Subtype-Selective Thyromimetic Length = 258 Back     alignment and structure
>pdb|1NQ1|A Chain A, Tr Receptor Mutations Conferring Hormone Resistance And Reduced Corepressor Release Exhibit Decreased Stability In The Nterminal Lbd Length = 263 Back     alignment and structure
>pdb|3L1B|A Chain A, Complex Structure Of Fxr Ligand-Binding Domain With A Tetrahydroazepinoindole Compound Length = 233 Back     alignment and structure
>pdb|1OSH|A Chain A, A Chemical, Genetic, And Structural Analysis Of The Nuclear Bile Acid Receptor Fxr Length = 232 Back     alignment and structure
>pdb|3FLI|A Chain A, Discovery Of Xl335, A Highly Potent, Selective And Orally- Active Agonist Of The Farnesoid X Receptor (Fxr) Length = 231 Back     alignment and structure
>pdb|3HC5|A Chain A, Fxr With Src1 And Gsk826 Length = 232 Back     alignment and structure
>pdb|1NQ2|A Chain A, Two Rth Mutants With Impaired Hormone Binding Length = 264 Back     alignment and structure
>pdb|3JZC|A Chain A, Crystal Structure Of Tr-Beta Bound To The Selective Thyromimetic Triac Length = 263 Back     alignment and structure
>pdb|3IMY|A Chain A, Structure Of Tr-Beta Bound To Selective Thyromimetic Gc-1 Length = 261 Back     alignment and structure
>pdb|3GWS|X Chain X, Crystal Structure Of T3-Bound Thyroid Hormone Receptor Length = 259 Back     alignment and structure
>pdb|3RUT|A Chain A, Fxr With Src1 And Gsk359 Length = 229 Back     alignment and structure
>pdb|3D57|A Chain A, Tr Variant D355r Length = 266 Back     alignment and structure
>pdb|2PIN|A Chain A, Thyroid Receptor Beta In Complex With Inhibitor Length = 253 Back     alignment and structure
>pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 Back     alignment and structure
>pdb|3GZ9|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Delta (Ppard) In Complex With A Full Agonist Length = 269 Back     alignment and structure
>pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 Back     alignment and structure
>pdb|2NXX|E Chain E, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 248 Back     alignment and structure
>pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 Back     alignment and structure
>pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 Back     alignment and structure
>pdb|1Z5X|E Chain E, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 310 Back     alignment and structure
>pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1YJE|A Chain A, Crystal Structure Of The Rngfi-B Ligand-Binding Domain Length = 264 Back     alignment and structure
>pdb|3V3E|B Chain B, Crystal Structure Of The Human Nur77 Ligand-Binding Domain Length = 257 Back     alignment and structure
>pdb|2QW4|A Chain A, Human Nr4a1 Ligand-Binding Domain Length = 273 Back     alignment and structure
>pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 Back     alignment and structure
>pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 Back     alignment and structure
>pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 Back     alignment and structure
>pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 Back     alignment and structure
>pdb|1R20|D Chain D, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO THE SYNTHETIC AGONIST BYI06830 Length = 265 Back     alignment and structure
>pdb|3VHU|A Chain A, Mineralocorticoid Receptor Ligand-Binding Domain With Spironolactone Length = 294 Back     alignment and structure
>pdb|3VHV|A Chain A, Mineralocorticoid Receptor Ligand-Binding Domain With Non-Steroidal Antagonist Length = 260 Back     alignment and structure
>pdb|2AA6|A Chain A, Mineralocorticoid Receptor S810l Mutant With Bound Progesterone Length = 275 Back     alignment and structure
>pdb|1I7G|A Chain A, Crystal Structure Of The Ligand Binding Domain From Human Ppar-Alpha In Complex With The Agonist Az 242 Length = 287 Back     alignment and structure
>pdb|1R1K|D Chain D, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 266 Back     alignment and structure
>pdb|2ZNN|A Chain A, Human Pprr Alpha Ligand Binding Domain In Complex With A Synthetic Agonist Tipp703 Length = 273 Back     alignment and structure
>pdb|2REW|A Chain A, Crystal Structure Of Pparalpha Ligand Binding Domain With Bms-631707 Length = 277 Back     alignment and structure
>pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 Back     alignment and structure
>pdb|3SP6|A Chain A, Structural Basis For Iloprost As A Dual PparalphaDELTA AGONIST Length = 285 Back     alignment and structure
>pdb|3ET1|A Chain A, Structure Of Pparalpha With 3-[5-Methoxy-1-(4-Methoxy- Benzenesulfonyl)-1h-Indol-3-Yl]-Propionic Acid Length = 291 Back     alignment and structure
>pdb|1K7L|A Chain A, The 2.5 Angstrom Resolution Crystal Structure Of The Human Pparalpha Ligand Binding Domain Bound With Gw409544 And A Co-Activator Peptide. Length = 288 Back     alignment and structure
>pdb|2P54|A Chain A, A Crystal Structure Of Ppar Alpha Bound With Src1 Peptide And Gw735 Length = 267 Back     alignment and structure
>pdb|2NPA|A Chain A, The Crystal Structure Of The Human Pparaplpha Ligand Binding Domain In Complex With A A-Hydroxyimino Phenylpropanoic Acid Length = 270 Back     alignment and structure
>pdb|3G8I|A Chain A, Aleglitazar, A New, Potent, And Balanced Ppar AlphaGAMMA Agonist For The Treatment Of Type Ii Diabetes Length = 270 Back     alignment and structure
>pdb|1KKQ|A Chain A, Crystal Structure Of The Human Ppar-Alpha Ligand-Binding Domain In Complex With An Antagonist Gw6471 And A Smrt Corepressor Motif Length = 269 Back     alignment and structure
>pdb|1N4H|A Chain A, Characterization Of Ligands For The Orphan Nuclear Receptor Rorbeta Length = 259 Back     alignment and structure
>pdb|2HBH|A Chain A, Crystal Structure Of Vitamin D Nuclear Receptor Ligand Binding Domain Bound To A Locked Side-Chain Analog Of Calcitriol And Src-1 Peptide Length = 302 Back     alignment and structure
>pdb|1Y9R|A Chain A, Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone And Harboring The S810l Mutation Responsible For A Severe Form Of Hypertension Length = 255 Back     alignment and structure
>pdb|2OAX|A Chain A, Crystal Structure Of The S810l Mutant Mineralocorticoid Receptor Associated With Sc9420 Length = 256 Back     alignment and structure
>pdb|1ILG|A Chain A, Crystal Structure Of Apo Human Pregnane X Receptor Ligand Binding Domain Length = 316 Back     alignment and structure
>pdb|4FHH|A Chain A, Development Of Synthetically Accessible Non-Secosteroidal Hybrid Molecules Combining Vitamin D Receptor Agonism And Histone Deacetylase Inhibition Length = 300 Back     alignment and structure
>pdb|1K4W|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Ror Beta Ligand-Binding Domain In The Active Conformation Length = 252 Back     alignment and structure
>pdb|1SKX|A Chain A, Structural Disorder In The Complex Of Human Pxr And The Macrolide Antibiotic Rifampicin Length = 313 Back     alignment and structure
>pdb|1NQ7|A Chain A, Characterization Of Ligands For The Orphan Nuclear Receptor Rorbeta Length = 244 Back     alignment and structure
>pdb|3CTB|A Chain A, Tethered Pxr-LbdSRC-1p Apoprotein Length = 344 Back     alignment and structure
>pdb|3MNO|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, F608s) Mutations At 1.55a Length = 261 Back     alignment and structure
>pdb|2O9I|A Chain A, Crystal Structure Of The Human Pregnane X Receptor Lbd In Complex With An Src-1 Coactivator Peptide And T0901317 Length = 293 Back     alignment and structure
>pdb|3E7C|A Chain A, Glucocorticoid Receptor Lbd Bound To Gsk866 Length = 257 Back     alignment and structure
>pdb|3CLD|A Chain A, Ligand Binding Domain Of The Glucocorticoid Receptor Complexed With Fluticazone Furoate Length = 259 Back     alignment and structure
>pdb|1XV9|B Chain B, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 246 Back     alignment and structure
>pdb|2AA2|A Chain A, Mineralocorticoid Receptor With Bound Aldosterone Length = 275 Back     alignment and structure
>pdb|2A3I|A Chain A, Structural And Biochemical Mechanisms For The Specificity Of Hormone Binding And Coactivator Assembly By Mineralocorticoid Receptor Length = 253 Back     alignment and structure
>pdb|3MNP|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, V708a, E711g) Mutations At 1.50a Length = 261 Back     alignment and structure
>pdb|3F5C|B Chain B, Structure Of Dax-1:lrh-1 Complex Length = 268 Back     alignment and structure
>pdb|3MNE|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By F608s Mutation At 1.96a Length = 261 Back     alignment and structure
>pdb|1I38|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain T877a Mutant Complex With Dihydrotestosterone Length = 260 Back     alignment and structure
>pdb|1I37|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain Complex With Dihydrotestosterone Length = 260 Back     alignment and structure
>pdb|3G8O|A Chain A, Progesterone Receptor With Bound Pyrrolidine 1 Length = 263 Back     alignment and structure
>pdb|1E3K|A Chain A, Human Progesteron Receptor Ligand Binding Domain In Complex With The Ligand Metribolone (R1881) Length = 258 Back     alignment and structure
>pdb|1SR7|A Chain A, Progesterone Receptor Hormone Binding Domain With Bound Mometasone Furoate Length = 259 Back     alignment and structure
>pdb|2Q7K|A Chain A, The Androgen Receptor Prostate Cancer Mutant H874y Ligand Binding Domain Bound With Testosterone And An Ar 20-30 Peptide Length = 257 Back     alignment and structure
>pdb|1A28|A Chain A, Hormone-Bound Human Progesterone Receptor Ligand-Binding Domain Length = 256 Back     alignment and structure
>pdb|2AX6|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877a Mutant In Complex With Hydroxyflutamide Length = 256 Back     alignment and structure
>pdb|1XJ7|A Chain A, Complex Androgen Receptor Lbd And Rac3 Peptide Length = 257 Back     alignment and structure
>pdb|1T73|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With A Fxxff Motif Length = 269 Back     alignment and structure
>pdb|3H52|A Chain A, Crystal Structure Of The Antagonist Form Of Human Glucocorticoid Receptor Length = 254 Back     alignment and structure
>pdb|2AM9|A Chain A, Crystal Structure Of Human Androgen Receptor Ligand Binding Domain In Complex With Testosterone Length = 266 Back     alignment and structure
>pdb|1T5Z|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain (Lbd) With Dht And A Peptide Derived From Its Physiological Coactivator Ara70 Length = 251 Back     alignment and structure
>pdb|2AX9|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3 Length = 256 Back     alignment and structure
>pdb|1E3G|A Chain A, Human Androgen Receptor Ligand Binding In Complex With The Ligand Metribolone (R1881) Length = 263 Back     alignment and structure
>pdb|1PDU|A Chain A, Ligand-Binding Domain Of Drosophila Orphan Nuclear Receptor Dhr38 Length = 244 Back     alignment and structure
>pdb|2W8Y|A Chain A, Ru486 Bound To The Progesterone Receptor In A Destabilized Agonistic Conformation Length = 260 Back     alignment and structure
>pdb|2HVC|A Chain A, The Crystal Structure Of Ligand-Binding Domain (Lbd) Of Human Androgen Receptor In Complex With A Selective Modulator Lgd2226 Length = 250 Back     alignment and structure
>pdb|1SQN|A Chain A, Progesterone Receptor Ligand Binding Domain With Bound Norethindrone Length = 261 Back     alignment and structure
>pdb|1NHZ|A Chain A, Crystal Structure Of The Antagonist Form Of Glucocorticoid Receptor Length = 280 Back     alignment and structure
>pdb|2ABI|A Chain A, Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone Length = 256 Back     alignment and structure
>pdb|3A2I|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305f) Ligand Binding Domain Complexed With Tei-9647 Length = 263 Back     alignment and structure
>pdb|3A2J|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305fH397F) LIGAND Binding Domain Complexed With Tei-9647 Length = 263 Back     alignment and structure
>pdb|3KBA|A Chain A, Progesterone Receptor Bound To Sulfonamide Pyrrolidine Partial Agonist Length = 253 Back     alignment and structure
>pdb|1GS4|A Chain A, Structural Basis For The Glucocorticoid Response In A Mutant Human Androgen Receptor (Arccr) Derived From An Androgen-Independent Prostate Cancer Length = 248 Back     alignment and structure
>pdb|2Z4J|A Chain A, Crystal Structure Of Ar Lbd With Shp Peptide Nr Box 2 Length = 248 Back     alignment and structure
>pdb|3RLJ|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With Sarm S-22 Length = 247 Back     alignment and structure
>pdb|2OZ7|A Chain A, Crystal Structure Of The Human Androgen Receptor T877a Mutant Ligand- Binding Domain With Cyproterone Acetate Length = 249 Back     alignment and structure
>pdb|1XOW|A Chain A, Crystal Structure Of The Human Androgen Receptor Ligand Binding Domain Bound With An Androgen Receptor Nh2- Terminal Peptide, Ar20-30, And R1881 Length = 249 Back     alignment and structure
>pdb|3RLL|A Chain A, Crystal Structure Of The T877a Androgen Receptor Ligand Binding Domain In Complex With (S)-N-(4-Cyano-3-(Trifluoromethyl)phenyl)-3-(4- Cyanonaphthalen-1-Yloxy)-2-Hydroxy-2-Methylpropanamide Length = 247 Back     alignment and structure
>pdb|3L3X|A Chain A, Crystal Structure Of Dht-Bound Androgen Receptor In Complex With The First Motif Of Steroid Receptor Coactivator 3 Length = 250 Back     alignment and structure
>pdb|1N83|A Chain A, Crystal Structure Of The Complex Between The Orphan Nuclear Hormone Receptor Ror(Alpha)-Lbd And Cholesterol Length = 270 Back     alignment and structure
>pdb|3BQD|A Chain A, Doubling The Size Of The Glucocorticoid Receptor Ligand Binding Pocket By Deacylcortivazol Length = 255 Back     alignment and structure
>pdb|1M2Z|A Chain A, Crystal Structure Of A Dimer Complex Of The Human Glucocorticoid Receptor Ligand-Binding Domain Bound To Dexamethasone And A Tif2 Coactivator Motif Length = 257 Back     alignment and structure
>pdb|3M7R|A Chain A, Crystal Structure Of Vdr H305q Mutant Length = 253 Back     alignment and structure
>pdb|2ZL9|A Chain A, 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26,27- Dimethyl-19-Norvitamin D3 Analogs: Synthesis, Biological Evaluation And Crystal Structure Length = 271 Back     alignment and structure
>pdb|1DB1|A Chain A, Crystal Structure Of The Nuclear Receptor For Vitamin D Complexed To Vitamin D Length = 259 Back     alignment and structure
>pdb|4E2J|A Chain A, X-Ray Crystal Structure Of The Ancestral Glucocorticoid Receptor 2 Ligand Binding Domain In Complex With Mometasone Furoate And Tif-2 Coactivator Fragment Length = 250 Back     alignment and structure
>pdb|1S0Z|A Chain A, Crystal Structure Of The Vdr Lbd Complexed To Seocalcitol. Length = 263 Back     alignment and structure
>pdb|3GN8|A Chain A, X-Ray Crystal Structure Of Ancgr2 In Complex With Dexamethasone Length = 249 Back     alignment and structure
>pdb|3P8X|A Chain A, Synthesis, Structure, And Biological Activity Of Des-Side Chain Analogues Of 1alpha,25-Dihydroxyvitamin D3 With Substituents At C-18 Length = 280 Back     alignment and structure
>pdb|2ZFX|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With Yr301 And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 265 Back     alignment and structure
>pdb|1RJK|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With 2md And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 292 Back     alignment and structure
>pdb|3B0T|A Chain A, Human Vdr Ligand Binding Domain In Complex With Maxacalcitol Length = 254 Back     alignment and structure
>pdb|3AZ1|A Chain A, Crystal Structure Analysis Of Vitamin D Receptor Length = 253 Back     alignment and structure
>pdb|4FNE|A Chain A, X-Ray Crystal Structure Of The Ancestral 3-Keto Steroid Receptor - Doc Complex Length = 254 Back     alignment and structure
>pdb|2Q3Y|A Chain A, Ancestral Corticiod Receptor In Complex With Doc Length = 249 Back     alignment and structure
>pdb|1XNX|A Chain A, Crystal Structure Of Constitutive Androstane Receptor Length = 256 Back     alignment and structure
>pdb|2Q1H|A Chain A, Ancestral Corticoid Receptor In Complex With Aldosterone Length = 250 Back     alignment and structure
>pdb|1XLS|E Chain E, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 242 Back     alignment and structure
>pdb|3RY9|A Chain A, Crystal Structure Of The Resurrected Ancestral Glucocorticoid Receptor 1 In Complex With Doc Length = 250 Back     alignment and structure
>pdb|2AX8|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain W741l Mutant In Complex With S-1 Length = 256 Back     alignment and structure
>pdb|1Z95|A Chain A, Crystal Structure Of The Androgen Receptor Ligand-Binding Domain W741l Mutant Complex With R-Bicalutamide Length = 246 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-135
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 1e-104
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 1e-100
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 8e-90
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 3e-86
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 1e-84
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 4e-83
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 1e-82
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 4e-81
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 2e-79
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 5e-79
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 2e-78
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 6e-78
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 7e-78
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 2e-77
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 3e-76
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 1e-75
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 2e-75
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 6e-75
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 9e-75
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 9e-74
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 6e-73
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 1e-72
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 1e-72
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 4e-72
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 2e-70
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 2e-70
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 4e-70
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 9e-70
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 1e-69
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 1e-69
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 1e-69
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 3e-68
2p54_A267 PPAR-alpha, peroxisome proliferator-activated rece 9e-68
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 2e-67
1yje_A264 Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga 3e-67
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 3e-67
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 8e-67
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 9e-67
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 2e-66
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 3e-66
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 6e-66
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 2e-65
1t7r_A269 Androgen receptor; nuclear receptor, transcription 1e-63
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 1e-62
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 1e-62
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 2e-62
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 7e-62
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 9e-62
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 7e-61
2han_A93 Protein ultraspiracle; transcription regulation, t 3e-57
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 5e-57
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 2e-56
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 2e-56
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 3e-55
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 6e-55
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 1e-54
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 1e-54
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 1e-54
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 2e-54
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 3e-54
2han_B119 Ecdysone receptor; transcription regulation, trans 1e-53
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 2e-53
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 3e-53
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 5e-52
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 1e-51
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 1e-51
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 3e-51
2nll_B103 Protein (thyroid hormone receptor); complex (trans 3e-51
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 2e-46
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
 Score =  392 bits (1007), Expect = e-135
 Identities = 223/349 (63%), Positives = 267/349 (76%), Gaps = 6/349 (1%)

Query: 3   PDTATLLVNFNSGGANSMSSFGSNNHSSSHNNGSSNSSIISPYPPNHPLCGSKHLCSICG 62
           P T TL  +  S   +S  +  S++       G +    +  +P  +    +KH+C+ICG
Sbjct: 85  PTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICG 144

Query: 63  DRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMG 122
           DR+SGKHYGVYSCEGCKGFFKRTVRKDL+Y CR+ ++C+IDKRQRNRCQYCRYQKCL MG
Sbjct: 145 DRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMG 204

Query: 123 MKREAVQEERQRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQDIVNEQQA 182
           MKREAVQEERQR K+R+ NEVESTS    +MPVERILEAE  V+ K E   +  +    +
Sbjct: 205 MKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPS 264

Query: 183 T------NICKATDKQLFQLVDWAKHIPHFTTLPLEDQVLLLRAGWNELLIASFSHRSIS 236
           +      NIC+A DKQLF LV+WAK IPHF+ LPL+DQV+LLRAGWNELLIASFSHRSI+
Sbjct: 265 SPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIA 324

Query: 237 VKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGCLRTIILFNPD 296
           VKDGILLA G+ V+R+SAH AGVG IFDRVLTELVSKMR+M+MDKTELGCLR I+LFNPD
Sbjct: 325 VKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPD 384

Query: 297 VRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSI 345
            +GL +   VE LREKVY SLE Y +  + E+PGRFAKLLLRLP+LRSI
Sbjct: 385 SKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSI 433


>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 Back     alignment and structure
>2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 Back     alignment and structure
>1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 Back     alignment and structure
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 Back     alignment and structure
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 100.0
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 100.0
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 100.0
2han_A93 Protein ultraspiracle; transcription regulation, t 100.0
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 100.0
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 100.0
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 100.0
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 100.0
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 100.0
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 100.0
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 100.0
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 100.0
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 100.0
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 100.0
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 100.0
4hn5_A117 Glucocorticoid receptor; glucocorticoid receptor, 100.0
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 100.0
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 100.0
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 100.0
2nll_B103 Protein (thyroid hormone receptor); complex (trans 100.0
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 100.0
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 100.0
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 100.0
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 100.0
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 100.0
2han_B119 Ecdysone receptor; transcription regulation, trans 100.0
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 100.0
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 100.0
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 100.0
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 100.0
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 99.98
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 99.97
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 99.97
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 99.97
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 99.97
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 99.97
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 99.97
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 99.97
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 99.97
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 99.97
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 99.97
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 99.97
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 99.97
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 99.97
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 99.97
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 99.97
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 99.97
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 99.97
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 99.97
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 99.97
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 99.97
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 99.97
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 99.97
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 99.97
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 99.97
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 99.97
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 99.97
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 99.97
1t7r_A269 Androgen receptor; nuclear receptor, transcription 99.97
3vi8_A273 Peroxisome proliferator-activated receptor alpha; 99.97
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 99.97
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 99.97
3v3e_B257 Nuclear receptor subfamily 4 group A member 1; orp 99.97
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 99.97
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 99.96
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 99.96
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 99.96
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 99.96
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 99.96
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 99.96
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 99.94
2lze_A87 A primordial catalytic fold generated by in vitro 99.86
2lze_A87 A primordial catalytic fold generated by in vitro 93.89
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-69  Score=512.82  Aligned_cols=294  Identities=73%  Similarity=1.194  Sum_probs=251.4

Q ss_pred             CCCCcCcccCCCCCCcccccccchhhHHHHHhhhcCCCcccccCCCCcccccccccCchhhhhHHHHhcCcchhHHHHHH
Q psy3092          53 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEER  132 (347)
Q Consensus        53 ~~~~~C~VCg~~a~g~HyGv~sC~~Ck~FFRR~v~~~~~~~C~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~r  132 (347)
                      .....|.||||+|+|+||||.+|+|||+||||+|+++..|.|+++++|.+++..|++||+|||+||+++||++++||.+|
T Consensus       135 ~~~~~C~VCg~~a~g~hygv~sC~~Ck~FFrR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~r  214 (467)
T 3dzy_A          135 FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEER  214 (467)
T ss_dssp             --CEECTTTSSEECSEETTEECCHHHHHHHHHHHHTTCCCCCSSSSCCCCCSSSSSSCHHHHHHHHHHTTCCGGGCCCCS
T ss_pred             CCCCcceeCCCCCCCCcCCCcchhhhhHhccccccCCCceeCCCCCCCCCCcccccccccchhhhhhhccccchhhhccc
Confidence            34567999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hhhhccccccccCCCCCCCCCcHHHHHHHHHhccCCCCCCcc------ccchhHHHhhhhHHHHHHHHHHHHHHhhCCCC
Q psy3092         133 QRTKERDSNEVESTSGTLIEMPVERILEAEQRVDMKQEPADQ------DIVNEQQATNICKATDKQLFQLVDWAKHIPHF  206 (347)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~l~~~~~w~k~~p~F  206 (347)
                      ++.+.+.....+.+.....+.++++++++...+.........      ..........++++.+.+++.+++|+|+||+|
T Consensus       215 ~~~k~r~~~~~~~~~~~~~~~~~~~ll~a~~~~e~~~~~~~~~~~~~~~~~~~~~~~~l~e~a~~~L~~vVeWAK~iP~F  294 (467)
T 3dzy_A          215 QRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHF  294 (467)
T ss_dssp             CCCCCCSCSSCTTSTTCSCSSCHHHHHHHHHC----------------------CCTTHHHHHHHHHHHHHHHHHHSTTS
T ss_pred             cccccccccccccccccCCCCchhhhhhhhhhhcccchhhhhhcccCCCCcccchHHHHHHHHHHHHHHHHHHHHhCcch
Confidence            876554333333333344566788888776544332211110      01112234567888999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhcccccCCCceEecCCccccccchhhcCchhhHHhhHHHHHHHHHhcCCCHhHHHH
Q psy3092         207 TTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDRVLTELVSKMREMKMDKTELGC  286 (347)
Q Consensus       207 ~~L~~~dq~~Llk~~~~~~~~l~~a~~s~~~~~~~~~~~g~~i~~~~~~~~~~~~~~~~~~~~l~~~l~~L~l~~~E~~l  286 (347)
                      ++|+.+||+.|||++|.+++++.++++++..++.+++++|..++++.....++..++++++.+++.+|++|++|++||++
T Consensus       295 ~~L~~~DQi~LLK~~w~elliL~~a~rs~~~~~~~ll~~g~~i~~~~~~~~~~~~~~~~il~~lv~~l~~L~ld~~E~~l  374 (467)
T 3dzy_A          295 SELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGC  374 (467)
T ss_dssp             TTSCHHHHHHHHHHHHHHHHHHHHHHHTSSSTTBCCCSSSCCCBTHHHHTTTCHHHHHHHHHHTHHHHHHHTCCHHHHHH
T ss_pred             hcCCHHHHHHHHHhHHHHHHHHHHHHHhccCCCceEecCCceechhhhhhhcchHHHHHHHHHHHHHHHHhcCCHHHHHH
Confidence            99999999999999999999999999999888999999999998888777777888899998999999999999999999


Q ss_pred             HHHHHhhcCCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHhhhhhhhccC
Q psy3092         287 LRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNHSEEPGRFAKLLLRLPSLRSIE  346 (347)
Q Consensus       287 L~ai~l~~p~~~~l~~~~~i~~~r~~~~~~L~~y~~~~~~~~~~Rf~~LL~ll~~lr~i~  346 (347)
                      |+||+||+||+++|++.+.|+++|++++.+|++|++.++++++.||++||++||+||+|+
T Consensus       375 LkAIvLfnpd~~gL~~~~~Ve~lQe~~~~aL~~Y~~~~~p~~p~Rf~kLLl~Lp~LRsi~  434 (467)
T 3dzy_A          375 LRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIG  434 (467)
T ss_dssp             HHHHHHSCTTSTTCSCHHHHHHHHHHHHHHHHHHHHHHCTTCTTHHHHHHTHHHHHHHHH
T ss_pred             HHHHHHhCcCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999885



>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* Back     alignment and structure
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Back     alignment and structure
>3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Back     alignment and structure
>3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Back     alignment and structure
>2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} Back     alignment and structure
>2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d2p1ta1230 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R 1e-64
d1pzla_233 a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { 3e-59
d1hg4a_265 a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph 6e-57
d1g2na_256 a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth 2e-56
d1n46a_251 a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b 2e-55
d1pq9a_239 a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human 5e-54
d1fcya_236 a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g 2e-53
d1pk5a_242 a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- 1e-51
d1osha_231 a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo 1e-51
d2p54a1267 a.123.1.1 (A:202-468) Peroxisome proliferator acti 8e-51
d1xpca_245 a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom 7e-50
d2e2ra1223 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 2e-49
d2b50b1265 a.123.1.1 (B:211-475) Peroxisome proliferator-acti 9e-49
d2j7ya1236 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat 2e-48
d3d24a1227 a.123.1.1 (A:194-420) Steroid hormone receptor ERR 1e-47
d1xvpb_246 a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) 2e-47
d2fvja1271 a.123.1.1 (A:207-477) Peroxisome proliferator acti 8e-47
d2r40d1243 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m 1e-46
d1ovla_236 a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma 6e-46
d1nrla_292 a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho 2e-45
d1pdua_230 a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui 4e-44
d1ie9a_255 a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( 1e-43
d1t7ra_250 a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan 2e-43
d1sqna_251 a.123.1.1 (A:) Progesterone receptor {Human (Homo 3e-43
d1xnxa_232 a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) 4e-43
d2qw4a1233 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 7e-43
d1nhza_247 a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom 1e-40
d1n83a_251 a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { 7e-40
d1dszb_84 g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- 2e-39
d1nq7a_244 a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R 1e-38
d2hanb183 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do 5e-36
d1kb2a_89 g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin 3e-35
d1lo1a_90 g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi 2e-34
d1cita_89 g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b 3e-33
d1a6ya_78 g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b 4e-33
d1dsza_75 g.39.1.2 (A:) Retinoic acid receptor DNA-binding d 1e-32
d1r4ia_74 g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve 3e-30
d1hcqa_74 g.39.1.2 (A:) Estrogen receptor DNA-binding domain 1e-29
d1lata_71 g.39.1.2 (A:) Glucocorticoid receptor DNA-binding 5e-28
d2nllb_103 g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D 8e-27
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure

class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Retinoid-X receptor alpha (RXR-alpha)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  202 bits (515), Expect = 1e-64
 Identities = 137/200 (68%), Positives = 157/200 (78%), Gaps = 6/200 (3%)

Query: 152 EMPVERILEAEQRVDMKQEP------ADQDIVNEQQATNICKATDKQLFQLVDWAKHIPH 205
           +MPVERILEAE  V+ K E                  TNIC+A DKQLF LV+WAK IPH
Sbjct: 1   DMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPH 60

Query: 206 FTTLPLEDQVLLLRAGWNELLIASFSHRSISVKDGILLAPGVTVYRSSAHEAGVGGIFDR 265
           F+ LPL+DQV+LLRAGWNELLIASFSHRSI+VKDGILLA G+ V+R+SAH AGVG IFDR
Sbjct: 61  FSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDR 120

Query: 266 VLTELVSKMREMKMDKTELGCLRTIILFNPDVRGLKSQQVVEMLREKVYTSLEEYTRVNH 325
           VLTELVSKMR+M+MDKTELGCLR I+LFNPD +GL +   VE LREKVY SLE Y +  +
Sbjct: 121 VLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKY 180

Query: 326 SEEPGRFAKLLLRLPSLRSI 345
            E+PGRFAKLLLRLP+LRSI
Sbjct: 181 PEQPGRFAKLLLRLPALRSI 200


>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 Back     information, alignment and structure
>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d1dszb_84 Retinoid X receptor (RXR-alpha) DNA-binding domain 100.0
d2hanb183 Ecdysone receptor DNA-binding domain {Fruit fly (D 100.0
d1g2na_256 Ultraspiracle protein, usp {Heliothis virescens [T 100.0
d1kb2a_89 Vitamin D3 receptor, VDR, DNA-binding domain {Huma 100.0
d1dsza_75 Retinoic acid receptor DNA-binding domain {Human ( 100.0
d1lo1a_90 Steroid hormone receptor Err2 DNA-binding domain { 100.0
d1a6ya_78 Orphan nuclear receptor reverb DNA-binding domain 100.0
d2p1ta1230 Retinoid-X receptor alpha (RXR-alpha) {Human (Homo 100.0
d2nllb_103 Thyroid hormone receptor (TR-beta) DNA-binding dom 100.0
d1r4ia_74 Androgen receptor {Rat (Rattus norvegicus) [TaxId: 100.0
d1lata_71 Glucocorticoid receptor DNA-binding domain {Rat (R 100.0
d2e2ra1223 Orphan nuclear receptor ERR3 {Human (Homo sapiens) 99.98
d1cita_89 Orphan nuclear receptor NGFI-B DNA-binding domain 99.98
d1pzla_233 Hepatocyte nuclear factor 4-alpha {Human (Homo sap 99.98
d1hcqa_74 Estrogen receptor DNA-binding domain {Human and ch 99.98
d1hg4a_265 Ultraspiracle protein, usp {Drosophila melanogaste 99.97
d1pq9a_239 Oxysterols receptor LXR-beta {Human (Homo sapiens) 99.97
d3d24a1227 Steroid hormone receptor ERR1 {Human (Homo sapiens 99.97
d1fcya_236 Retinoic acid receptor gamma (RAR-gamma) {Human (H 99.97
d1n46a_251 Thyroid hormone receptor beta (TR-beta) {Human (Ho 99.97
d1pk5a_242 Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus 99.97
d1ovla_236 Orphan nuclear receptor NURR1 {Human (Homo sapiens 99.97
d2r40d1243 Ecdysone receptor {Noctuid moth (Heliothis viresce 99.97
d1xnxa_232 Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu 99.97
d1osha_231 Bile acid receptor FXR {Human (Homo sapiens) [TaxI 99.96
d1xvpb_246 Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s 99.96
d1pdua_230 Nuclear hormone receptor HR38 {Fruit fly (Drosophi 99.96
d1xpca_245 Estrogen receptor alpha {Human (Homo sapiens) [Tax 99.96
d1ie9a_255 Vitamin D nuclear receptor {Human (Homo sapiens) [ 99.96
d1t7ra_250 Androgen receptor {Chimpanzee (Pan troglodytes) [T 99.96
d2p54a1267 Peroxisome proliferator activated receptor alpha, 99.96
d1n83a_251 Orphan nuclear receptor ROR-alpha {Human (Homo sap 99.96
d1sqna_251 Progesterone receptor {Human (Homo sapiens) [TaxId 99.96
d1nhza_247 Glucocorticoid receptor {Human (Homo sapiens) [Tax 99.96
d2qw4a1233 Orphan nuclear receptor NR4A1 {Human (Homo sapiens 99.96
d2j7ya1236 Estrogen receptor beta {Rat (Rattus norvegicus) [T 99.96
d2b50b1265 Peroxisome proliferator-activated receptor delta, 99.96
d1nq7a_244 Orphan nuclear receptor ROR-beta {Rat (Rattus norv 99.96
d2fvja1271 Peroxisome proliferator activated receptor gamma, 99.96
d1nrla_292 Pregnane x receptor, PXR {Human (Homo sapiens) [Ta 99.95
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 85.67
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Retinoid X receptor (RXR-alpha) DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.9e-37  Score=217.44  Aligned_cols=80  Identities=86%  Similarity=1.634  Sum_probs=76.4

Q ss_pred             CCcCcccCCCCCCcccccccchhhHHHHHhhhcCCCcccccCCCCcccccccccCchhhhhHHHHhcCcchhHHHHHHhh
Q psy3092          55 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLSYACREGRNCIIDKRQRNRCQYCRYQKCLNMGMKREAVQEERQR  134 (347)
Q Consensus        55 ~~~C~VCg~~a~g~HyGv~sC~~Ck~FFRR~v~~~~~~~C~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~r~~  134 (347)
                      +++|.|||++|+|+||||.+|+|||+||||+|.++..|.|..+++|.+++..|..||+|||+|||++||++++||.+|++
T Consensus         5 ~~~C~VC~~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~c~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~Rdr   84 (84)
T d1dszb_           5 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR   84 (84)
T ss_dssp             CEECTTTCCEESSEETTEECCHHHHHHHHHHHHHTCCCCCSSCSCCCCCTTTTTTCHHHHHHHHHHTTCCGGGSCCCCCC
T ss_pred             CCcCccCCCcCCccCCCHHHHHHhHHHHHHHHhcCCCeeccCCCCcccCCCCCccCCCCccHHHHHcCCChHHcccccCC
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999988763



>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure